RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780257|ref|YP_003064670.1| SSU ribosomal protein S19P [Candidatus Liberibacter asiaticus str. psy62] (92 letters) >d2uubs1 d.28.1.1 (S:2-81) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]} Length = 80 Score = 110 bits (276), Expect = 4e-26 Identities = 37/76 (48%), Positives = 53/76 (69%) Query: 3 RSVRKGPFVTKSLLKKVSQARDSGGRGVVRVWCRNCDIMPQFIGLTFGVYNGRKHVPVSV 62 RS++KG FV LL+KV + G + +++ W R I+P+ +G T VYNG++HVPV + Sbjct: 2 RSLKKGVFVDDHLLEKVLELNAKGEKRLIKTWSRRSTIVPEMVGHTIAVYNGKQHVPVYI 61 Query: 63 SEEMVGFKLGDFAPTR 78 +E MVG KLG+FAPTR Sbjct: 62 TENMVGHKLGEFAPTR 77 >d2gy9s1 d.28.1.1 (S:2-80) Ribosomal protein S19 {Escherichia coli [TaxId: 562]} Length = 79 Score = 107 bits (270), Expect = 2e-25 Identities = 44/76 (57%), Positives = 56/76 (73%) Query: 3 RSVRKGPFVTKSLLKKVSQARDSGGRGVVRVWCRNCDIMPQFIGLTFGVYNGRKHVPVSV 62 RS++KGPF+ LLKKV +A +SG + +R W R I P IGLT V+NGR+HVPV V Sbjct: 1 RSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNMIGLTIAVHNGRQHVPVFV 60 Query: 63 SEEMVGFKLGDFAPTR 78 ++EMVG KLG+FAPTR Sbjct: 61 TDEMVGHKLGEFAPTR 76 >d2hi7b1 a.29.15.1 (B:14-162) Disulfide bond formation protein DsbB {Escherichia coli [TaxId: 562]} Length = 149 Score = 25.4 bits (55), Expect = 1.4 Identities = 4/24 (16%), Positives = 8/24 (33%) Query: 30 VVRVWCRNCDIMPQFIGLTFGVYN 53 V + + F+GL + Sbjct: 110 VFVASGDSAERQWDFLGLEMPQWL 133 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.323 0.139 0.437 Gapped Lambda K H 0.267 0.0696 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 352,771 Number of extensions: 14267 Number of successful extensions: 22 Number of sequences better than 10.0: 1 Number of HSP's gapped: 22 Number of HSP's successfully gapped: 7 Length of query: 92 Length of database: 2,407,596 Length adjustment: 56 Effective length of query: 36 Effective length of database: 1,638,716 Effective search space: 58993776 Effective search space used: 58993776 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (21.9 bits)