HHSEARCH alignment of GI: 254780258 and SCOP domain: d2qamc1

Alignment
>d2qamc1 b.34.5.3 (C:125-269) C-terminal domain of ribosomal protein L2 {Escherichia coli [TaxId: 562]}
Probab=100.00  E-value=0  Score=453.36  Aligned_cols=145  Identities=62%  Similarity=1.053  Sum_probs=141.7

Q ss_pred             CCCCHHHHHCCCCCEEEEEEEECCCCEEEEEECCCEEEEEEECCCEEEEEECCCCEEEECCCCEEEEEEECCCCCCCCCC
Q ss_conf             57411044357463776233303688258863465189967508889999489758998567809998512553323001
Q gi|254780258|r  127 PGNAMPLRFIPVGSIVHNVEMKPGKGGQISRSAGSYARLVERDRSRALLRLSSGEMRFVHSSCMASIGAVSNQDHSNVNH  206 (278)
Q Consensus       127 ~Gn~lpL~~IP~Gt~I~NIE~~pG~Ggkl~RsAGt~a~Ii~k~~~~~~ikLPSGe~r~i~~~c~AtIG~vsN~~~~~~~~  206 (278)
                      +||+|||.+||+||+|||||+.||+||||||||||||+|++||++|++|||||||+++|+++|+||||+|||.+|.++++
T Consensus         1 pGN~lpL~~IP~Gt~I~NIE~~pg~Ggkl~RsAGt~a~vi~k~~~~~~vkLPSGe~r~i~~~c~ATiG~vsn~~~~~~~~   80 (145)
T d2qamc1           1 PGNTLPMRNIPVGSTVHNVEMKPGKGGQLARSAGTYVQIVARDGAYVTLRLRSGEMRKVEADCRATLGEVGNAEHMLRVL   80 (145)
T ss_dssp             TTCCCBTTTSCSSCCCCSBCSSTTSCCCBSCSTTCCCEEEEEETTEEEEECTTSCEEEECSSCBCCSSCBSCCGGGGCCC
T ss_pred             CCCCCCHHHCCCCCEEEEEECCCCCCCCEEEECCCEEEEEEECCCEEEEEECCCCEEEECCCCCEEECCCCCHHHHCCHH
T ss_conf             96547373588998699884258997437651266899987549879999247666885120336750005014430000


Q ss_pred             CCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCCCCCCCEEEEEE
Q ss_conf             313441005779970123326874788888888888887887887343772548888886149962
Q gi|254780258|r  207 AKAGRARWLGMRSHVRGVAMNPVDHPHGGGEGKTSGGRNPCSPWGKLTKGKRTRSNKSTDVFIARS  272 (278)
Q Consensus       207 gKAG~~Rwlg~RP~VRGvAMNpvDHPhGGGeGkt~~gr~~~spwG~~~kg~kTr~~k~~~~~i~~~  272 (278)
                      +|||++||+|+||+|||||||||||||||||+++ +|++|+||||++|||+|||++|++|+|||+|
T Consensus        81 gKAG~~r~~g~rP~VRGvaMNpvdHPhGGg~~~~-~g~~p~tpwG~~~kg~kTr~~k~~~~~i~~r  145 (145)
T d2qamc1          81 GKAGAARWRGVRPTVRGTAMNPVDHPHGGGEGRN-FGKHPVTPWGVQTKGKKTRSNKRTDKFIVRR  145 (145)
T ss_dssp             CSHHHHHTTTCCCCCCGGGSCGGGCTTCCCSSSC-CCSCCBCTTSCBSSSCCCCCCSSSGGGBSSC
T ss_pred             CHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCEEEEC
T ss_conf             5356787578998311463267658888878888-9979979885258997389988878878769


SCOP domain information

class: All beta proteins
fold: SH3-like barrel
superfamily: Translation proteins SH3-like domain
family: C-terminal domain of ribosomal protein L2
domain: C-terminal domain of ribosomal protein L2
species: Escherichia coli [TaxId: 562]