BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780260|ref|YP_003064673.1| 50S ribosomal protein L4
[Candidatus Liberibacter asiaticus str. psy62]
         (207 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done


Results from round 1


>gi|254780260|ref|YP_003064673.1| 50S ribosomal protein L4 [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254039937|gb|ACT56733.1| 50S ribosomal protein L4 [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 207

 Score =  422 bits (1085), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 207/207 (100%), Positives = 207/207 (100%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT
Sbjct: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS
Sbjct: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG
Sbjct: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRFK 207
           INVYDILRCSKLVLSKSAIEALEDRFK
Sbjct: 181 INVYDILRCSKLVLSKSAIEALEDRFK 207


>gi|315122817|ref|YP_004063306.1| 50S ribosomal protein L4 [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313496219|gb|ADR52818.1| 50S ribosomal protein L4 [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 207

 Score =  367 bits (941), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 179/207 (86%), Positives = 189/207 (91%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           MIELSVR+LDG DKGVISVSE IFALKPQQGILARVLRWQSWR+  GCSKSKGRSE+AYT
Sbjct: 1   MIELSVRDLDGADKGVISVSEGIFALKPQQGILARVLRWQSWRRSKGCSKSKGRSEIAYT 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G+KMY QKGTGRARHSSKS  QFRGGGKAFGPVP  G H LPKK+RSLALRHALSDKF S
Sbjct: 61  GAKMYTQKGTGRARHSSKSAPQFRGGGKAFGPVPGNGAHDLPKKIRSLALRHALSDKFSS 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           NDI+VID+LVSKE KTKYL  RFRAL+LSNALIIDG QLDRNFQLAARNIPNINLL VQG
Sbjct: 121 NDILVIDSLVSKELKTKYLAERFRALNLSNALIIDGVQLDRNFQLAARNIPNINLLSVQG 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRFK 207
           INVYDILRCSKL+LSKSA+EALE RFK
Sbjct: 181 INVYDILRCSKLILSKSAVEALEGRFK 207


>gi|86357306|ref|YP_469198.1| 50S ribosomal protein L4 [Rhizobium etli CFN 42]
 gi|109893627|sp|Q2K9L5|RL4_RHIEC RecName: Full=50S ribosomal protein L4
 gi|86281408|gb|ABC90471.1| 50S ribosomal protein L4 [Rhizobium etli CFN 42]
 gi|327191387|gb|EGE58413.1| 50S ribosomal protein L4 [Rhizobium etli CNPAF512]
          Length = 206

 Score =  266 bits (681), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 127/206 (61%), Positives = 164/206 (79%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +EL+V+ L+G+D G +S+S++IF L+P++ ILARV+RWQ  +K+ G  K+KGR+EV+ TG
Sbjct: 1   MELNVKTLEGKDAGKVSLSDEIFGLEPREDILARVIRWQLAKKQQGTHKAKGRAEVSRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +KMY QKGTGRARH S    QFRGGGKA GPV     H LPKKVR+L LRHALS K  ++
Sbjct: 61  AKMYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHEHDLPKKVRALGLRHALSAKIKAD 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           D++VIDNLV+ E KTK L + F  L L+NAL I G +LD NF+LAA+NIPNI++LP+QGI
Sbjct: 121 DVIVIDNLVAAEAKTKALASAFETLGLTNALFIGGAELDGNFKLAAQNIPNIDVLPIQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDI+R  KLVLSK+A+EALE+RFK
Sbjct: 181 NVYDIVRRGKLVLSKAAVEALEERFK 206


>gi|218460209|ref|ZP_03500300.1| 50S ribosomal protein L4 [Rhizobium etli Kim 5]
          Length = 206

 Score =  266 bits (680), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 126/206 (61%), Positives = 164/206 (79%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +EL+V+ L+G+D G +S+S++IF L+P++ ILARV+RWQ  +K+ G  K+KGR+EV+ TG
Sbjct: 1   MELNVKTLEGKDAGKVSLSDEIFGLEPREDILARVIRWQLAKKQQGTHKAKGRAEVSRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +KMY QKGTGRARH S    QFRGGGKA GPV     H LPKKVR+L LRHALS K  ++
Sbjct: 61  AKMYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHEHDLPKKVRALGLRHALSAKIKAD 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           D++VIDNL++ E KTK L + F  L L+NAL I G +LD NF+LAA+NIPNI++LP+QGI
Sbjct: 121 DVIVIDNLIAAEAKTKALASAFETLGLTNALFIGGAELDGNFKLAAQNIPNIDVLPIQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDI+R  KLVLSK+A+EALE+RFK
Sbjct: 181 NVYDIVRRGKLVLSKAAVEALEERFK 206


>gi|218672011|ref|ZP_03521680.1| 50S ribosomal protein L4 [Rhizobium etli GR56]
          Length = 206

 Score =  266 bits (679), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 127/206 (61%), Positives = 164/206 (79%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +EL+V+ L+G+D G +S+S++IF L+P++ ILARV+RWQ  +K+ G  K+KGR+EV+ TG
Sbjct: 1   MELNVKTLEGKDAGKVSLSDEIFGLEPREDILARVIRWQLAKKQQGTHKAKGRAEVSRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +KMY QKGTGRARH S    QFRGGGKA GPV     H LPKKVR+L LRHALS K  ++
Sbjct: 61  AKMYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHEHDLPKKVRALGLRHALSAKIKAD 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           D++VIDNLV+ E KTK L + F  L L+NAL I G +LD NF+LAA+NIPNI++LP+QGI
Sbjct: 121 DVIVIDNLVAAEAKTKALASVFETLGLTNALFIGGAELDGNFKLAAQNIPNIDVLPIQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDI+R  KLVLSK+A+EALE+RFK
Sbjct: 181 NVYDIVRRGKLVLSKAAVEALEERFK 206


>gi|190891356|ref|YP_001977898.1| 50S ribosomal protein L4 [Rhizobium etli CIAT 652]
 gi|226730712|sp|B3PWS2|RL4_RHIE6 RecName: Full=50S ribosomal protein L4
 gi|190696635|gb|ACE90720.1| 50S ribosomal protein L4 [Rhizobium etli CIAT 652]
          Length = 206

 Score =  265 bits (678), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 127/206 (61%), Positives = 163/206 (79%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +EL+V+ L+G+D G +S+S+ IF L+P++ ILARV+RWQ  +K+ G  K+KGR+EV+ TG
Sbjct: 1   MELNVKTLEGKDAGKVSLSDAIFGLEPREDILARVIRWQLAKKQQGTHKAKGRAEVSRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +KMY QKGTGRARH S    QFRGGGKA GPV     H LPKKVR+L LRHALS K  ++
Sbjct: 61  AKMYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHEHDLPKKVRALGLRHALSAKIKAD 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           D++VIDNLV+ E KTK L + F  L L+NAL I G +LD NF+LAA+NIPNI++LP+QGI
Sbjct: 121 DVIVIDNLVATEAKTKALASAFETLGLTNALFIGGAELDGNFKLAAQNIPNIDVLPIQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDI+R  KLVLSK+A+EALE+RFK
Sbjct: 181 NVYDIVRRGKLVLSKAAVEALEERFK 206


>gi|325293335|ref|YP_004279199.1| 50S ribosomal protein L4 [Agrobacterium sp. H13-3]
 gi|325061188|gb|ADY64879.1| 50S ribosomal protein L4 [Agrobacterium sp. H13-3]
          Length = 206

 Score =  263 bits (672), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 125/206 (60%), Positives = 163/206 (79%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +EL+V+ L+G+D G +S+S++IF L P+Q ILAR++RWQ  +K+ G  K+K R+EV+ TG
Sbjct: 1   MELNVKTLEGKDAGKVSLSDEIFGLDPRQDILARMVRWQLAKKQQGTHKTKTRAEVSRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +KMY QKGTGRARH S    QFRGGGKA GPV     H LPKKVR+LALRHALS K  + 
Sbjct: 61  AKMYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHAHDLPKKVRALALRHALSAKLKAE 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           D++++D LV+ E KTK L+  F +L L+NAL+I G +LD NF+LAA+NIPN+++LPVQGI
Sbjct: 121 DLIIVDQLVASEAKTKALLGSFASLGLTNALVIGGAELDGNFKLAAQNIPNVDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR  KLVLSK+A+EALE+RFK
Sbjct: 181 NVYDILRRGKLVLSKAAVEALEERFK 206


>gi|116251541|ref|YP_767379.1| 50S ribosomal protein L4 [Rhizobium leguminosarum bv. viciae 3841]
 gi|166199852|sp|Q1MIE0|RL4_RHIL3 RecName: Full=50S ribosomal protein L4
 gi|115256189|emb|CAK07270.1| putative 50S ribosomal protein L4 [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 206

 Score =  263 bits (671), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 126/206 (61%), Positives = 162/206 (78%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +E +V+ L+G+D G +S+S+ IF L+P++ ILARV+RWQ  +K+ G  K+KGR+EV+ TG
Sbjct: 1   MEFNVKTLEGKDAGKVSLSDAIFGLEPREDILARVIRWQLAKKQQGTHKAKGRAEVSRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +KMY QKGTGRARH S    QFRGGGKA GPV     H LPKKVR+L LRHALS K  ++
Sbjct: 61  AKMYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHEHDLPKKVRALGLRHALSAKIKAD 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           D++VIDNLV+ E KTK L + F  L L+NAL I G +LD NF+LAA+NIPNI++LP+QGI
Sbjct: 121 DVIVIDNLVAAEAKTKSLASVFETLGLTNALFIGGAELDGNFKLAAQNIPNIDVLPIQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDI+R  KLVLSK+A+EALE+RFK
Sbjct: 181 NVYDIVRRGKLVLSKAAVEALEERFK 206


>gi|15889241|ref|NP_354922.1| 50S ribosomal protein L4 [Agrobacterium tumefaciens str. C58]
 gi|46576833|sp|Q8UE19|RL4_AGRT5 RecName: Full=50S ribosomal protein L4
 gi|15157068|gb|AAK87707.1| 50S ribosomal protein L4 [Agrobacterium tumefaciens str. C58]
          Length = 206

 Score =  263 bits (671), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 125/206 (60%), Positives = 163/206 (79%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +EL+V+ L+G+D G +S+S++IF L P+Q ILAR++RWQ  +K+ G  K+K RSEV+ TG
Sbjct: 1   MELNVKTLEGKDAGKVSLSDEIFGLDPRQDILARMVRWQLAKKQQGTHKTKNRSEVSRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +KMY QKGTGRARH S    QFRGGGKA GPV     H LPKKVR+LALRHALS K  + 
Sbjct: 61  AKMYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHAHDLPKKVRALALRHALSAKLKAE 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           +++++D LV+ E KTK L+  F +L L+NAL+I G +LD NF+LAA+NIPN+++LPVQGI
Sbjct: 121 ELIIVDQLVASEAKTKALLGSFASLGLTNALVIGGAELDGNFKLAAQNIPNVDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR  KLVLSK+A+EALE+RFK
Sbjct: 181 NVYDILRRGKLVLSKAAVEALEERFK 206


>gi|241204166|ref|YP_002975262.1| 50S ribosomal protein L4 [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240858056|gb|ACS55723.1| ribosomal protein L4/L1e [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 206

 Score =  262 bits (669), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 125/206 (60%), Positives = 162/206 (78%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +E +V+ L+G+D G +S+S+ IF L+P++ ILARV+RWQ  +K+ G  K+KGR+E++ TG
Sbjct: 1   MEFNVKTLEGKDAGKVSLSDAIFGLEPREDILARVIRWQLAKKQQGTHKAKGRAEISRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +KMY QKGTGRARH S    QFRGGGKA GPV     H LPKKVR+L LRHALS K  ++
Sbjct: 61  AKMYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHEHDLPKKVRALGLRHALSAKIKAD 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           D++VIDNLV+ E KTK L + F  L L+NAL I G +LD NF+LAA+NIPNI++LP+QGI
Sbjct: 121 DVIVIDNLVAAEAKTKSLASVFETLGLTNALFIGGAELDGNFKLAAQNIPNIDVLPIQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDI+R  KLVLSK+A+EALE+RFK
Sbjct: 181 NVYDIVRRGKLVLSKAAVEALEERFK 206


>gi|15965110|ref|NP_385463.1| 50S ribosomal protein L4 [Sinorhizobium meliloti 1021]
 gi|307314360|ref|ZP_07593966.1| ribosomal protein L4/L1e [Sinorhizobium meliloti BL225C]
 gi|307322072|ref|ZP_07601448.1| ribosomal protein L4/L1e [Sinorhizobium meliloti AK83]
 gi|46577284|sp|Q92QG9|RL4_RHIME RecName: Full=50S ribosomal protein L4
 gi|15074290|emb|CAC45936.1| Probable 50S ribosomal protein L4 [Sinorhizobium meliloti 1021]
 gi|306892254|gb|EFN23064.1| ribosomal protein L4/L1e [Sinorhizobium meliloti AK83]
 gi|306899058|gb|EFN29700.1| ribosomal protein L4/L1e [Sinorhizobium meliloti BL225C]
          Length = 206

 Score =  261 bits (666), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 124/206 (60%), Positives = 163/206 (79%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L+V+ L+G+D G +S+S+ IF L+P++ I+ARV+RWQ  +++ G  KSKGR+EV+ TG
Sbjct: 1   MDLTVKTLEGKDAGKVSLSDAIFGLEPREDIIARVVRWQLAKRQQGTHKSKGRAEVSRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +KMY QKGTGRARH S    QFRGGGKA GPV     H LPKK+R+L LRHALS K  + 
Sbjct: 61  AKMYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHAHDLPKKIRALGLRHALSAKLKAE 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           DI+VID+LV+ E KTK L   F +L L+NALII G +++ NF+LAA+NIPN+++LPVQGI
Sbjct: 121 DIIVIDDLVANEAKTKALAGAFASLGLTNALIIGGAEIEGNFKLAAQNIPNVDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR  KLVLSK+A+EALE+RFK
Sbjct: 181 NVYDILRRGKLVLSKAAVEALEERFK 206


>gi|227821757|ref|YP_002825727.1| 50S ribosomal protein L4 [Sinorhizobium fredii NGR234]
 gi|254803749|sp|C3MAY1|RL4_RHISN RecName: Full=50S ribosomal protein L4
 gi|227340756|gb|ACP24974.1| 50S ribosomal protein L4 [Sinorhizobium fredii NGR234]
          Length = 206

 Score =  259 bits (663), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 123/206 (59%), Positives = 163/206 (79%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L+V+ L+G+D G +S+S+ IF L+P++ I+ARV+RWQ  +++ G  K+KGR+EVA TG
Sbjct: 1   MDLTVKTLEGKDAGKVSLSDAIFGLEPREDIIARVVRWQLAKRQQGTHKAKGRAEVARTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +KMY QKGTGRARH S    QFRGGGKA GPV     H LPKKVR+L LRHALS K  + 
Sbjct: 61  AKMYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHAHDLPKKVRALGLRHALSAKLKAE 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           +I+V+D+LV+ E KTK L   F +L L+NALII G +++ NF+LAA+NIPN+++LPVQGI
Sbjct: 121 EIIVLDDLVANEAKTKALAGAFASLGLTNALIIGGAEIENNFKLAAQNIPNVDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR  KLVLSK+A+EALE+RFK
Sbjct: 181 NVYDILRRGKLVLSKAAVEALEERFK 206


>gi|222148367|ref|YP_002549324.1| 50S ribosomal protein L4 [Agrobacterium vitis S4]
 gi|254803708|sp|B9JVN8|RL4_AGRVS RecName: Full=50S ribosomal protein L4
 gi|221735355|gb|ACM36318.1| 50S ribosomal protein L4 [Agrobacterium vitis S4]
          Length = 206

 Score =  259 bits (662), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 125/206 (60%), Positives = 161/206 (78%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +EL+V+ L+G D G +S+S+ IF L+P+Q I+AR++RWQ  +K+ G  K+K R+EV+ TG
Sbjct: 1   MELNVKTLEGTDAGTVSLSDAIFGLEPRQDIIARMVRWQLAKKQQGTHKTKTRAEVSRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +KMY QKGTGRARH S    QFRGGGKA GPV     H LPKKVR+LALRHALS KF ++
Sbjct: 61  AKMYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHEHDLPKKVRALALRHALSAKFKAD 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           +++++D LV+ + KTK  V  F AL L NAL+I G +LD NF+LAA NIPNI++LPVQGI
Sbjct: 121 ELIIVDQLVAADAKTKAAVGVFEALGLKNALVIGGVELDVNFKLAAANIPNIDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR  KLVLSK+A+EALE+RFK
Sbjct: 181 NVYDILRRGKLVLSKAAVEALEERFK 206


>gi|209548936|ref|YP_002280853.1| 50S ribosomal protein L4 [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|226730713|sp|B5ZYT6|RL4_RHILW RecName: Full=50S ribosomal protein L4
 gi|209534692|gb|ACI54627.1| ribosomal protein L4/L1e [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 206

 Score =  258 bits (659), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 125/206 (60%), Positives = 161/206 (78%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +E +V+ L+G+D G +S+S+ IF L+P++ ILARV+RWQ  +K+ G  K+KGR+EV+ TG
Sbjct: 1   MEFNVKTLEGKDAGKVSLSDAIFGLEPREDILARVIRWQLAKKQQGTHKAKGRAEVSRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +KMY QKGTGRARH S    QFRGGGKA GPV     H LPKKVR+L LR ALS K  ++
Sbjct: 61  AKMYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHEHDLPKKVRALGLRLALSAKIKAD 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           D++VIDNLV+ E KTK L + F  L L+NAL I G +LD NF+LAA+NIPNI++LP+QGI
Sbjct: 121 DVIVIDNLVAAEAKTKALASVFETLGLTNALFIGGAELDGNFKLAAQNIPNIDVLPIQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDI+R  KLVLSK+A+EALE+RFK
Sbjct: 181 NVYDIVRRGKLVLSKAAVEALEERFK 206


>gi|150396208|ref|YP_001326675.1| 50S ribosomal protein L4 [Sinorhizobium medicae WSM419]
 gi|166199909|sp|A6U860|RL4_SINMW RecName: Full=50S ribosomal protein L4
 gi|150027723|gb|ABR59840.1| ribosomal protein L4/L1e [Sinorhizobium medicae WSM419]
          Length = 206

 Score =  258 bits (658), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 121/206 (58%), Positives = 163/206 (79%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L+V+ L+G+D G +S+S+ IF L+P++ I+ARV+RWQ  +++ G  K+KGR+EV+ TG
Sbjct: 1   MDLTVKTLEGKDAGKVSLSDAIFGLEPREDIIARVVRWQLAKRQQGTHKAKGRAEVSRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +KMY QKGTGRARH S    QFRGGGKA GPV     H LPKKVR+L LRHALS K  + 
Sbjct: 61  AKMYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHAHDLPKKVRALGLRHALSAKLKAE 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           +I+++D+LV+ E KTK L   F +L L+NALII G +++ NF+LAA+NIPN+++LPVQGI
Sbjct: 121 EIIIVDDLVANEAKTKALAGAFASLGLTNALIIGGAEIEGNFKLAAQNIPNVDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR  KLVLSK+A+EALE+RFK
Sbjct: 181 NVYDILRRGKLVLSKAAVEALEERFK 206


>gi|222085676|ref|YP_002544206.1| 50S ribosomal protein L4 [Agrobacterium radiobacter K84]
 gi|254803707|sp|B9JDS9|RL4_AGRRK RecName: Full=50S ribosomal protein L4
 gi|221723124|gb|ACM26280.1| 50S ribosomal protein L4 [Agrobacterium radiobacter K84]
          Length = 206

 Score =  256 bits (655), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 124/206 (60%), Positives = 159/206 (77%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +EL+V+ L+G+D G +S+S+ IF L+P++ I+ARV+RWQ  +KR G  K++GR+EV+ TG
Sbjct: 1   MELNVKTLEGKDAGKVSLSDAIFGLEPREDIIARVIRWQLAKKRQGTHKAQGRAEVSRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +KMY QKGTGRARH S    QFRGGGKA GPV     H LPKKVR+L LR ALS K  + 
Sbjct: 61  AKMYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHEHDLPKKVRALGLRLALSAKLKAE 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           D++++DNLV+ + KTK L   F  L L+NAL I G +LD NF+LAA NIPNI++LPVQGI
Sbjct: 121 DVIILDNLVAADAKTKALAGAFETLGLTNALFIGGAELDSNFKLAAANIPNIDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR  KLVLSK+A+EALE+RFK
Sbjct: 181 NVYDILRRGKLVLSKAAVEALEERFK 206


>gi|260468553|ref|ZP_05813720.1| ribosomal protein L4/L1e [Mesorhizobium opportunistum WSM2075]
 gi|259028709|gb|EEW30018.1| ribosomal protein L4/L1e [Mesorhizobium opportunistum WSM2075]
          Length = 206

 Score =  250 bits (638), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 122/206 (59%), Positives = 153/206 (74%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L +  L G+D G + +SE+IF L P++ IL RV+RWQ  +K+ G  K+KGR+E+A TG
Sbjct: 1   MDLKITTLGGKDAGKVKLSEEIFGLDPREDILQRVVRWQLAKKQQGTHKAKGRAEIARTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +KMY QKGTGRARH S    QFRGGGKA GPV     H LPKKVR+L L+HALS K  S 
Sbjct: 61  AKMYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHEHDLPKKVRALGLKHALSAKAKSA 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            I++ID L   E KTK L+  F  L LSNAL+I G +LD+NF+LAA NIPNI++LP+QGI
Sbjct: 121 SIIIIDELKLTEAKTKALIANFATLGLSNALVIGGAELDQNFKLAATNIPNIDVLPIQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR   LVLSK+A+EALE+RFK
Sbjct: 181 NVYDILRRGTLVLSKAAVEALEERFK 206


>gi|294852569|ref|ZP_06793242.1| 50S ribosomal protein L4/L1 [Brucella sp. NVSL 07-0026]
 gi|294821158|gb|EFG38157.1| 50S ribosomal protein L4/L1 [Brucella sp. NVSL 07-0026]
          Length = 206

 Score =  249 bits (636), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 120/206 (58%), Positives = 157/206 (76%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L++  L+G+D G + ++E+IF L P+  IL RV+RWQ  R++ G  K++GR +V+ TG
Sbjct: 1   MDLTITTLEGKDAGKVKLNEEIFGLDPRDDILQRVVRWQLARRQQGSHKAQGRGDVSRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           SKMY QKGTGRARH S    QFRGGG+A GPV     H LPKKVR+L LRHALS K  ++
Sbjct: 61  SKMYKQKGTGRARHHSARAPQFRGGGQAHGPVVRNHDHDLPKKVRALGLRHALSAKAKAS 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           D+++ID+L S + KTK LV++F  L L NAL+I G ++D NFQ AA NIPNI++LPVQGI
Sbjct: 121 DLIIIDDLASADAKTKQLVSQFAKLGLENALLIGGAEIDANFQRAASNIPNIDMLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR  KLVLSK+A+EALE+RFK
Sbjct: 181 NVYDILRRGKLVLSKAAVEALEERFK 206


>gi|13470552|ref|NP_102121.1| 50S ribosomal protein L4 [Mesorhizobium loti MAFF303099]
 gi|46577286|sp|Q98N56|RL4_RHILO RecName: Full=50S ribosomal protein L4
 gi|14021294|dbj|BAB47907.1| 50S ribosomal protein L4 [Mesorhizobium loti MAFF303099]
          Length = 206

 Score =  249 bits (636), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 122/206 (59%), Positives = 152/206 (73%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L +  L G+D G + +SE+IF L P++ IL RV+RWQ  +K+ G  K+KGR+E+A TG
Sbjct: 1   MDLKITTLGGKDAGKVKLSEEIFGLDPREDILQRVVRWQLAKKQQGTHKAKGRAEIARTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +KMY QKGTGRARH S    QFRGGGKA GPV     H LPK VR+L L+HALS K  S 
Sbjct: 61  AKMYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHEHDLPKNVRALGLKHALSAKAKSA 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            I+VID L   E KTK L+  F  L LSNAL+I G +LD+NF+LAA NIPNI++LP+QGI
Sbjct: 121 SIIVIDELKLTEAKTKALIANFATLGLSNALVIGGAELDKNFKLAATNIPNIDVLPIQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR   LVLSK+A+EALE+RFK
Sbjct: 181 NVYDILRRGTLVLSKAAVEALEERFK 206


>gi|319783321|ref|YP_004142797.1| ribosomal protein L4/L1e [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317169209|gb|ADV12747.1| ribosomal protein L4/L1e [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 206

 Score =  249 bits (635), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 120/206 (58%), Positives = 153/206 (74%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L +  L G+D G + +S++IF L P++ IL RV+RWQ  +K+ G  K+KGR+E+A TG
Sbjct: 1   MDLKITTLGGKDAGKVELSDEIFGLDPREDILQRVVRWQLAKKQQGTHKTKGRAEIARTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +KMY QKGTGRARH S    QFRGGGKA GPV     H LPKKVR+L L+HALS K  S 
Sbjct: 61  AKMYKQKGTGRARHHSARAPQFRGGGKAHGPVVRSHEHELPKKVRALGLKHALSAKAKSA 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            I++ID L   E KTK L+  F  L L+NAL+I G +LD+NF+LAA NIPNI++LP+QGI
Sbjct: 121 SIIIIDELKLTEAKTKALIANFATLGLTNALLIGGAELDKNFKLAATNIPNIDVLPIQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR   LVLSK+A+EALE+RFK
Sbjct: 181 NVYDILRRGTLVLSKAAVEALEERFK 206


>gi|110634029|ref|YP_674237.1| 50S ribosomal protein L4 [Mesorhizobium sp. BNC1]
 gi|123057912|sp|Q11HQ3|RL4_MESSB RecName: Full=50S ribosomal protein L4
 gi|110285013|gb|ABG63072.1| LSU ribosomal protein L4P [Chelativorans sp. BNC1]
          Length = 206

 Score =  249 bits (635), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 119/206 (57%), Positives = 155/206 (75%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L V  L G+D G + VS++IF L P++ IL RV+RWQ  +++ G  K+KGR+E+A TG
Sbjct: 1   MDLKVTTLAGKDAGKVEVSDEIFGLDPREDILHRVVRWQLAKRQQGTHKAKGRAEIARTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +KMY QKGTGRARHSS    QFRGGGKA GPVP    H LPKKVR+L L+HALS K  S 
Sbjct: 61  AKMYRQKGTGRARHSSARAPQFRGGGKAHGPVPHSHAHDLPKKVRALGLKHALSAKAKSA 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           +++++D+L  KE KTK LV  F  L ++NAL+I G ++D  F+ AA NIPNI++LP+QGI
Sbjct: 121 NLIIVDDLAIKEAKTKALVESFAKLGVTNALMIGGAEIDAGFKRAAANIPNIDVLPIQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR   LVLSK+A+EALE+RFK
Sbjct: 181 NVYDILRRGTLVLSKAAVEALEERFK 206


>gi|239832121|ref|ZP_04680450.1| 50S ribosomal protein L4 [Ochrobactrum intermedium LMG 3301]
 gi|239824388|gb|EEQ95956.1| 50S ribosomal protein L4 [Ochrobactrum intermedium LMG 3301]
          Length = 206

 Score =  248 bits (634), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 119/206 (57%), Positives = 157/206 (76%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L++  L+G+D G + ++E+IF L P+  IL RV+RWQ  R++ G  K++GR +V+ TG
Sbjct: 1   MDLTITTLEGKDAGKVKLNEEIFGLDPRDDILQRVVRWQLARRQQGSHKAQGRGDVSRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +KMY QKGTGRARH S    QFRGGG+A GPV     H LPKKVR+L LRHALS K  ++
Sbjct: 61  AKMYKQKGTGRARHHSARAPQFRGGGQAHGPVVRSHDHDLPKKVRALGLRHALSAKAKAS 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           D+++ID+L + E KTK LV++F  L L NAL+I G ++D NFQ AA NIPNI++LPVQGI
Sbjct: 121 DLIIIDDLAATEAKTKQLVSQFAKLGLENALLIGGAEIDANFQRAASNIPNIDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR  KLVLSK+A+EALE+RFK
Sbjct: 181 NVYDILRRGKLVLSKAAVEALEERFK 206


>gi|23502109|ref|NP_698236.1| 50S ribosomal protein L4 [Brucella suis 1330]
 gi|62290143|ref|YP_221936.1| 50S ribosomal protein L4 [Brucella abortus bv. 1 str. 9-941]
 gi|82700066|ref|YP_414640.1| 50S ribosomal protein L4 [Brucella melitensis biovar Abortus 2308]
 gi|148559402|ref|YP_001259152.1| 50S ribosomal protein L4 [Brucella ovis ATCC 25840]
 gi|161619188|ref|YP_001593075.1| 50S ribosomal protein L4 [Brucella canis ATCC 23365]
 gi|163843498|ref|YP_001627902.1| 50S ribosomal protein L4 [Brucella suis ATCC 23445]
 gi|189024381|ref|YP_001935149.1| Ribosomal protein L4/L1e [Brucella abortus S19]
 gi|225627702|ref|ZP_03785739.1| 50S ribosomal protein L4 [Brucella ceti str. Cudo]
 gi|225852729|ref|YP_002732962.1| 50S ribosomal protein L4 [Brucella melitensis ATCC 23457]
 gi|237815651|ref|ZP_04594648.1| 50S ribosomal protein L4 [Brucella abortus str. 2308 A]
 gi|254689452|ref|ZP_05152706.1| 50S ribosomal protein L4 [Brucella abortus bv. 6 str. 870]
 gi|254693937|ref|ZP_05155765.1| 50S ribosomal protein L4 [Brucella abortus bv. 3 str. Tulya]
 gi|254697587|ref|ZP_05159415.1| 50S ribosomal protein L4 [Brucella abortus bv. 2 str. 86/8/59]
 gi|254701973|ref|ZP_05163801.1| 50S ribosomal protein L4 [Brucella suis bv. 5 str. 513]
 gi|254704517|ref|ZP_05166345.1| 50S ribosomal protein L4 [Brucella suis bv. 3 str. 686]
 gi|254706587|ref|ZP_05168415.1| 50S ribosomal protein L4 [Brucella pinnipedialis M163/99/10]
 gi|254710303|ref|ZP_05172114.1| 50S ribosomal protein L4 [Brucella pinnipedialis B2/94]
 gi|254714300|ref|ZP_05176111.1| 50S ribosomal protein L4 [Brucella ceti M644/93/1]
 gi|254717737|ref|ZP_05179548.1| 50S ribosomal protein L4 [Brucella ceti M13/05/1]
 gi|254730481|ref|ZP_05189059.1| 50S ribosomal protein L4 [Brucella abortus bv. 4 str. 292]
 gi|256031797|ref|ZP_05445411.1| 50S ribosomal protein L4 [Brucella pinnipedialis M292/94/1]
 gi|256044882|ref|ZP_05447786.1| 50S ribosomal protein L4 [Brucella melitensis bv. 1 str. Rev.1]
 gi|256061312|ref|ZP_05451462.1| 50S ribosomal protein L4 [Brucella neotomae 5K33]
 gi|256113786|ref|ZP_05454590.1| 50S ribosomal protein L4 [Brucella melitensis bv. 3 str. Ether]
 gi|256257698|ref|ZP_05463234.1| 50S ribosomal protein L4 [Brucella abortus bv. 9 str. C68]
 gi|256263781|ref|ZP_05466313.1| ribosomal protein L4 [Brucella melitensis bv. 2 str. 63/9]
 gi|260168931|ref|ZP_05755742.1| 50S ribosomal protein L4 [Brucella sp. F5/99]
 gi|260546691|ref|ZP_05822430.1| ribosomal protein L4 [Brucella abortus NCTC 8038]
 gi|260565516|ref|ZP_05836000.1| ribosomal protein L4/L1e [Brucella melitensis bv. 1 str. 16M]
 gi|260566239|ref|ZP_05836709.1| ribosomal protein L4/L1e [Brucella suis bv. 4 str. 40]
 gi|260754975|ref|ZP_05867323.1| ribosomal protein L4 [Brucella abortus bv. 6 str. 870]
 gi|260758191|ref|ZP_05870539.1| ribosomal protein L4 [Brucella abortus bv. 4 str. 292]
 gi|260762017|ref|ZP_05874360.1| ribosomal protein L4 [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883984|ref|ZP_05895598.1| ribosomal protein L4 [Brucella abortus bv. 9 str. C68]
 gi|261214229|ref|ZP_05928510.1| ribosomal protein L4 [Brucella abortus bv. 3 str. Tulya]
 gi|261219580|ref|ZP_05933861.1| ribosomal protein L4 [Brucella ceti M13/05/1]
 gi|261314047|ref|ZP_05953244.1| ribosomal protein L4 [Brucella pinnipedialis M163/99/10]
 gi|261317866|ref|ZP_05957063.1| ribosomal protein L4 [Brucella pinnipedialis B2/94]
 gi|261322075|ref|ZP_05961272.1| ribosomal protein L4 [Brucella ceti M644/93/1]
 gi|261325319|ref|ZP_05964516.1| ribosomal protein L4 [Brucella neotomae 5K33]
 gi|261752541|ref|ZP_05996250.1| ribosomal protein L4 [Brucella suis bv. 5 str. 513]
 gi|261755200|ref|ZP_05998909.1| ribosomal protein L4 [Brucella suis bv. 3 str. 686]
 gi|261758424|ref|ZP_06002133.1| ribosomal protein L4 [Brucella sp. F5/99]
 gi|265988895|ref|ZP_06101452.1| ribosomal protein L4 [Brucella pinnipedialis M292/94/1]
 gi|265991309|ref|ZP_06103866.1| ribosomal protein L4 [Brucella melitensis bv. 1 str. Rev.1]
 gi|265995146|ref|ZP_06107703.1| ribosomal protein L4 [Brucella melitensis bv. 3 str. Ether]
 gi|297248538|ref|ZP_06932256.1| 50S ribosomal protein L4/L1 [Brucella abortus bv. 5 str. B3196]
 gi|306840302|ref|ZP_07473074.1| 50S ribosomal protein L4 [Brucella sp. BO2]
 gi|306844136|ref|ZP_07476730.1| 50S ribosomal protein L4 [Brucella sp. BO1]
 gi|46577272|sp|Q8G077|RL4_BRUSU RecName: Full=50S ribosomal protein L4
 gi|51338733|sp|Q8YHN9|RL4_BRUME RecName: Full=50S ribosomal protein L4
 gi|75496682|sp|Q57CQ9|RL4_BRUAB RecName: Full=50S ribosomal protein L4
 gi|109893579|sp|Q2YM04|RL4_BRUA2 RecName: Full=50S ribosomal protein L4
 gi|166234640|sp|A5VR05|RL4_BRUO2 RecName: Full=50S ribosomal protein L4
 gi|189029492|sp|A9M5P9|RL4_BRUC2 RecName: Full=50S ribosomal protein L4
 gi|189029493|sp|B0CH31|RL4_BRUSI RecName: Full=50S ribosomal protein L4
 gi|226730626|sp|B2S678|RL4_BRUA1 RecName: Full=50S ribosomal protein L4
 gi|254803720|sp|C0RJK0|RL4_BRUMB RecName: Full=50S ribosomal protein L4
 gi|23348069|gb|AAN30151.1| ribosomal protein L4 [Brucella suis 1330]
 gi|62196275|gb|AAX74575.1| RplD, ribosomal protein L4 [Brucella abortus bv. 1 str. 9-941]
 gi|82616167|emb|CAJ11210.1| Ribosomal protein L4/L1e [Brucella melitensis biovar Abortus 2308]
 gi|82798166|gb|ABB91835.1| ribosomal protein L4 [Brucella abortus]
 gi|82798168|gb|ABB91836.1| ribosomal protein L4 [Brucella abortus]
 gi|82798170|gb|ABB91837.1| ribosomal protein L4 [Brucella abortus]
 gi|82798172|gb|ABB91838.1| ribosomal protein L4 [Brucella abortus]
 gi|82798174|gb|ABB91839.1| ribosomal protein L4 [Brucella abortus]
 gi|82798176|gb|ABB91840.1| ribosomal protein L4 [Brucella abortus]
 gi|82798178|gb|ABB91841.1| ribosomal protein L4 [Brucella abortus]
 gi|82798180|gb|ABB91842.1| ribosomal protein L4 [Brucella canis]
 gi|82798182|gb|ABB91843.1| ribosomal protein L4 [Brucella melitensis biovar Melitensis]
 gi|82798184|gb|ABB91844.1| ribosomal protein L4 [Brucella melitensis biovar Melitensis]
 gi|82798186|gb|ABB91845.1| ribosomal protein L4 [Brucella melitensis biovar Melitensis]
 gi|82798188|gb|ABB91846.1| ribosomal protein L4 [Brucella neotomae 5K33]
 gi|82798190|gb|ABB91847.1| ribosomal protein L4 [Brucella ovis]
 gi|82798192|gb|ABB91848.1| ribosomal protein L4 [Brucella suis 1330]
 gi|82798194|gb|ABB91849.1| ribosomal protein L4 [Brucella suis ATCC 23445]
 gi|82798196|gb|ABB91850.1| ribosomal protein L4 [Brucella suis bv. 3 str. 686]
 gi|82798198|gb|ABB91851.1| ribosomal protein L4 [Brucella suis bv. 4 str. 40]
 gi|82798200|gb|ABB91852.1| ribosomal protein L4 [Brucella suis]
 gi|82798202|gb|ABB91853.1| ribosomal protein L4 [Brucella pinnipedialis]
 gi|82798204|gb|ABB91854.1| ribosomal protein L4 [Brucella ceti]
 gi|148370659|gb|ABQ60638.1| ribosomal protein L4 [Brucella ovis ATCC 25840]
 gi|161335999|gb|ABX62304.1| 50S ribosomal protein L4 [Brucella canis ATCC 23365]
 gi|163674221|gb|ABY38332.1| 50S ribosomal protein L4 [Brucella suis ATCC 23445]
 gi|189019953|gb|ACD72675.1| Ribosomal protein L4/L1e [Brucella abortus S19]
 gi|225617707|gb|EEH14752.1| 50S ribosomal protein L4 [Brucella ceti str. Cudo]
 gi|225641094|gb|ACO01008.1| 50S ribosomal protein L4 [Brucella melitensis ATCC 23457]
 gi|237788949|gb|EEP63160.1| 50S ribosomal protein L4 [Brucella abortus str. 2308 A]
 gi|260095741|gb|EEW79618.1| ribosomal protein L4 [Brucella abortus NCTC 8038]
 gi|260151584|gb|EEW86678.1| ribosomal protein L4/L1e [Brucella melitensis bv. 1 str. 16M]
 gi|260155757|gb|EEW90837.1| ribosomal protein L4/L1e [Brucella suis bv. 4 str. 40]
 gi|260668509|gb|EEX55449.1| ribosomal protein L4 [Brucella abortus bv. 4 str. 292]
 gi|260672449|gb|EEX59270.1| ribosomal protein L4 [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675083|gb|EEX61904.1| ribosomal protein L4 [Brucella abortus bv. 6 str. 870]
 gi|260873512|gb|EEX80581.1| ribosomal protein L4 [Brucella abortus bv. 9 str. C68]
 gi|260915836|gb|EEX82697.1| ribosomal protein L4 [Brucella abortus bv. 3 str. Tulya]
 gi|260924669|gb|EEX91237.1| ribosomal protein L4 [Brucella ceti M13/05/1]
 gi|261294765|gb|EEX98261.1| ribosomal protein L4 [Brucella ceti M644/93/1]
 gi|261297089|gb|EEY00586.1| ribosomal protein L4 [Brucella pinnipedialis B2/94]
 gi|261301299|gb|EEY04796.1| ribosomal protein L4 [Brucella neotomae 5K33]
 gi|261303073|gb|EEY06570.1| ribosomal protein L4 [Brucella pinnipedialis M163/99/10]
 gi|261738408|gb|EEY26404.1| ribosomal protein L4 [Brucella sp. F5/99]
 gi|261742294|gb|EEY30220.1| ribosomal protein L4 [Brucella suis bv. 5 str. 513]
 gi|261744953|gb|EEY32879.1| ribosomal protein L4 [Brucella suis bv. 3 str. 686]
 gi|262766259|gb|EEZ12048.1| ribosomal protein L4 [Brucella melitensis bv. 3 str. Ether]
 gi|263002093|gb|EEZ14668.1| ribosomal protein L4 [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093909|gb|EEZ17843.1| ribosomal protein L4 [Brucella melitensis bv. 2 str. 63/9]
 gi|264661092|gb|EEZ31353.1| ribosomal protein L4 [Brucella pinnipedialis M292/94/1]
 gi|297175707|gb|EFH35054.1| 50S ribosomal protein L4/L1 [Brucella abortus bv. 5 str. B3196]
 gi|306275579|gb|EFM57311.1| 50S ribosomal protein L4 [Brucella sp. BO1]
 gi|306289701|gb|EFM60890.1| 50S ribosomal protein L4 [Brucella sp. BO2]
 gi|326409254|gb|ADZ66319.1| Ribosomal protein L4/L1e [Brucella melitensis M28]
 gi|326538962|gb|ADZ87177.1| 50S ribosomal protein L4 [Brucella melitensis M5-90]
          Length = 206

 Score =  248 bits (634), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 120/206 (58%), Positives = 157/206 (76%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L++  L+G+D G + ++E+IF L P+  IL RV+RWQ  R++ G  K++GR +V+ TG
Sbjct: 1   MDLTITTLEGKDAGKVKLNEEIFGLDPRDDILQRVVRWQLARRQQGSHKAQGRGDVSRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           SKMY QKGTGRARH S    QFRGGG+A GPV     H LPKKVR+L LRHALS K  ++
Sbjct: 61  SKMYKQKGTGRARHHSARAPQFRGGGQAHGPVVRNHDHDLPKKVRALGLRHALSAKAKAS 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           D+++ID+L S + KTK LV++F  L L NAL+I G ++D NFQ AA NIPNI++LPVQGI
Sbjct: 121 DLIIIDDLASADAKTKQLVSQFAKLGLENALLIGGAEIDANFQRAASNIPNIDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR  KLVLSK+A+EALE+RFK
Sbjct: 181 NVYDILRRGKLVLSKAAVEALEERFK 206


>gi|153009287|ref|YP_001370502.1| 50S ribosomal protein L4 [Ochrobactrum anthropi ATCC 49188]
 gi|166234695|sp|A6X0B9|RL4_OCHA4 RecName: Full=50S ribosomal protein L4
 gi|151561175|gb|ABS14673.1| ribosomal protein L4/L1e [Ochrobactrum anthropi ATCC 49188]
          Length = 206

 Score =  248 bits (634), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 119/206 (57%), Positives = 157/206 (76%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L++  L+G+D G + ++E+IF L P+  IL RV+RWQ  R++ G  K++GR +V+ TG
Sbjct: 1   MDLTITTLEGKDAGKVKLNEEIFGLDPRDDILQRVVRWQLARRQQGSHKAQGRGDVSRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +KMY QKGTGRARH S    QFRGGG+A GPV     H LPKKVR+L LRHALS K  ++
Sbjct: 61  AKMYKQKGTGRARHHSARAPQFRGGGQAHGPVVRSHDHDLPKKVRALGLRHALSAKAKAS 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           D+++ID+L + E KTK LV++F  L L NAL+I G ++D NFQ AA NIPNI++LPVQGI
Sbjct: 121 DLIIIDDLAATEAKTKQLVSQFAKLGLENALVIGGAEIDVNFQRAASNIPNIDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR  KLVLSK+A+EALE+RFK
Sbjct: 181 NVYDILRRGKLVLSKAAVEALEERFK 206


>gi|254719290|ref|ZP_05181101.1| 50S ribosomal protein L4 [Brucella sp. 83/13]
 gi|265984290|ref|ZP_06097025.1| ribosomal protein L4 [Brucella sp. 83/13]
 gi|306838042|ref|ZP_07470900.1| 50S ribosomal protein L4 [Brucella sp. NF 2653]
 gi|264662882|gb|EEZ33143.1| ribosomal protein L4 [Brucella sp. 83/13]
 gi|306406966|gb|EFM63187.1| 50S ribosomal protein L4 [Brucella sp. NF 2653]
          Length = 206

 Score =  246 bits (629), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 119/206 (57%), Positives = 156/206 (75%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L++  L+G+D G + ++E+IF L P+  IL RV+RWQ   ++ G  K++GR +V+ TG
Sbjct: 1   MDLTITTLEGKDAGKVKLNEEIFGLDPRDDILQRVVRWQLAHRQQGSHKAQGRGDVSRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           SKMY QKGTGRARH S    QFRGGG+A GPV     H LPKKVR+L LRHALS K  ++
Sbjct: 61  SKMYKQKGTGRARHHSARAPQFRGGGQAHGPVVRNHDHDLPKKVRALGLRHALSAKAKAS 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           D+++ID+L S + KTK LV++F  L L NAL+I G ++D NFQ AA NIPNI++LPVQGI
Sbjct: 121 DLIIIDDLASADAKTKQLVSQFAKLGLENALLIGGAEIDANFQRAASNIPNIDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR  KLVLSK+A+EALE+RFK
Sbjct: 181 NVYDILRRGKLVLSKAAVEALEERFK 206


>gi|110180290|gb|ABG54388.1| 23S ribosomal protein L4 [Brucella pinnipedialis]
          Length = 206

 Score =  246 bits (627), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 119/206 (57%), Positives = 156/206 (75%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L++  L+G+D G + ++E+IF L P+  IL RV+RWQ  R++ G  K++GR +V+ TG
Sbjct: 1   MDLTITTLEGKDAGKVKLNEEIFGLDPRDDILQRVVRWQLARRQQGSHKAQGRGDVSRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           SKMY QKGTGRA H S    QFRGGG+A GPV     H LPKKVR+L LRHALS K  ++
Sbjct: 61  SKMYKQKGTGRASHHSARAPQFRGGGQAHGPVVRNHDHDLPKKVRALGLRHALSAKAKAS 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           D+++ID+L S + KTK LV++F  L L NAL+I G ++D NFQ AA NIPNI++LPVQGI
Sbjct: 121 DLIIIDDLASADAKTKQLVSQFAKLGLENALLIGGAEIDANFQRAASNIPNIDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR  KLVLSK+A+EALE+RFK
Sbjct: 181 NVYDILRRGKLVLSKAAVEALEERFK 206


>gi|256369656|ref|YP_003107166.1| 50S ribosomal protein L4 [Brucella microti CCM 4915]
 gi|255999818|gb|ACU48217.1| 50S ribosomal protein L4 [Brucella microti CCM 4915]
          Length = 206

 Score =  245 bits (626), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 119/206 (57%), Positives = 156/206 (75%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L++  L+G+D   + ++E+IF L P+  IL RV+RWQ  R++ G  K++GR +V+ TG
Sbjct: 1   MDLTITTLEGKDADKVKLNEEIFGLDPRDDILQRVVRWQLARRQQGSHKAQGRGDVSRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           SKMY QKGTGRARH S    QFRGGG+A GPV     H LPKKVR+L LRHALS K  ++
Sbjct: 61  SKMYKQKGTGRARHHSARAPQFRGGGQAHGPVVRNHDHDLPKKVRALGLRHALSAKAKAS 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           D+++ID+L S + KTK LV++F  L L NAL+I G ++D NFQ AA NIPNI++LPVQGI
Sbjct: 121 DLIIIDDLASADAKTKQLVSQFAKLGLENALLIGGAEIDANFQRAASNIPNIDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR  KLVLSK+A+EALE+RFK
Sbjct: 181 NVYDILRRGKLVLSKAAVEALEERFK 206


>gi|110180274|gb|ABG54380.1| 23S ribosomal protein L4 [Brucella ceti]
 gi|110180278|gb|ABG54382.1| 23S ribosomal protein L4 [Brucella ceti]
          Length = 206

 Score =  245 bits (626), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 119/206 (57%), Positives = 156/206 (75%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L++  L+G+D G + ++E+IF L P+  IL RV+RWQ  R++ G  K++GR +V+ TG
Sbjct: 1   MDLTITTLEGKDAGKVKLNEEIFGLDPRDDILQRVVRWQLARRQQGSHKAQGRGDVSRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           SKMY QKGT RARH S    QFRGGG+A GPV     H LPKKVR+L LRHALS K  ++
Sbjct: 61  SKMYKQKGTDRARHHSARAPQFRGGGQAHGPVVRNHDHDLPKKVRALGLRHALSAKAKAS 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           D+++ID+L S + KTK LV++F  L L NAL+I G ++D NFQ AA NIPNI++LPVQGI
Sbjct: 121 DLIIIDDLASADAKTKQLVSQFAKLGLENALLIGGAEIDANFQRAASNIPNIDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR  KLVLSK+A+EALE+RFK
Sbjct: 181 NVYDILRRGKLVLSKAAVEALEERFK 206


>gi|256159967|ref|ZP_05457685.1| 50S ribosomal protein L4 [Brucella ceti M490/95/1]
 gi|256255198|ref|ZP_05460734.1| 50S ribosomal protein L4 [Brucella ceti B1/94]
 gi|261222394|ref|ZP_05936675.1| ribosomal protein L4 [Brucella ceti B1/94]
 gi|265998359|ref|ZP_06110916.1| ribosomal protein L4 [Brucella ceti M490/95/1]
 gi|82798206|gb|ABB91855.1| ribosomal protein L4 [Brucella ceti]
 gi|260920978|gb|EEX87631.1| ribosomal protein L4 [Brucella ceti B1/94]
 gi|262552827|gb|EEZ08817.1| ribosomal protein L4 [Brucella ceti M490/95/1]
          Length = 206

 Score =  245 bits (625), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 119/206 (57%), Positives = 156/206 (75%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L++  L+G+D G + ++E+IF L P+  IL RV+RWQ  R++ G  K++GR +V+ TG
Sbjct: 1   MDLTITTLEGKDAGKVKLNEEIFGLDPRDDILQRVVRWQLARRQQGSHKAQGRGDVSRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           SKMY QKGTGRARH S    QFRGGG+A GPV     H LPKKV +L LRHALS K  ++
Sbjct: 61  SKMYKQKGTGRARHHSARAPQFRGGGQAHGPVVRNHDHDLPKKVLALGLRHALSAKAKAS 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           D+++ID+L S + KTK LV++F  L L NAL+I G ++D NFQ AA NIPNI++LPVQGI
Sbjct: 121 DLIIIDDLASADAKTKQLVSQFAKLGLENALLIGGAEIDANFQRAASNIPNIDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR  KLVLSK+A+EALE+RFK
Sbjct: 181 NVYDILRRGKLVLSKAAVEALEERFK 206


>gi|110180276|gb|ABG54381.1| 23S ribosomal protein L4 [Brucella ceti]
 gi|110180280|gb|ABG54383.1| 23S ribosomal protein L4 [Brucella ceti]
          Length = 206

 Score =  244 bits (622), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 119/206 (57%), Positives = 156/206 (75%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L++  L+G+D G + ++E+IF L P+  IL RV+RWQ  R++ G  K++GR +V+ TG
Sbjct: 1   MDLTITTLEGKDAGKVKLNEEIFGLDPRDDILQRVVRWQLARRQQGSHKAQGRGDVSRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           SKMY QKGTGRA H S    QFRGGG+A GPV     H LPKKVR+L LRHALS K  ++
Sbjct: 61  SKMYKQKGTGRACHHSARAPQFRGGGQAHGPVVRNHDHDLPKKVRALGLRHALSAKAKAS 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           D+++ID+L S + KTK LV++F  L L NAL+I G ++D NFQ AA NIPNI++LPVQGI
Sbjct: 121 DLIIIDDLASADAKTKQLVSQFAKLGLENALLIGGAEIDANFQRAASNIPNIDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR  KLVLSK+A+EALE+RFK
Sbjct: 181 NVYDILRRGKLVLSKAAVEALEERFK 206


>gi|163760800|ref|ZP_02167879.1| 50S ribosomal protein L4 [Hoeflea phototrophica DFL-43]
 gi|162281844|gb|EDQ32136.1| 50S ribosomal protein L4 [Hoeflea phototrophica DFL-43]
          Length = 206

 Score =  244 bits (622), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 116/206 (56%), Positives = 157/206 (76%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L+V  L+G+  G IS+S+ IF L+P+Q ++ R++RWQ  +K+ G  K+ GRSE++ TG
Sbjct: 1   MDLTVTTLEGKSAGKISLSDAIFGLEPRQDLIQRIVRWQLAKKQQGGHKTLGRSEISRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +KM+ QKGTGRARH + S  QFRGGG+A GPV     H LPKKVR+LALRHALS K  ++
Sbjct: 61  AKMFKQKGTGRARHHAASAPQFRGGGRAHGPVVRSHAHDLPKKVRALALRHALSAKAQAS 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           DI+++D+L + E KTK L      + L+NAL I G +LD+NF+LAA+NIPN+++LPVQGI
Sbjct: 121 DIIIVDSLTAGEAKTKALTGSLDKMGLNNALFIGGAELDQNFRLAAKNIPNVDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR  KLVLSK A+ ALE+RFK
Sbjct: 181 NVYDILRRGKLVLSKDAVAALEERFK 206


>gi|90417762|ref|ZP_01225674.1| ribosomal protein L4 [Aurantimonas manganoxydans SI85-9A1]
 gi|90337434|gb|EAS51085.1| ribosomal protein L4 [Aurantimonas manganoxydans SI85-9A1]
          Length = 206

 Score =  243 bits (619), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 116/206 (56%), Positives = 155/206 (75%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +++++++LDG+D G  ++++DIF L+P++ IL R++RWQ  +++ G  ++ GR+E+A TG
Sbjct: 1   MDVTIKSLDGKDAGTATLADDIFGLEPREDILQRMVRWQLAKRQQGSHQTLGRAEIARTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +K+Y QKGTGRARH S    QFRGGGKA GPV     H LPKKVR+LALRHALS K  S 
Sbjct: 61  AKLYRQKGTGRARHGSARAPQFRGGGKAHGPVSRSHAHDLPKKVRALALRHALSAKAKSG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            I+VID L + E KTK +V  F  L L+NAL I G +LD NF  +ARNIP +++LPVQGI
Sbjct: 121 GIVVIDELKAAEGKTKAMVKTFADLGLTNALFIGGAELDANFTRSARNIPQMDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR   LVLSK+A+EALE+RFK
Sbjct: 181 NVYDILRRQTLVLSKAAVEALEERFK 206


>gi|110180282|gb|ABG54384.1| 23S ribosomal protein L4 [Brucella ceti]
 gi|110180286|gb|ABG54386.1| 23S ribosomal protein L4 [Brucella ceti]
          Length = 206

 Score =  242 bits (618), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 118/206 (57%), Positives = 155/206 (75%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L++  L+G+D G + ++E+IF L P+  IL RV+RWQ  R++ G  K++GR +V+ TG
Sbjct: 1   MDLTITTLEGKDAGKVKLNEEIFGLDPRDDILQRVVRWQLARRQQGSHKAQGRGDVSRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           SKMY QKGT RARH S    QFRGGG+A GPV     H LPKKV +L LRHALS K  ++
Sbjct: 61  SKMYKQKGTDRARHHSARAPQFRGGGQAHGPVVRNHDHDLPKKVLALGLRHALSAKAKAS 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           D+++ID+L S + KTK LV++F  L L NAL+I G ++D NFQ AA NIPNI++LPVQGI
Sbjct: 121 DLIIIDDLASADAKTKQLVSQFAKLGLENALLIGGAEIDANFQRAASNIPNIDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR  KLVLSK+A+EALE+RFK
Sbjct: 181 NVYDILRRGKLVLSKAAVEALEERFK 206


>gi|49474403|ref|YP_032445.1| 50S ribosomal protein L4 [Bartonella quintana str. Toulouse]
 gi|81646966|sp|Q6FZC3|RL4_BARQU RecName: Full=50S ribosomal protein L4
 gi|49239907|emb|CAF26305.1| 50s ribosomal protein l4 [Bartonella quintana str. Toulouse]
          Length = 206

 Score =  239 bits (611), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 120/206 (58%), Positives = 151/206 (73%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L +R LDG + G + VSE IF L P++ IL RV+RWQ  R + G   S+GRS+V+ TG
Sbjct: 1   MDLVIRTLDGNEAGRLKVSESIFGLVPREDILQRVVRWQLARHQQGTHHSQGRSDVSRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +KM+ QKGTGRARHSS    QFRGGGKA GPV     H LPKK+R L LR ALS K  +N
Sbjct: 61  AKMFKQKGTGRARHSSARAPQFRGGGKAHGPVVRSHAHDLPKKIRVLGLRLALSAKLKAN 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           D++++D L  KE KTK LV+ F  L   NAL++ G ++D NF  AA NIPNI++LP+QGI
Sbjct: 121 DLIIVDELNVKEAKTKMLVSCFSKLGFKNALLVGGKEIDINFSRAASNIPNIDILPIQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR SKLVLSK+A+EALE+RFK
Sbjct: 181 NVYDILRRSKLVLSKAAVEALEERFK 206


>gi|121602068|ref|YP_988968.1| 50S ribosomal protein L4 [Bartonella bacilliformis KC583]
 gi|121602137|ref|YP_988998.1| 50S ribosomal protein L4 [Bartonella bacilliformis KC583]
 gi|120614245|gb|ABM44846.1| ribosomal protein L4 [Bartonella bacilliformis KC583]
 gi|120614314|gb|ABM44915.1| ribosomal protein L4 [Bartonella bacilliformis KC583]
          Length = 206

 Score =  239 bits (610), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 120/206 (58%), Positives = 152/206 (73%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L ++ LDG+  G +SVSE +F L P++ IL RV+RWQ  R++ G  K +GRS+++ TG
Sbjct: 1   MDLIIKTLDGKKTGELSVSEHVFGLVPREDILQRVVRWQLARRQKGTHKVQGRSDISRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +KMY QKGTGRARHSS    QFRGGGKA GPV     H LPKK R+L LR ALS KF +N
Sbjct: 61  AKMYKQKGTGRARHSSARAPQFRGGGKAHGPVIRSHAHGLPKKSRALGLRLALSAKFKAN 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           D++VID    ++ KTK L T F  L  +NAL+I G ++D NF  AA NIPNI++LP+QGI
Sbjct: 121 DLIVIDEFNLQDPKTKVLATNFSKLGFNNALLIGGKEIDVNFFRAASNIPNIDVLPIQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR SKLVLSK A+EALE+RFK
Sbjct: 181 NVYDILRRSKLVLSKKAVEALEERFK 206


>gi|163868649|ref|YP_001609858.1| 50S ribosomal protein L4 [Bartonella tribocorum CIP 105476]
 gi|189029491|sp|A9IW26|RL4_BART1 RecName: Full=50S ribosomal protein L4
 gi|161018305|emb|CAK01863.1| 50S ribosomal protein L4 [Bartonella tribocorum CIP 105476]
          Length = 206

 Score =  239 bits (609), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 118/206 (57%), Positives = 154/206 (74%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L ++ LDG + G + VSE IF L P++ IL RV+RWQ  R++ G  +S+GRS+V+ TG
Sbjct: 1   MDLVIKTLDGHEAGKLKVSESIFDLVPREDILQRVVRWQLARRQQGTHQSQGRSDVSRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +KM+ QKGTGRARHSS    QFRGGGKA GPV     H LPKK+R+L LR ALS K  + 
Sbjct: 61  AKMFKQKGTGRARHSSARAPQFRGGGKAHGPVFRSHAHDLPKKIRALGLRLALSAKLKAK 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           D++V+D L  K+ KTK LV+ F  L  +NAL+I G ++D NF  AA NIPNI++LP+QGI
Sbjct: 121 DLIVVDELAVKDAKTKKLVSHFSKLGFNNALLIGGQEIDINFFRAASNIPNIDVLPIQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR SKLVLSK+A+EALE+RF+
Sbjct: 181 NVYDILRRSKLVLSKAAVEALEERFR 206


>gi|240850834|ref|YP_002972234.1| 50S ribosomal protein L4 [Bartonella grahamii as4aup]
 gi|240267957|gb|ACS51545.1| 50S ribosomal protein L4 [Bartonella grahamii as4aup]
          Length = 206

 Score =  238 bits (606), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 117/206 (56%), Positives = 153/206 (74%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L ++ LDG + G + VSE IF L P++ IL RV+RWQ  R++ G  +S+GRS+V+ TG
Sbjct: 1   MDLVIKTLDGNEAGKLKVSEAIFDLVPREDILQRVVRWQLARRQQGSHQSQGRSDVSRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +KM+ QKGTGRARHSS    QFRGGGKA GPV     H LPKK+R+L LR ALS K  + 
Sbjct: 61  AKMFKQKGTGRARHSSARAPQFRGGGKAHGPVVRSHAHDLPKKIRALGLRLALSAKLKAK 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           D++++D L  K+ KTK LV+ F  L  +NAL+I G ++D NF  A  NIPNI++LP+QGI
Sbjct: 121 DLIIVDELTVKDAKTKMLVSHFSKLGFNNALLIGGKEIDINFFRAVSNIPNIDILPIQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR SKLVLSK+A+EALE+RFK
Sbjct: 181 NVYDILRRSKLVLSKAAVEALEERFK 206


>gi|319899098|ref|YP_004159191.1| 50S ribosomal protein L4 [Bartonella clarridgeiae 73]
 gi|319403062|emb|CBI76617.1| 50S ribosomal protein L4 [Bartonella clarridgeiae 73]
          Length = 206

 Score =  236 bits (601), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 117/206 (56%), Positives = 152/206 (73%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L ++ LDG++ G + VSE +F L P++ IL RV+RWQ  R++ G  +S+GRS+V+ TG
Sbjct: 1   MDLMIKTLDGKEAGKVKVSESVFGLIPREDILQRVVRWQLTRRQKGTHQSQGRSDVSRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +KM+ QKGTGRARHSS    QFRGGGKA GPV     H LPKKVR+L LR ALS K  ++
Sbjct: 61  AKMFKQKGTGRARHSSARAPQFRGGGKAHGPVMRSHAHGLPKKVRALGLRLALSAKLKAD 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           D++V+D L  ++ KTK L   F  L  +NAL+I G ++D NF  AA NIPNI++LPVQGI
Sbjct: 121 DLIVVDELNIRDAKTKVLNANFSKLGFNNALLIGGKEIDVNFFRAASNIPNIDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR  KLVLSK A+EALE+RFK
Sbjct: 181 NVYDILRRGKLVLSKEAVEALEERFK 206


>gi|319408764|emb|CBI82421.1| 50S ribosomal protein L4 [Bartonella schoenbuchensis R1]
          Length = 206

 Score =  235 bits (600), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 118/206 (57%), Positives = 152/206 (73%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L ++ LDG + G + VSE IF L P++ IL RV+RWQ  R++ G  +S+GRS+VA TG
Sbjct: 1   MDLVIKTLDGNEAGKLKVSEHIFGLAPREDILQRVVRWQLARRQQGTHQSQGRSDVARTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +KM+ QKGTGRARHSS    QFRGGGKA GPV    VH LPKK R+L L  ALS K  +N
Sbjct: 61  AKMFKQKGTGRARHSSARAPQFRGGGKAHGPVARSHVHILPKKSRALGLCLALSVKLKTN 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           D++V+D L  ++ KTK L   F  L  +NAL+I G +++ NF  AA NIPNI++LPVQGI
Sbjct: 121 DLIVVDELNVQDAKTKVLAKSFSKLGFNNALLIGGKEINMNFSRAASNIPNIDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR +KLVLSK+A+EALE+RFK
Sbjct: 181 NVYDILRRNKLVLSKAAVEALEERFK 206


>gi|319404424|emb|CBI78027.1| 50S ribosomal protein L4 [Bartonella rochalimae ATCC BAA-1498]
          Length = 206

 Score =  234 bits (597), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 116/206 (56%), Positives = 153/206 (74%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L ++ LDG++ G + VSE+IF L P++ IL RV+RWQ  R++ G  +S+GRS+V+ TG
Sbjct: 1   MDLVIKTLDGKEAGKLKVSENIFGLTPREDILQRVVRWQLARRQKGTHQSQGRSDVSRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +KM+ QKGTGRARHSS    QFRGGGKA GPV     H LPKKVR+L LR ALS K  ++
Sbjct: 61  AKMFKQKGTGRARHSSARAPQFRGGGKAHGPVMRSHAHNLPKKVRALGLRLALSVKLKTD 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           +++++D L  ++ KTK L   F  L  +NAL+I G ++D NF  AA NIPNI++LPVQGI
Sbjct: 121 NLIIVDELSIRDAKTKMLNMNFSKLGFNNALLIGGKEVDVNFFRAASNIPNIDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR SKLVLSK A+E LE+RFK
Sbjct: 181 NVYDILRRSKLVLSKEAVETLEERFK 206


>gi|161511095|ref|NP_772039.2| 50S ribosomal protein L4 [Bradyrhizobium japonicum USDA 110]
 gi|46577249|sp|Q89J85|RL4_BRAJA RecName: Full=50S ribosomal protein L4
          Length = 206

 Score =  233 bits (595), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 115/206 (55%), Positives = 150/206 (72%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +EL V  L+G++ G + +S+ IF L+P+Q I+AR ++WQ  +++ G  K+KGR+E+  TG
Sbjct: 1   MELKVTTLEGKEAGSVQLSDAIFGLEPRQDIIARCVQWQLNKRQAGTHKAKGRAEIWRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            KMY QKGTG ARH S  V QFRGGG+AFGPV       LPKKVR+LAL+HALS K    
Sbjct: 61  KKMYKQKGTGGARHGSARVPQFRGGGRAFGPVVRSHATDLPKKVRALALKHALSAKAKDG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           D++VID    +  KTK L+  F  L L+NALIIDG +L+  F  AARNIPN+++LP+QGI
Sbjct: 121 DLLVIDKAALEAAKTKALLGHFSGLGLTNALIIDGAELNNGFAAAARNIPNMDVLPIQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR  KLVL+K+AI+ALE RFK
Sbjct: 181 NVYDILRRQKLVLTKAAIDALEARFK 206


>gi|319407425|emb|CBI81076.1| 50S ribosomal protein L4 [Bartonella sp. 1-1C]
          Length = 206

 Score =  233 bits (595), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 115/206 (55%), Positives = 153/206 (74%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L ++ LDG++ G + VSE+IF L P++ IL RV+RWQ  R++ G  +S+GRS+V+ TG
Sbjct: 1   MDLIIKTLDGKEAGKLKVSENIFGLTPREDILQRVVRWQLARRQKGTHQSQGRSDVSRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +KM+ QKGTGRARHSS    QFRGGGKA GPV     H LPKK+R+L LR ALS K  ++
Sbjct: 61  AKMFKQKGTGRARHSSARAPQFRGGGKAHGPVIRSHAHNLPKKIRALGLRLALSVKLKTD 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           +++++D L  ++ KTK L   F  L  +NAL+I G ++D NF  AA NIPNI++LPVQGI
Sbjct: 121 NLIIVDELSIRDAKTKVLNMNFSKLGFNNALLIGGKEVDMNFFRAASNIPNIDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR SKLVLSK A+E LE+RFK
Sbjct: 181 NVYDILRRSKLVLSKEAVETLEERFK 206


>gi|49475793|ref|YP_033834.1| 50S ribosomal protein L4 [Bartonella henselae str. Houston-1]
 gi|81647792|sp|Q6G2W6|RL4_BARHE RecName: Full=50S ribosomal protein L4
 gi|49238600|emb|CAF27841.1| 50S ribosomal protein l4 [Bartonella henselae str. Houston-1]
          Length = 206

 Score =  233 bits (594), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 114/206 (55%), Positives = 151/206 (73%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L ++ LDG + G + VSE +F L P++ IL RV+RWQ  R++ G  +S+GRS+V+ TG
Sbjct: 1   MDLLIKTLDGNEVGKLKVSESVFGLVPREDILQRVVRWQLARRQQGTHQSQGRSDVSRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +KM+ QKGTGRARHSS    QFRGGGKA GPV     H LPKK+R+L LR ALS K  ++
Sbjct: 61  AKMFKQKGTGRARHSSARAPQFRGGGKAHGPVVRSHAHTLPKKIRALGLRFALSAKLKAD 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           D++V+D    K+ KT+ LV+ F  L   NAL+I G ++D NF  A  NIPNI++LP+QGI
Sbjct: 121 DLIVVDEFNVKDAKTRMLVSCFSKLGFDNALLIGGNEVDLNFSRATSNIPNIDILPIQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR SKLVLSK+A+E LE+RFK
Sbjct: 181 NVYDILRRSKLVLSKAAVEVLEERFK 206


>gi|299135256|ref|ZP_07028447.1| ribosomal protein L4/L1e [Afipia sp. 1NLS2]
 gi|298590233|gb|EFI50437.1| ribosomal protein L4/L1e [Afipia sp. 1NLS2]
          Length = 206

 Score =  233 bits (594), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 113/206 (54%), Positives = 152/206 (73%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +EL+V  L+G+  G +++S++IF L+P++ I+ RV+ WQ  +++ G  K+KGR+EV  TG
Sbjct: 1   MELNVTTLEGKAAGSVNLSDEIFGLEPRKDIIQRVVNWQLAKRQAGTHKAKGRAEVWRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            KMY QKGTG ARH S  V QFRGGG+AFGPV     H LPKKVR+L LRHALS K    
Sbjct: 61  KKMYKQKGTGGARHGSARVPQFRGGGRAFGPVVRSHAHDLPKKVRALGLRHALSAKAKDG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++VIDN   K+ KTK L+  F  L L++ALI+DG +++  F  AARNIP+I++LP+QGI
Sbjct: 121 GLVVIDNAELKDAKTKALIAHFSGLGLTSALIVDGAEVNNGFAQAARNIPHIDVLPIQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR  KLVL+K+A++ALE RFK
Sbjct: 181 NVYDILRRQKLVLTKAAVDALEARFK 206


>gi|27353674|dbj|BAC50664.1| 50S ribosomal protein L4 [Bradyrhizobium japonicum USDA 110]
          Length = 220

 Score =  233 bits (594), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 115/206 (55%), Positives = 150/206 (72%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +EL V  L+G++ G + +S+ IF L+P+Q I+AR ++WQ  +++ G  K+KGR+E+  TG
Sbjct: 15  MELKVTTLEGKEAGSVQLSDAIFGLEPRQDIIARCVQWQLNKRQAGTHKAKGRAEIWRTG 74

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            KMY QKGTG ARH S  V QFRGGG+AFGPV       LPKKVR+LAL+HALS K    
Sbjct: 75  KKMYKQKGTGGARHGSARVPQFRGGGRAFGPVVRSHATDLPKKVRALALKHALSAKAKDG 134

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           D++VID    +  KTK L+  F  L L+NALIIDG +L+  F  AARNIPN+++LP+QGI
Sbjct: 135 DLLVIDKAALEAAKTKALLGHFSGLGLTNALIIDGAELNNGFAAAARNIPNMDVLPIQGI 194

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR  KLVL+K+AI+ALE RFK
Sbjct: 195 NVYDILRRQKLVLTKAAIDALEARFK 220


>gi|114704485|ref|ZP_01437393.1| 50S ribosomal protein L4 [Fulvimarina pelagi HTCC2506]
 gi|114539270|gb|EAU42390.1| 50S ribosomal protein L4 [Fulvimarina pelagi HTCC2506]
          Length = 206

 Score =  233 bits (594), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 115/206 (55%), Positives = 150/206 (72%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++++++ LDG D G +++SE IF L P+Q IL R++R+Q  +++ G   + GRS+VA TG
Sbjct: 1   MDVTIKKLDGADAGTVTLSEAIFGLDPRQDILHRMVRYQLAKRQQGTHSTLGRSDVARTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +KMY QKGTGRARHS+    QFRGGG A GP P      LPKK+R+LAL+HALS K  S 
Sbjct: 61  AKMYRQKGTGRARHSTAKAPQFRGGGIAHGPTPRSHAIDLPKKLRALALKHALSAKAKSG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++VID L + E KTK +V  F  L + NALII G +LD+NF  A+RNI  I++LPVQGI
Sbjct: 121 GLIVIDELKADEGKTKSMVKSFAGLGIENALIIGGSELDQNFARASRNIAKIDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR   LVLSKSA+EALE+RFK
Sbjct: 181 NVYDILRRQTLVLSKSAVEALEERFK 206


>gi|319405897|emb|CBI79529.1| 50S ribosomal protein L4 [Bartonella sp. AR 15-3]
          Length = 206

 Score =  232 bits (592), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 117/206 (56%), Positives = 151/206 (73%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L V+ LDG++ G + VSE+IF L P++ IL RV+RWQ  R++ G   S+GRS+V+ TG
Sbjct: 1   MDLVVKTLDGKEAGKLKVSENIFGLTPREDILQRVIRWQLARRQKGTHPSQGRSDVSRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +KM+ QKGTGRARHSS    QFRGGGKA GPV     H+LPKKVR+L LR ALS K  ++
Sbjct: 61  AKMFKQKGTGRARHSSARAPQFRGGGKAHGPVMRCHAHSLPKKVRALGLRLALSVKLKTD 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++V+D L  ++ KTK L   F  L  +NAL+I G ++D NF  AA NIPNI++LPVQGI
Sbjct: 121 SLIVVDKLSIRDAKTKALNESFSKLGFNNALLIGGKEVDMNFFRAASNIPNIDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR  KLVLSK A+E LE+RFK
Sbjct: 181 NVYDILRRGKLVLSKEAVETLEERFK 206


>gi|209884814|ref|YP_002288671.1| ribosomal protein L4/L1 family [Oligotropha carboxidovorans OM5]
 gi|226730700|sp|B6JET4|RL4_OLICO RecName: Full=50S ribosomal protein L4
 gi|209873010|gb|ACI92806.1| ribosomal protein L4/L1 family [Oligotropha carboxidovorans OM5]
          Length = 206

 Score =  231 bits (588), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 111/206 (53%), Positives = 151/206 (73%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +EL+V  L+G+  G +++S+ IF L+P+  I+ RV+ WQ  +++ G  K+KGR+E+A TG
Sbjct: 1   MELNVTTLEGKAAGSVNLSDTIFGLEPRTDIIQRVVNWQLAKRQAGTHKTKGRAEIARTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            KMY QKGTG ARH S  V QFRGGG+AFGPV     + LPKKVR+L LRHALS K    
Sbjct: 61  KKMYKQKGTGGARHGSARVPQFRGGGRAFGPVVRSHAYDLPKKVRALGLRHALSAKAKDG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++V+DN   K+ KTK L+  F  L L++ALI+DG +++  F  AARNIP+I++LP+QGI
Sbjct: 121 SLVVLDNAELKDAKTKALIGHFSGLGLTSALIVDGAEVNNGFAQAARNIPHIDVLPIQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR  KLVL+K+A++ALE RFK
Sbjct: 181 NVYDILRRQKLVLTKAAVDALEARFK 206


>gi|148256391|ref|YP_001240976.1| 50S ribosomal protein L4 [Bradyrhizobium sp. BTAi1]
 gi|166234638|sp|A5ELM6|RL4_BRASB RecName: Full=50S ribosomal protein L4
 gi|146408564|gb|ABQ37070.1| LSU ribosomal protein L4P [Bradyrhizobium sp. BTAi1]
          Length = 206

 Score =  229 bits (583), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 113/206 (54%), Positives = 148/206 (71%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +EL V  L+G+D G + +S+ IF L+P+  I+ R ++WQ  +++ G  K+KGR+E+  TG
Sbjct: 1   MELKVTTLEGKDAGSVQLSDAIFGLEPRVDIIQRCVQWQLNKRQAGTHKAKGRAEIWRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            KMY QKGTG ARH S  V QFRGGG+AFGPV       LPKKVR+LAL+HALS K    
Sbjct: 61  KKMYKQKGTGGARHGSARVPQFRGGGRAFGPVVRSHATDLPKKVRALALKHALSAKAKDG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           D++V++N   +  KTK L+  F  L L+NALIIDG +L   F  AARNIPN+++LP+QGI
Sbjct: 121 DLVVLENATLEAAKTKALIGHFSGLGLTNALIIDGAELHNGFAAAARNIPNLDVLPIQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR  KLVL+K+AI+ALE RFK
Sbjct: 181 NVYDILRRQKLVLTKAAIDALEARFK 206


>gi|146340058|ref|YP_001205106.1| 50S ribosomal protein L4 [Bradyrhizobium sp. ORS278]
 gi|166234639|sp|A4YSJ3|RL4_BRASO RecName: Full=50S ribosomal protein L4
 gi|146192864|emb|CAL76869.1| 50S ribosomal subunit protein L4 [Bradyrhizobium sp. ORS278]
          Length = 206

 Score =  228 bits (581), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 148/206 (71%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +EL V  L+G++ G + +S+ IF L+P+  I+ R ++WQ  +++ G  K+KGR+E+  TG
Sbjct: 1   MELKVTTLEGKEAGSVQLSDAIFGLEPRADIIQRCVQWQLNKRQAGTHKAKGRAEIWRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            KMY QKGTG ARH S  V QFRGGG+AFGPV       LPKKVR+LAL+HALS K    
Sbjct: 61  KKMYKQKGTGGARHGSARVPQFRGGGRAFGPVVRSHATDLPKKVRALALKHALSAKAKDG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           D++V++N   +  KTK L+  F  L L+NALIIDG +L   F  AARNIPN+++LP+QGI
Sbjct: 121 DLVVLENATLEAAKTKALIGHFSGLGLTNALIIDGAELHNGFAAAARNIPNLDVLPIQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR  KLVL+K+AI+ALE RFK
Sbjct: 181 NVYDILRRQKLVLTKAAIDALEARFK 206


>gi|92117099|ref|YP_576828.1| 50S ribosomal protein L4 [Nitrobacter hamburgensis X14]
 gi|122418094|sp|Q1QN29|RL4_NITHX RecName: Full=50S ribosomal protein L4
 gi|91799993|gb|ABE62368.1| LSU ribosomal protein L4P [Nitrobacter hamburgensis X14]
          Length = 206

 Score =  227 bits (579), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 146/206 (70%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +EL+V  L+G   G + +S+ IF L+P++ ++ R + WQ  +++ G  K+KGR+E+  TG
Sbjct: 1   MELNVTTLEGNAAGSVQLSDGIFGLEPRKDLIQRCVNWQLAKRQAGTHKTKGRAEIWRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            KM+ QKGTG ARH S  V QFRGGG+AFGPV     H LPKKVR+LALRHALS K    
Sbjct: 61  KKMFKQKGTGNARHGSARVPQFRGGGRAFGPVVRSHAHDLPKKVRALALRHALSAKAKDG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++VID+    E KTK LV  F  L L+NALI+DG  +   F  AARNIPNI++LP+QGI
Sbjct: 121 GLIVIDSAELNEAKTKALVGHFSGLGLTNALIVDGAAVHAGFATAARNIPNIDVLPIQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR  KLVL+K+A++ALE RFK
Sbjct: 181 NVYDILRRRKLVLTKAAVDALEARFK 206


>gi|75675557|ref|YP_317978.1| 50S ribosomal protein L4 [Nitrobacter winogradskyi Nb-255]
 gi|109893613|sp|Q3SSW5|RL4_NITWN RecName: Full=50S ribosomal protein L4
 gi|74420427|gb|ABA04626.1| LSU ribosomal protein L4P [Nitrobacter winogradskyi Nb-255]
          Length = 206

 Score =  227 bits (578), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 111/206 (53%), Positives = 149/206 (72%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +EL+V  L+G+  G + +S+ IF L+P++ ++ R + WQ  + + G  K+KGR+E+  TG
Sbjct: 1   MELNVTTLEGKAAGSVHLSDGIFGLEPRKDLIQRCVNWQLAKSQAGTHKTKGRAEIWRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K++ QKGTG ARH S    QFRGGG+AFGPV     H LPKKVR+LALRHALS K    
Sbjct: 61  KKLFKQKGTGNARHGSARAPQFRGGGRAFGPVVRSHAHDLPKKVRALALRHALSAKAKDG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++VID++  KE KTK L+  F +L L++ALIIDG Q+   F  AARNIPNI++LP+QGI
Sbjct: 121 GLIVIDSVELKEAKTKALMGHFSSLGLTSALIIDGAQVHAGFATAARNIPNIDVLPIQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR  KLVL+K+A++ALE RFK
Sbjct: 181 NVYDILRRQKLVLTKAAVDALEARFK 206


>gi|115525584|ref|YP_782495.1| 50S ribosomal protein L4 [Rhodopseudomonas palustris BisA53]
 gi|122295409|sp|Q07KL9|RL4_RHOP5 RecName: Full=50S ribosomal protein L4
 gi|115519531|gb|ABJ07515.1| LSU ribosomal protein L4P [Rhodopseudomonas palustris BisA53]
          Length = 206

 Score =  226 bits (576), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 114/208 (54%), Positives = 150/208 (72%), Gaps = 4/208 (1%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +EL V  L+G+D G + +S++IF L P+  I+ R + WQ  +++ G  K+KGR+E+  TG
Sbjct: 1   MELKVTTLEGKDAGSVQLSDEIFGLDPRSDIIQRCVIWQLAKRQAGTHKAKGRAEIWRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHA--LPKKVRSLALRHALSDKFC 119
            KMY QKGTG ARH S+ V QFRGGG+AFGPV  +  HA  LPKKVR++AL+HALS K  
Sbjct: 61  KKMYKQKGTGGARHGSQRVPQFRGGGRAFGPV--VRSHAIDLPKKVRAMALKHALSAKAK 118

Query: 120 SNDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
              ++VID       KTK LV  F  L L++ALIIDG +L+  F +AARNIPNI++LP+Q
Sbjct: 119 DGGLIVIDQATLDSAKTKALVGHFAGLGLTSALIIDGAELNNGFAVAARNIPNIDVLPIQ 178

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRFK 207
           GINVYDILR  KLVL+K+A++ALE RFK
Sbjct: 179 GINVYDILRRQKLVLTKAAVDALEARFK 206


>gi|91977651|ref|YP_570310.1| 50S ribosomal protein L4 [Rhodopseudomonas palustris BisB5]
 gi|123762621|sp|Q134T0|RL4_RHOPS RecName: Full=50S ribosomal protein L4
 gi|91684107|gb|ABE40409.1| LSU ribosomal protein L4P [Rhodopseudomonas palustris BisB5]
          Length = 206

 Score =  226 bits (576), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 116/208 (55%), Positives = 151/208 (72%), Gaps = 4/208 (1%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +EL V  L+G++ G + +S+ IF L+P+Q I+ R + WQ  +++ G  K+KGR+E+  TG
Sbjct: 1   MELKVTTLEGKEAGSVQLSDAIFGLEPRQDIVQRCVIWQLAKRQAGTHKAKGRAEIWRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHA--LPKKVRSLALRHALSDKFC 119
            KMY QKGTG ARH S+ V QFRGGG+AFGPV  +  HA  LPKKVR+LALRHALS K  
Sbjct: 61  KKMYKQKGTGGARHGSQRVPQFRGGGRAFGPV--VRSHAIDLPKKVRALALRHALSAKAK 118

Query: 120 SNDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
              ++VID    +  KTK LV  F  L L+NALIIDG +++  F  AARNIPNI++LPVQ
Sbjct: 119 GGGLIVIDKAELEAAKTKALVGAFSGLGLTNALIIDGAEVNNGFATAARNIPNIDVLPVQ 178

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRFK 207
           GINVYDI+R  KLVL+K+A++ALE RFK
Sbjct: 179 GINVYDIVRRRKLVLTKAALDALEARFK 206


>gi|85715130|ref|ZP_01046114.1| 50S ribosomal protein L4 [Nitrobacter sp. Nb-311A]
 gi|85698045|gb|EAQ35918.1| 50S ribosomal protein L4 [Nitrobacter sp. Nb-311A]
          Length = 206

 Score =  226 bits (576), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 109/206 (52%), Positives = 149/206 (72%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +EL++  L+G+  G + +S+ IF L+P++ ++ R + WQ  +++ G  K+KGR+E+  TG
Sbjct: 1   MELNITTLEGKAAGSVQLSDGIFGLEPRKDLIQRCVNWQLAKRQAGTRKTKGRAEIWRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K++ QKGTG ARH S    QFRGGG+AFGPV     H LPKKVR+LALRHALS K    
Sbjct: 61  KKLFKQKGTGNARHGSARAPQFRGGGRAFGPVVRSHAHDLPKKVRALALRHALSAKAKDG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++VID++  KE KTK L+  F  L L++ALI+DG Q+   F  AARNIPNI++LP+QGI
Sbjct: 121 GLIVIDSVELKEAKTKALMGHFSGLGLTSALIVDGAQVHAGFATAARNIPNIDVLPIQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR  KLVL+K+A++ALE RFK
Sbjct: 181 NVYDILRRQKLVLTKAAVDALEARFK 206


>gi|90424936|ref|YP_533306.1| 50S ribosomal protein L4 [Rhodopseudomonas palustris BisB18]
 gi|109893630|sp|Q211E9|RL4_RHOPB RecName: Full=50S ribosomal protein L4
 gi|90106950|gb|ABD88987.1| LSU ribosomal protein L4P [Rhodopseudomonas palustris BisB18]
          Length = 206

 Score =  226 bits (575), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 149/206 (72%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +EL V  L+G++ G + +S++IF L P+  I+ R + WQ  +++ G  K+KGR+EV  TG
Sbjct: 1   MELKVTTLEGKEAGSVQLSDEIFGLDPRVDIIQRCVNWQLAKRQAGTHKAKGRAEVWRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            KMY QKGTG ARH S+ V QFRGGG+AFGPV       LPKKVR+LAL+HALS K    
Sbjct: 61  KKMYKQKGTGGARHGSQRVPQFRGGGRAFGPVVRSHAFDLPKKVRALALKHALSAKAKDG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++VI++   +  KTK LV  F  L L++ALIIDG +L+  F +AARNIPNI++LP+QGI
Sbjct: 121 GLIVIESATLEAAKTKALVGHFSGLGLTSALIIDGAELNNGFAVAARNIPNIDVLPIQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR  KLVL+K+A++ALE RFK
Sbjct: 181 NVYDILRRQKLVLTKAAVDALEARFK 206


>gi|328543359|ref|YP_004303468.1| 50S ribosomal protein L4 [Polymorphum gilvum SL003B-26A1]
 gi|326413104|gb|ADZ70167.1| 50S ribosomal protein L4 [Polymorphum gilvum SL003B-26A1]
          Length = 206

 Score =  226 bits (575), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 149/206 (72%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +EL V+ LDG   G I+VS++IF L+P+  ++ RV+RWQ  +++ G  K+KGRSEV+ T 
Sbjct: 1   MELEVKTLDGSAAGSITVSDEIFGLEPRTDLIHRVVRWQLAKRQAGTHKAKGRSEVSGTT 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K   QKG+G ARH ++   QFRGGGKAFGPV     H LPKKVR+L L HALS K  + 
Sbjct: 61  KKFVRQKGSGGARHGNRKAPQFRGGGKAFGPVVRDHGHDLPKKVRALGLAHALSTKAKAG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++++++  + E KTK L  +F  L L +ALIIDG +LD NF LAARNIP +++LPVQGI
Sbjct: 121 SLIIVEDAKAGEAKTKALKEKFGKLGLQSALIIDGSELDANFALAARNIPAVDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR + LVL+K+A+ A+E+RFK
Sbjct: 181 NVYDILRRNTLVLTKAAVSAIEERFK 206


>gi|217976766|ref|YP_002360913.1| 50S ribosomal protein L4 [Methylocella silvestris BL2]
 gi|254803745|sp|B8ELG2|RL4_METSB RecName: Full=50S ribosomal protein L4
 gi|217502142|gb|ACK49551.1| ribosomal protein L4/L1e [Methylocella silvestris BL2]
          Length = 206

 Score =  225 bits (573), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 150/206 (72%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +++ + +L+G+  G I + + IF L+P+Q ++AR++R+Q  ++R G  K+KGR+E+A TG
Sbjct: 1   MKIDITSLNGDSAGSIDLDDSIFGLEPRQDLIARMVRYQLAKRRAGTHKTKGRAEIARTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH S  V QFRGGG+AFGPV     H LPKKVR+LAL+HALS K    
Sbjct: 61  KKLYKQKGTGSARHGSARVPQFRGGGRAFGPVVRSHAHDLPKKVRALALKHALSAKAQGG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            I+V  +  + + KTK L   F    L +ALIIDG ++++NF LAARNIP I++LPVQGI
Sbjct: 121 GIIVWSDASATDAKTKALKASFAKAGLLSALIIDGAEVEQNFALAARNIPQIDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR  KLVL+++AI+ALE RFK
Sbjct: 181 NVYDILRREKLVLTRAAIDALEARFK 206


>gi|86749416|ref|YP_485912.1| 50S ribosomal protein L4 [Rhodopseudomonas palustris HaA2]
 gi|109893629|sp|Q2IXQ9|RL4_RHOP2 RecName: Full=50S ribosomal protein L4
 gi|86572444|gb|ABD07001.1| LSU ribosomal protein L4P [Rhodopseudomonas palustris HaA2]
          Length = 206

 Score =  224 bits (572), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 115/208 (55%), Positives = 150/208 (72%), Gaps = 4/208 (1%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +EL V  L+G++ G + +S+ IF L+P+  I+ R + WQ  +++ G  K+KGR+EV  TG
Sbjct: 1   MELKVTTLEGQEAGSVQLSDAIFGLEPRNDIVQRCVIWQLAKRQAGTHKAKGRAEVWRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHA--LPKKVRSLALRHALSDKFC 119
            KMY QKGTG ARH S+ V QFRGGG+AFGPV  +  HA  LPKKVR+LALRHALS K  
Sbjct: 61  KKMYKQKGTGGARHGSQRVPQFRGGGRAFGPV--VRSHAIDLPKKVRALALRHALSAKAK 118

Query: 120 SNDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
              ++VID    +  KTK LV  F  L L+NALIIDG +++  F  AARNIPNI++LP+Q
Sbjct: 119 GGGLIVIDKAELEAAKTKALVGAFSGLGLTNALIIDGAEVNTGFATAARNIPNIDVLPIQ 178

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRFK 207
           GINVYDI+R  KLVL+K+A++ALE RFK
Sbjct: 179 GINVYDIVRRRKLVLTKAALDALEARFK 206


>gi|39936312|ref|NP_948588.1| 50S ribosomal protein L4 [Rhodopseudomonas palustris CGA009]
 gi|192292036|ref|YP_001992641.1| 50S ribosomal protein L4 [Rhodopseudomonas palustris TIE-1]
 gi|46577158|sp|P61068|RL4_RHOPA RecName: Full=50S ribosomal protein L4; AltName: Full=RRP-L4
 gi|226730715|sp|B3QBX9|RL4_RHOPT RecName: Full=50S ribosomal protein L4
 gi|39650167|emb|CAE28690.1| 50S ribosomal protein L4 [Rhodopseudomonas palustris CGA009]
 gi|192285785|gb|ACF02166.1| ribosomal protein L4/L1e [Rhodopseudomonas palustris TIE-1]
          Length = 206

 Score =  223 bits (569), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 115/208 (55%), Positives = 149/208 (71%), Gaps = 4/208 (1%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +EL V  L+G++ G + +S++IF L+P+  I+ R + WQ  +++ G  K+KGR+EV  TG
Sbjct: 1   MELKVTTLEGKEAGSVQLSDEIFGLEPRSDIIQRCVIWQLAKRQAGTHKAKGRAEVWRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHA--LPKKVRSLALRHALSDKFC 119
            KMY QKGTG ARH S+ V QFRGGG+AFGPV  +  HA  LPKKVR LALRHALS K  
Sbjct: 61  KKMYKQKGTGGARHGSQRVPQFRGGGRAFGPV--VRSHAIDLPKKVRVLALRHALSAKAK 118

Query: 120 SNDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
              ++V+D    +  KTK LV  F  L L +ALIIDG +++  F  AARNIPNI++LPVQ
Sbjct: 119 GGGLIVLDKAELEAAKTKTLVGHFSGLGLESALIIDGAEVNNGFAAAARNIPNIDVLPVQ 178

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRFK 207
           GINVYDILR  KLVL+K+A++ALE RFK
Sbjct: 179 GINVYDILRRKKLVLTKAAVDALEARFK 206


>gi|158424177|ref|YP_001525469.1| 50S ribosomal protein L4 [Azorhizobium caulinodans ORS 571]
 gi|158331066|dbj|BAF88551.1| ribosomal protein L4/L1e [Azorhizobium caulinodans ORS 571]
          Length = 207

 Score =  222 bits (566), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 107/207 (51%), Positives = 147/207 (71%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M+EL+V+ LDG + G I +S+ IF L+P+  IL R++ WQ  R++ G  ++KGRSE+  T
Sbjct: 1   MMELTVKTLDGAEAGSIQLSDAIFGLEPRADILHRMVTWQLARRQAGTHRTKGRSEINRT 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
             K+Y QKGTG ARH + S  QFRGGG+AFGPV       LPKKVR+LAL+HALS K  +
Sbjct: 61  SKKLYKQKGTGNARHGAASAPQFRGGGRAFGPVVRSHAFDLPKKVRALALKHALSSKAKA 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             I+V+D     + KTK L  RF  L +++ L++DG Q+  NF LAARN+ ++++LPVQG
Sbjct: 121 EQIIVLDAATLTDAKTKALKERFEKLGIASVLVVDGEQVATNFALAARNLASVDVLPVQG 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRFK 207
           INVYDILR   LVL+++A++ALE RFK
Sbjct: 181 INVYDILRRDTLVLTRAAVDALEARFK 207


>gi|316933528|ref|YP_004108510.1| 50S ribosomal protein L4/L1e [Rhodopseudomonas palustris DX-1]
 gi|315601242|gb|ADU43777.1| ribosomal protein L4/L1e [Rhodopseudomonas palustris DX-1]
          Length = 206

 Score =  222 bits (565), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 113/208 (54%), Positives = 148/208 (71%), Gaps = 4/208 (1%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +EL V  L+G + G + +S++IF L+P+  I+ R + WQ  +++ G  K+KGR+EV  TG
Sbjct: 1   MELKVTTLEGNEAGSVQLSDEIFGLEPRTDIIQRCVIWQLAKRQAGTHKAKGRAEVWRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHA--LPKKVRSLALRHALSDKFC 119
            KMY QKGTG ARH S+ V QFRGGG+AFGPV  +  HA  LPKKVR LALRHALS K  
Sbjct: 61  KKMYKQKGTGGARHGSQRVPQFRGGGRAFGPV--VRSHAIDLPKKVRVLALRHALSAKAK 118

Query: 120 SNDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
              ++V+D    +  KTK LV  F  L L +ALI+DG +++  F  AARNIPNI++LP+Q
Sbjct: 119 GGGLIVLDKAELEAAKTKTLVGHFSGLGLESALIVDGAEVNTGFAAAARNIPNIDVLPIQ 178

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRFK 207
           GINVYDILR  KLVL+K+A++ALE RFK
Sbjct: 179 GINVYDILRRKKLVLTKAAVDALEARFK 206


>gi|170738702|ref|YP_001767357.1| 50S ribosomal protein L4 [Methylobacterium sp. 4-46]
 gi|226730694|sp|B0UHW8|RL4_METS4 RecName: Full=50S ribosomal protein L4
 gi|168192976|gb|ACA14923.1| ribosomal protein L4/L1e [Methylobacterium sp. 4-46]
          Length = 206

 Score =  221 bits (563), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 147/206 (71%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++  +  LDG + G + V+E IF L+P+  +L R +RWQ  +++ G  K K RSE++ T 
Sbjct: 1   MKFEITTLDGGEAGSVEVNEAIFGLEPRADLLQRCVRWQLAKRQAGTHKVKTRSEISRTT 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            KMY QKGTG ARH + S  QFRGG +AFGPV     H LPKKVR+LALRHALS K  + 
Sbjct: 61  KKMYKQKGTGNARHGAASAPQFRGGARAFGPVVRSHAHDLPKKVRALALRHALSAKARAA 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++V+D++  ++ KTK L  RF AL  SNALII G ++D NF  AARN+P+I++LPVQGI
Sbjct: 121 SLVVVDDVRLEDGKTKALKDRFGALGWSNALIIGGAEVDENFGRAARNLPSIDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR  KLVL+++A++ALE RFK
Sbjct: 181 NVYDILRRDKLVLTRAAVDALEARFK 206


>gi|170748637|ref|YP_001754897.1| ribosomal protein L4/L1e [Methylobacterium radiotolerans JCM 2831]
 gi|226730692|sp|B1LWS7|RL4_METRJ RecName: Full=50S ribosomal protein L4
 gi|170655159|gb|ACB24214.1| ribosomal protein L4/L1e [Methylobacterium radiotolerans JCM 2831]
          Length = 206

 Score =  221 bits (563), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 149/206 (72%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L ++ LDG   G + ++E+IF L+P+  +L R++RWQ  ++R G    + RS+V  T 
Sbjct: 1   MKLDIKTLDGAGAGSVELNEEIFGLEPRADLLQRMVRWQLAKRRAGTHAVQNRSDVNRTR 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH + S  QFRGGG+AFGPV     H LPKKVR+LALRHALS K  ++
Sbjct: 61  KKLYKQKGTGNARHGAASAPQFRGGGRAFGPVVRDHSHDLPKKVRALALRHALSSKAKAS 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++V+D++  ++ KTK L+ RF  + LSNALII G ++D NF  AAR IP I++LPVQGI
Sbjct: 121 TLIVVDDIKIEDHKTKGLIERFGKMGLSNALIIGGAEVDVNFGRAARAIPQIDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR   LVL+K+A++ALE+RFK
Sbjct: 181 NVYDILRRDTLVLTKAAVDALEERFK 206


>gi|312115688|ref|YP_004013284.1| ribosomal protein L4/L1e [Rhodomicrobium vannielii ATCC 17100]
 gi|311220817|gb|ADP72185.1| ribosomal protein L4/L1e [Rhodomicrobium vannielii ATCC 17100]
          Length = 206

 Score =  218 bits (556), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 109/206 (52%), Positives = 144/206 (69%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++  V  LD  + G + + + +FAL+P+  IL R++R+Q  +++ G  K+K RSEV    
Sbjct: 1   MKAEVITLDASNAGSVELDDAVFALEPRTDILQRMVRYQLSKRQAGTHKAKARSEVNGPN 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG+ARH +    QFRGGG+  GPVP    H LPKKVR+LAL+HALS K  S+
Sbjct: 61  KKIYKQKGTGQARHGNDKPPQFRGGGRTAGPVPRSHAHDLPKKVRALALKHALSVKAKSD 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++V+D     E KT  L  +F  L LSNALIIDG  L  NF LAARNIPN+++LPVQGI
Sbjct: 121 ALVVLDKAEVTEAKTAQLRGKFAGLGLSNALIIDGAVLQDNFALAARNIPNVDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR  KLVL+++A+EALE+RFK
Sbjct: 181 NVYDILRREKLVLTRAALEALEERFK 206


>gi|154245624|ref|YP_001416582.1| ribosomal protein L4/L1e [Xanthobacter autotrophicus Py2]
 gi|226731446|sp|A7IFY2|RL4_XANP2 RecName: Full=50S ribosomal protein L4
 gi|154159709|gb|ABS66925.1| ribosomal protein L4/L1e [Xanthobacter autotrophicus Py2]
          Length = 206

 Score =  218 bits (556), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 108/208 (51%), Positives = 150/208 (72%), Gaps = 4/208 (1%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +E++V+ LDG + G +++S++IF L+P+  IL R + WQ  R++ G  ++KGRSE+  T 
Sbjct: 1   MEITVKTLDGIEAGSVTLSDEIFGLEPRADILHRCVTWQLSRRQAGTHRTKGRSEINRTS 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHA--LPKKVRSLALRHALSDKFC 119
            KMY QKGTG ARH + S  QFRGGG+AFGPV  +  HA  LPKKVR+LAL+HALS K  
Sbjct: 61  KKMYKQKGTGNARHGAASAPQFRGGGRAFGPV--VRSHAIDLPKKVRALALKHALSSKAK 118

Query: 120 SNDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
           +  I+V+D +   + KTK L   F  L L + LI+DG Q+++N  LAARN+P +++LP+Q
Sbjct: 119 AAQIIVLDKVSLDDPKTKALKEHFAKLGLESVLIVDGAQVEQNVALAARNLPYVDVLPIQ 178

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRFK 207
           GINVYDILR   LVL+K+A++ALE RFK
Sbjct: 179 GINVYDILRRDTLVLTKAAVDALEARFK 206


>gi|304391454|ref|ZP_07373396.1| ribosomal protein, L4/L1 family [Ahrensia sp. R2A130]
 gi|303295683|gb|EFL90041.1| ribosomal protein, L4/L1 family [Ahrensia sp. R2A130]
          Length = 206

 Score =  218 bits (555), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 107/206 (51%), Positives = 147/206 (71%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +EL V  +DG   G +S+S+ +F L+P+Q I+ R++R+Q  + R G  + +GRS+V  TG
Sbjct: 1   MELDVTKMDGSKSGKVSLSDTVFGLEPRQDIIQRMVRYQLAKARQGTHQVQGRSDVDRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            +MY QKGTG ARH S++  QFRGGGKA GP      H L KK R+LALRHALS K  + 
Sbjct: 61  KRMYRQKGTGGARHHSQAAPQFRGGGKAHGPQSRDHSHDLTKKFRALALRHALSAKAQAG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++V+D+L +K+ KT  L      L   NAL+I G +LD NF+LAA+NIP+I++LPVQGI
Sbjct: 121 TLVVVDDLAAKDPKTAALRGNLGKLGFENALMIGGSELDNNFKLAAQNIPHIDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDI+R + LVLSK+A++ALE+RFK
Sbjct: 181 NVYDIIRRNTLVLSKAAVDALEERFK 206


>gi|220921900|ref|YP_002497201.1| 50S ribosomal protein L4 [Methylobacterium nodulans ORS 2060]
 gi|254803744|sp|B8IS86|RL4_METNO RecName: Full=50S ribosomal protein L4
 gi|219946506|gb|ACL56898.1| ribosomal protein L4/L1e [Methylobacterium nodulans ORS 2060]
          Length = 206

 Score =  218 bits (555), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 109/206 (52%), Positives = 144/206 (69%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++  +  LDG D G + + E IF L+P+  +L R +RWQ  +++ G  K K RSE++ T 
Sbjct: 1   MKFEITTLDGADAGSVELDEAIFGLEPRADLLQRCVRWQLAKRQAGTHKVKTRSEISRTT 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            KMY QKGTG ARH + S  QFRGG +AFGPV     H LPKKVR+LALRHALS K    
Sbjct: 61  KKMYKQKGTGNARHGAASAPQFRGGARAFGPVVRSHAHDLPKKVRALALRHALSAKAKDA 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++V+D++  ++ KTK L   F  L LSNALII G ++D NF  AARN+P+I++LPVQGI
Sbjct: 121 SLIVVDDVRLEDGKTKALKECFGKLGLSNALIIGGTEVDENFGRAARNLPSIDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR  KLVL+++A++ALE RFK
Sbjct: 181 NVYDILRRDKLVLTRAAVDALEARFK 206


>gi|298291439|ref|YP_003693378.1| ribosomal protein L4/L1e [Starkeya novella DSM 506]
 gi|296927950|gb|ADH88759.1| ribosomal protein L4/L1e [Starkeya novella DSM 506]
          Length = 206

 Score =  217 bits (553), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 144/206 (69%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +EL+V+ LDG D G +++S++IF L+P+Q IL R++ WQ  R++ G  ++  RSEV  T 
Sbjct: 1   MELAVKKLDGTDAGSVTLSDEIFGLEPRQDILHRMVVWQLARRQAGTHQTLSRSEVNRTK 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            KMY QKGTG ARH + S  QFRGG KAF PV       LPKKVR+LAL+HALS K    
Sbjct: 61  RKMYKQKGTGGARHGAASAPQFRGGAKAFAPVQHSHAIDLPKKVRALALKHALSSKAKDQ 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            I+V+D+    E KTK L  R   L LSN L++ G ++D NF LA+RN+ ++++LPVQGI
Sbjct: 121 QIVVLDDATLAEPKTKLLKERLAGLGLSNVLVVSGAEVDANFGLASRNVGHLDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR   LVL+K+A++ALE RFK
Sbjct: 181 NVYDILRRQTLVLTKAAVDALEARFK 206


>gi|300022542|ref|YP_003755153.1| ribosomal protein L4/L1e [Hyphomicrobium denitrificans ATCC 51888]
 gi|299524363|gb|ADJ22832.1| ribosomal protein L4/L1e [Hyphomicrobium denitrificans ATCC 51888]
          Length = 205

 Score =  217 bits (552), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 143/206 (69%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++  V NLD    G I ++++IF L+ +  ++ R++R+Q+ ++  G   ++ RSEVA TG
Sbjct: 1   MKAEVTNLDASKAGDIDLADEIFGLEVRNDLIHRMVRYQTLKRMAGTHHAQDRSEVAVTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            KM  QKGTG ARH  KS  QFRGGGKAFGP P      LPKKVR+LALRHALS K  + 
Sbjct: 61  KKMTKQKGTGGARHGDKSAPQFRGGGKAFGPKPRSHAIELPKKVRALALRHALSSKAKAG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           +I+VID   S E KT  L  +F  L L NALIIDG +L+  F  AARNIPNI++LPVQGI
Sbjct: 121 EIVVIDKATS-EGKTGALKAQFAKLSLDNALIIDGAELEPTFARAARNIPNIDVLPVQGI 179

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR  KLVL+++A+ ALE RFK
Sbjct: 180 NVYDILRRRKLVLTRAAVAALEARFK 205


>gi|182678338|ref|YP_001832484.1| 50S ribosomal protein L4 [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|226730620|sp|B2IK63|RL4_BEII9 RecName: Full=50S ribosomal protein L4
 gi|182634221|gb|ACB94995.1| ribosomal protein L4/L1e [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 206

 Score =  217 bits (552), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 107/206 (51%), Positives = 145/206 (70%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +++ + +++GE  G I + + IF L+P+  ++AR++R+Q  ++R G  +S GR+++  TG
Sbjct: 1   MKIDITSVNGETAGSIDLDDAIFGLEPRVDLIARMIRYQLAKRRAGTHQSLGRADIHRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            KMY QKGTG ARH S    QFRGGGKAFGPV     H LPKK+R+LAL+HALS K    
Sbjct: 61  KKMYKQKGTGSARHGSARAPQFRGGGKAFGPVARSHEHDLPKKIRALALKHALSAKAKDG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            I++ ++    E KTK L   F  + L+NALIIDG +L+ NF LAARNIP I++LPVQGI
Sbjct: 121 GIIIWNDAKIPEAKTKGLKANFEKIGLTNALIIDGAELETNFSLAARNIPQIDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDI+R  KLVL+ +AI ALE RFK
Sbjct: 181 NVYDIVRRDKLVLTTAAINALEARFK 206


>gi|46205275|ref|ZP_00048760.2| COG0088: Ribosomal protein L4 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 206

 Score =  215 bits (548), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 145/206 (70%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L +  LDG   G + ++E IF L+P+  IL R++R+Q  ++R G    K RS+V  T 
Sbjct: 1   MKLDITTLDGGSAGSVELNEAIFGLEPRADILQRMVRYQLAKRRAGTHAVKNRSDVDRTS 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH + S  QFRGGG+AFGPV     H LPKKVR+LAL+HALS K  ++
Sbjct: 61  KKLYKQKGTGNARHGAASAPQFRGGGRAFGPVVRDHSHDLPKKVRALALKHALSTKAKAS 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++V+D++     KTK ++ RF  L LS+ALII G ++D NF  AAR IP I++LPVQGI
Sbjct: 121 TLIVVDDIKVDSHKTKAMIERFEKLGLSSALIIGGSEVDENFGRAARAIPKIDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR   LVL+++A++ALE+RFK
Sbjct: 181 NVYDILRRDTLVLTRAAVDALEERFK 206


>gi|188581376|ref|YP_001924821.1| 50S ribosomal protein L4 [Methylobacterium populi BJ001]
 gi|226730691|sp|B1ZLK5|RL4_METPB RecName: Full=50S ribosomal protein L4
 gi|179344874|gb|ACB80286.1| ribosomal protein L4/L1e [Methylobacterium populi BJ001]
          Length = 206

 Score =  215 bits (547), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 145/206 (70%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L +  LDG   G + ++E IF L+P+  IL R++R+Q  ++R G    K RS+V  T 
Sbjct: 1   MKLDITTLDGGSAGSLELNEAIFGLEPRADILQRMVRYQLAKRRAGTHAVKNRSDVDRTT 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH + S  QFRGGG+AFGPV     H LPKKVR+LAL+HALS K  ++
Sbjct: 61  KKLYKQKGTGNARHGAASAPQFRGGGRAFGPVVRDHSHDLPKKVRALALKHALSSKAKTS 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++V+D++     KTK ++ RF  L LS+ALII G ++D NF  AAR IP I++LPVQGI
Sbjct: 121 TLIVVDDIKVDSHKTKAMIERFEKLGLSSALIIGGSEVDENFGRAARAIPKIDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR   LVL+++A++ALE+RFK
Sbjct: 181 NVYDILRRDTLVLTRAAVDALEERFK 206


>gi|163851586|ref|YP_001639629.1| ribosomal protein L4/L1e [Methylobacterium extorquens PA1]
 gi|218530395|ref|YP_002421211.1| 50S ribosomal protein L4 [Methylobacterium chloromethanicum CM4]
 gi|240138754|ref|YP_002963226.1| 50S ribosomal subunit protein L4, regulates expression of S10
           operon [Methylobacterium extorquens AM1]
 gi|254561354|ref|YP_003068449.1| 50S ribosomal subunit protein L4, regulates expression of S10
           operon [Methylobacterium extorquens DM4]
 gi|226730686|sp|A9W4Q2|RL4_METEP RecName: Full=50S ribosomal protein L4
 gi|254803743|sp|B7L0R2|RL4_METC4 RecName: Full=50S ribosomal protein L4
 gi|163663191|gb|ABY30558.1| ribosomal protein L4/L1e [Methylobacterium extorquens PA1]
 gi|218522698|gb|ACK83283.1| ribosomal protein L4/L1e [Methylobacterium chloromethanicum CM4]
 gi|240008723|gb|ACS39949.1| 50S ribosomal subunit protein L4, regulates expression of S10
           operon [Methylobacterium extorquens AM1]
 gi|254268632|emb|CAX24591.1| 50S ribosomal subunit protein L4, regulates expression of S10
           operon [Methylobacterium extorquens DM4]
          Length = 206

 Score =  214 bits (544), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 105/206 (50%), Positives = 145/206 (70%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L +  LDG   G + ++E I+ L+P+  IL R++R+Q  ++R G    K RS+V  T 
Sbjct: 1   MKLDITTLDGGSAGSVELNEAIYGLEPRADILQRMVRYQLAKRRAGTHAVKNRSDVDRTS 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH + S  QFRGGG+AFGPV     H LPKKVR+LAL+HALS K  ++
Sbjct: 61  KKLYKQKGTGNARHGAASAPQFRGGGRAFGPVVRDHSHDLPKKVRALALKHALSAKAKAS 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++V+D++     KTK ++ RF  L LS+ALII G ++D NF  AAR IP I++LPVQGI
Sbjct: 121 TLIVVDDIKVDNHKTKAMIERFEKLGLSSALIIGGSEVDENFGRAARAIPKIDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR   LVL+++A++ALE+RFK
Sbjct: 181 NVYDILRRDTLVLTRAAVDALEERFK 206


>gi|118591183|ref|ZP_01548582.1| 50S ribosomal protein L4 [Stappia aggregata IAM 12614]
 gi|118436259|gb|EAV42901.1| 50S ribosomal protein L4 [Stappia aggregata IAM 12614]
          Length = 206

 Score =  211 bits (537), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 107/206 (51%), Positives = 150/206 (72%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +EL V+ L+G   G I+VS++IF L+P+  ++ RV+RWQ  +++ G  K+ GRSEV+ T 
Sbjct: 1   MELQVKTLEGGAAGSITVSDEIFGLEPRTDLIHRVVRWQLAKRQAGTHKALGRSEVSGTT 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K   QKG+G ARH +K   QFRGGGKAFGP+     H LPKKVR+L L+HALS K  ++
Sbjct: 61  KKFVRQKGSGGARHGNKKAPQFRGGGKAFGPIVRDHSHDLPKKVRALGLKHALSAKAMTD 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            I+V+++  + E KTK L  +   L L++ALIIDG ++D NF LA+RNIP++++LPVQGI
Sbjct: 121 SIVVVEDAKAAEAKTKALKAQLSKLGLTSALIIDGAEVDANFALASRNIPHLDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR + LVL+K+A+ ALE+R K
Sbjct: 181 NVYDILRANTLVLTKAAVSALEERLK 206


>gi|254502843|ref|ZP_05114994.1| ribosomal protein L4/L1 family [Labrenzia alexandrii DFL-11]
 gi|222438914|gb|EEE45593.1| ribosomal protein L4/L1 family [Labrenzia alexandrii DFL-11]
          Length = 206

 Score =  208 bits (529), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 149/206 (72%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +EL V+ L+G   G I+VS++IF L P+  ++ RV+RWQ  +++ G  K+ GRSEV  + 
Sbjct: 1   MELQVKTLEGGAAGSITVSDEIFGLDPRTDLIHRVVRWQLAKRQAGTHKTLGRSEVTGST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K   QKG+G ARH +K   QFRGGG+AFGPV     H LPKKVR L L+HALS K  ++
Sbjct: 61  KKFVRQKGSGGARHGNKKAPQFRGGGRAFGPVVRDHGHDLPKKVRVLGLKHALSAKAKAD 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            I+V+++  + E KTK L ++   L L++AL+IDG ++D NF LA+RNIP++++LPVQGI
Sbjct: 121 SIVVVEDAKAAEAKTKALKSQLNKLGLTSALVIDGAEVDNNFALASRNIPHLDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR + LVL+K+A+ ALE+RFK
Sbjct: 181 NVYDILRANTLVLTKAAVSALEERFK 206


>gi|110180284|gb|ABG54385.1| 23S ribosomal protein L4 [Brucella ceti]
          Length = 188

 Score =  207 bits (526), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 141/206 (68%), Gaps = 18/206 (8%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L++  L+G+D G + ++E+IF L P+  IL RV+RWQ  R++ G  K++GR       
Sbjct: 1   MDLTITTLEGKDAGKVKLNEEIFGLDPRDDILQRVVRWQLARRQQGSHKAQGR------- 53

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
                      ARH S    QFRGGG+A GPV     H LPKKV +L LRHALS K  ++
Sbjct: 54  -----------ARHHSARAPQFRGGGQAHGPVVRNHDHDLPKKVLALGLRHALSAKAKAS 102

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           D+++ID+L S + KTK LV++F  L L NAL+I G ++D NFQ AA NIPNI++LPVQGI
Sbjct: 103 DLIIIDDLASADAKTKQLVSQFAKLGLENALLIGGAEIDANFQRAASNIPNIDVLPVQGI 162

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR  KLVLSK+A+EALE+RFK
Sbjct: 163 NVYDILRRGKLVLSKAAVEALEERFK 188


>gi|296447531|ref|ZP_06889453.1| ribosomal protein L4/L1e [Methylosinus trichosporium OB3b]
 gi|296254919|gb|EFH02024.1| ribosomal protein L4/L1e [Methylosinus trichosporium OB3b]
          Length = 206

 Score =  206 bits (524), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 142/206 (68%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +++ V + DG++ G I ++++IF L+P+  ++ R++RWQ  ++R G    K R+++A TG
Sbjct: 1   MQIGVTSYDGQEAGSIELADEIFGLEPRTDLIFRMIRWQLAKRRAGTHAVKNRADIARTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            KMY QKGTG ARH S+ V QF GGG+AFGPV     H LPKKVR+LAL+HALS K    
Sbjct: 61  KKMYKQKGTGGARHGSRRVPQFIGGGRAFGPVVRSHEHDLPKKVRALALKHALSAKAKDG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            I+V +N      KTK L   F    L++ALIIDG +   NF LAARN+P I++LPV G+
Sbjct: 121 AIIVWENASLDAPKTKMLKAGFDKTGLTSALIIDGAEPQVNFALAARNLPKIDVLPVTGV 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR  KLVL+++A++ALE R K
Sbjct: 181 NVYDILRRDKLVLTRAAVDALEARLK 206


>gi|254470116|ref|ZP_05083520.1| ribosomal protein, L4/L1 family [Pseudovibrio sp. JE062]
 gi|211960427|gb|EEA95623.1| ribosomal protein, L4/L1 family [Pseudovibrio sp. JE062]
          Length = 205

 Score =  203 bits (517), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 145/205 (70%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +EL V+ L G+  G I+VS++IF L+P+  ++ RV+RWQ  +++ G  KS GRSEV  T 
Sbjct: 1   MELEVKTLGGKAAGSITVSDEIFGLEPRIDLIQRVVRWQLAKRQAGTHKSLGRSEVNGTT 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K   QKG+G ARH ++   QFRGGGKAFGPV     H LPKKVR+L L+HALS K  S 
Sbjct: 61  KKFVRQKGSGGARHGNRKAPQFRGGGKAFGPVVREHAHDLPKKVRALGLKHALSAKAASG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           ++ ++++  + E KTK L  +  +L L++AL +DG ++D NF LA RNIP +++LPVQGI
Sbjct: 121 NLYIVEDAKAAEAKTKALKEQLGSLGLTSALFVDGAEVDANFGLATRNIPLVDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRF 206
           NVYDILR   LVL+K+A+ ALE+RF
Sbjct: 181 NVYDILRRDTLVLTKAAVAALEERF 205


>gi|323136087|ref|ZP_08071170.1| ribosomal protein L4/L1e [Methylocystis sp. ATCC 49242]
 gi|322399178|gb|EFY01697.1| ribosomal protein L4/L1e [Methylocystis sp. ATCC 49242]
          Length = 206

 Score =  201 bits (510), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 102/206 (49%), Positives = 137/206 (66%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +++ V + DG+  G I +S+D+F L+P+  ++ R++RWQ  ++R G    K R+++A TG
Sbjct: 1   MKIDVTSFDGQAAGSIELSDDVFGLEPRTDLIFRMIRWQLAKRRAGTHAVKNRADIARTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            KMY QKGTG ARH S    QFRGGG+AFGP      H LPKKVR LAL+HALS K    
Sbjct: 61  KKMYKQKGTGGARHGSGRAPQFRGGGRAFGPQVRSHEHDLPKKVRQLALKHALSAKAKDG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            I+V +     E KTK L   F    L+NA+II G     NF LAARNIP I++LPV+G+
Sbjct: 121 GIIVWEKAELAEPKTKILAGGFAKSGLNNAIIIVGGAPQANFALAARNIPQIDVLPVEGV 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDI+R  KLVL+++A++ALE R K
Sbjct: 181 NVYDIIRREKLVLTRAAVDALEARLK 206


>gi|254418759|ref|ZP_05032483.1| ribosomal protein L4/L1 family [Brevundimonas sp. BAL3]
 gi|196184936|gb|EDX79912.1| ribosomal protein L4/L1 family [Brevundimonas sp. BAL3]
          Length = 212

 Score =  200 bits (509), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 140/206 (67%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQG-ILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           ++LSV  LDG+  G + +S+ +F +   +G ILAR + WQ  ++R G  K + R+E + T
Sbjct: 1   MKLSVIQLDGKAAGDVELSDAVFGISDIRGDILARTVNWQLAKRRAGTHKVQTRNENSRT 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G KMY QKGTG ARH S+   QF GG +AFGPV      +LPKK+R+LALRHALS K  S
Sbjct: 61  GKKMYKQKGTGGARHGSRRAPQFVGGSRAFGPVVRDHGFSLPKKIRALALRHALSSKAKS 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            D++V+D +  KE KT  L      L  + ALII G ++D NF LAARNIP+I++LP  G
Sbjct: 121 GDLIVVDTVSVKEAKTASLRETLGKLGWTKALIIAGPEVDTNFGLAARNIPHIDVLPNAG 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVYDILR  KLVL+K+AIEA+E RF
Sbjct: 181 LNVYDILRADKLVLTKAAIEAIEARF 206


>gi|307946287|ref|ZP_07661622.1| ribosomal protein, L4/L1 family [Roseibium sp. TrichSKD4]
 gi|307769951|gb|EFO29177.1| ribosomal protein, L4/L1 family [Roseibium sp. TrichSKD4]
          Length = 206

 Score =  199 bits (507), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 146/206 (70%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +EL V+ L+G   G I+VS++IF L+P+  ++ RV+RWQ  +++ G  K+  RSEV  T 
Sbjct: 1   MELQVKTLEGGAAGSITVSDEIFGLEPRTDLIHRVVRWQLAKRQAGTHKTLQRSEVTGTT 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K   QKG+G ARH ++   QFRGGGKAFGP+     H LPKKVR L L+H LS K  ++
Sbjct: 61  KKFVRQKGSGGARHGNRKAPQFRGGGKAFGPIVRDHSHDLPKKVRVLGLKHVLSAKAKAD 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++V+++  + E KTK L  +     L++ALIIDG ++D NF LA+RNIP++++LPVQGI
Sbjct: 121 SLIVVEDAKAAEAKTKALKEQLAKAGLTSALIIDGAEVDANFALASRNIPHVDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDI++ + LVL+K+A+ ALE+RFK
Sbjct: 181 NVYDIMQANTLVLTKAAVSALEERFK 206


>gi|302382619|ref|YP_003818442.1| ribosomal protein L4/L1e [Brevundimonas subvibrioides ATCC 15264]
 gi|302193247|gb|ADL00819.1| ribosomal protein L4/L1e [Brevundimonas subvibrioides ATCC 15264]
          Length = 222

 Score =  194 bits (493), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 137/206 (66%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQG-ILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           ++LS  NLDG+  G + +S+ IF +   +G +LAR + WQ  ++R G  K + R+E + T
Sbjct: 1   MKLSSINLDGKAAGDVELSDVIFGITDIRGDLLARYVNWQLAKRRAGTHKVQTRNENSRT 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G KMY QKGTG ARH S+   QF GG +AFGP+       LPKKVR+LALRHALS K  +
Sbjct: 61  GKKMYKQKGTGGARHGSRRAPQFVGGSRAFGPIVRDHGFDLPKKVRALALRHALSSKVKT 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            D++V+D L  KE KT  L   F  L  +  LII G ++D NF LA+RNIP I++LP  G
Sbjct: 121 GDLVVVDALTVKEAKTSALRETFGKLGWTRTLIIAGPEVDANFALASRNIPQIHVLPNAG 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVYDILR  KLVL+KSA+EA+E  +
Sbjct: 181 LNVYDILRADKLVLTKSAVEAIEATY 206


>gi|154253178|ref|YP_001414002.1| 50S ribosomal protein L4/L1e [Parvibaculum lavamentivorans DS-1]
 gi|171769628|sp|A7HWR2|RL4_PARL1 RecName: Full=50S ribosomal protein L4
 gi|154157128|gb|ABS64345.1| ribosomal protein L4/L1e [Parvibaculum lavamentivorans DS-1]
          Length = 206

 Score =  194 bits (493), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 144/206 (69%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +++ V  L+ +  G + +++ +FAL+P+  IL R++ WQ  +++ G  K+KGRSE+A TG
Sbjct: 1   MKIDVTTLEAKKAGSVDLTDGVFALEPRGDILHRMVAWQLAKRQAGTHKTKGRSEIALTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K   QKG+G ARH  +   QFRGGGKAFGPV       +PKKVR+LAL+ ALS K  S+
Sbjct: 61  KKFVKQKGSGGARHGDRKAPQFRGGGKAFGPVVRSHAFDMPKKVRALALKLALSAKAKSD 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           +++++D     E +TK     F  L L + LIIDG +LD NF LAARN+PN+++LPVQGI
Sbjct: 121 NLVILDEAKLAEPRTKAAKDAFEKLGLKSVLIIDGAELDANFALAARNLPNVDVLPVQGI 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR  KLVL+K+A+E+LE RFK
Sbjct: 181 NVYDILRREKLVLTKAAVESLEARFK 206


>gi|167645579|ref|YP_001683242.1| 50S ribosomal protein L4 [Caulobacter sp. K31]
 gi|189029494|sp|B0T2C3|RL4_CAUSK RecName: Full=50S ribosomal protein L4
 gi|167348009|gb|ABZ70744.1| ribosomal protein L4/L1e [Caulobacter sp. K31]
          Length = 212

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 136/206 (66%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQG-ILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           ++L V NLDG   G + + + IF +   +G IL RV+ WQ  ++R G  K + R+EV+ T
Sbjct: 1   MKLDVINLDGGKAGSVDLDDAIFGIADIRGDILQRVVTWQLAKRRSGNHKIQVRNEVSRT 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G KMY QKGTG ARH S+  +QF GG KA GPV       LPKK+R++ALRHALS K  S
Sbjct: 61  GKKMYKQKGTGSARHGSRRAAQFVGGAKAHGPVVRSHAFDLPKKIRAMALRHALSSKAKS 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             I+V+D  V  + KT  L   F  + L NAL+I G ++D NF+LAARNIPNI++LP  G
Sbjct: 121 GSIIVLDTAVLTDPKTAALRANFDKIGLKNALVIAGPEVDGNFKLAARNIPNIDVLPNAG 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVYD+LR   LVL+K A+EA+  RF
Sbjct: 181 LNVYDVLRRHTLVLTKDAVEAISARF 206


>gi|315497974|ref|YP_004086778.1| ribosomal protein l4/l1e [Asticcacaulis excentricus CB 48]
 gi|315415986|gb|ADU12627.1| ribosomal protein L4/L1e [Asticcacaulis excentricus CB 48]
          Length = 210

 Score =  192 bits (489), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 102/207 (49%), Positives = 134/207 (64%), Gaps = 1/207 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKP-QQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           ++L V  LD    G + VS+ +F L+  +  ILARV+ WQ  ++R G  K + R+E + T
Sbjct: 1   MKLDVITLDNGTAGSVDVSDAVFGLEEIRNDILARVVNWQLAKRRAGTHKVQTRNENSRT 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G KMY QKG+G ARH S+   QF GG +AFGPV       L KKVR+L LRHALS K  +
Sbjct: 61  GKKMYKQKGSGGARHGSRRAPQFVGGSRAFGPVVRSHAFDLQKKVRALGLRHALSSKAKA 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             ++V+D       KT  L  +F  L L NALII G ++D NF LA+RNIPNI++LP  G
Sbjct: 121 GALIVLDQATLDSAKTAALRAKFETLGLKNALIIAGPEVDTNFALASRNIPNIDVLPSAG 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRFK 207
           +NVYD+LR   LVL+KSA+EA+E RFK
Sbjct: 181 LNVYDVLRRHTLVLTKSAVEAIEARFK 207


>gi|197104697|ref|YP_002130074.1| 50S ribosomal protein L4 [Phenylobacterium zucineum HLK1]
 gi|226730702|sp|B4R8L8|RL4_PHEZH RecName: Full=50S ribosomal protein L4
 gi|196478117|gb|ACG77645.1| 50S ribosomal protein L4 [Phenylobacterium zucineum HLK1]
          Length = 212

 Score =  190 bits (482), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 99/207 (47%), Positives = 135/207 (65%), Gaps = 1/207 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKP-QQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           ++L V  LDG   G I + +DIF ++  +  IL R + WQ  ++R G  K + R+EV+ T
Sbjct: 1   MKLDVIKLDGGKGGSIELPDDIFGIEEIRADILQRCVTWQLAKRRAGTHKIQVRNEVSRT 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G KMY QKGTG ARH S+  +QF GG KA GPV       LPKKVR+LALRHALS K   
Sbjct: 61  GKKMYKQKGTGGARHGSRRAAQFVGGAKAHGPVVRSHAFDLPKKVRALALRHALSSKAKD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             ++V+D+    E KT  L   F  + ++NAL+I G Q+D N +LAARNIPN+++LP  G
Sbjct: 121 GSLIVLDSATLTEAKTAALRASFEKIGVTNALVIAGAQVDNNLKLAARNIPNVDVLPNAG 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRFK 207
           +NVYD+LR   LVL+K A+ A++ RF+
Sbjct: 181 LNVYDVLRRRTLVLTKDAVAAIQARFQ 207


>gi|126736643|ref|ZP_01752383.1| ribosomal protein L4/L1e [Roseobacter sp. CCS2]
 gi|126713956|gb|EBA10827.1| ribosomal protein L4/L1e [Roseobacter sp. CCS2]
          Length = 206

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 93/198 (46%), Positives = 129/198 (65%)

Query: 9   LDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQK 68
           LDG+  G + ++++IF L+P++ IL RV+RWQ  +   G     GRSEV+Y+  K+Y QK
Sbjct: 8   LDGKKAGSVELNDEIFGLEPRKDILHRVVRWQRNKAMQGTHDVLGRSEVSYSTKKIYRQK 67

Query: 69  GTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDN 128
           GTG ARH S+    FRGGG   GP P    H LPKK R L L+HALS K  + +++++D+
Sbjct: 68  GTGGARHGSRGAPIFRGGGTYKGPTPRSHAHDLPKKFRKLGLKHALSAKVAAGELVIVDD 127

Query: 129 LVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILR 188
           +  K+ KT  L  +  +L    ALIIDG +++ +F+ AA NI  IN+LP QG NVYDILR
Sbjct: 128 INVKDSKTSALAKQLGSLGWKRALIIDGSEVNADFKKAAANITTINVLPSQGANVYDILR 187

Query: 189 CSKLVLSKSAIEALEDRF 206
              LVL+K+ +EALE R 
Sbjct: 188 SDTLVLTKAGVEALEARL 205


>gi|16125498|ref|NP_420062.1| 50S ribosomal protein L4 [Caulobacter crescentus CB15]
 gi|221234244|ref|YP_002516680.1| 50S ribosomal protein L4 [Caulobacter crescentus NA1000]
 gi|46577288|sp|Q9A8V2|RL4_CAUCR RecName: Full=50S ribosomal protein L4
 gi|254803724|sp|B8H4D5|RL4_CAUCN RecName: Full=50S ribosomal protein L4
 gi|13422580|gb|AAK23230.1| ribosomal protein L4 [Caulobacter crescentus CB15]
 gi|220963416|gb|ACL94772.1| LSU ribosomal protein L1E-L4P [Caulobacter crescentus NA1000]
          Length = 212

 Score =  189 bits (479), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 135/206 (65%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQG-ILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           ++L V  LDG   G + + + IF +   +G IL RV+ WQ  ++R G  K + R+EV+ T
Sbjct: 1   MKLDVIKLDGGKAGSVDLDDAIFGIDEIRGDILQRVVTWQLAKRRSGNHKIQVRNEVSRT 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
             KMY QKGTG ARH S+  +QF GG KA GPV       LPKK+R+LALRHALS K  +
Sbjct: 61  SKKMYKQKGTGGARHGSRRAAQFVGGAKAHGPVVRSHAFDLPKKIRALALRHALSSKAKA 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             ++V+D++   E KT  L   F  + L NAL+I G ++D NF+LAARNIPN+++LP  G
Sbjct: 121 GSLVVVDSVALTEAKTAALRATFDKIGLKNALVIAGPEVDANFKLAARNIPNVDVLPNAG 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVYD+LR   LVL+K A+EA+  RF
Sbjct: 181 LNVYDVLRRQTLVLTKDAVEAISARF 206


>gi|329850208|ref|ZP_08265053.1| 50S ribosomal protein L4 [Asticcacaulis biprosthecum C19]
 gi|328840523|gb|EGF90094.1| 50S ribosomal protein L4 [Asticcacaulis biprosthecum C19]
          Length = 210

 Score =  189 bits (479), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 131/206 (63%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKP-QQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           ++L V  LD    G + +S+ +F +   +  IL RV+ WQ  ++R G  K + R+E + T
Sbjct: 1   MKLDVITLDASAAGSVELSDLVFGISDIRADILHRVVNWQLAKRRAGTHKVQTRNENSRT 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G KMY QKG+G ARH S+   QF GG +AFGPV       LPKKVR+L LRHALS K   
Sbjct: 61  GKKMYKQKGSGGARHGSRRAPQFVGGSRAFGPVVRSHAFDLPKKVRALGLRHALSSKVKD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             ++V+D  V    KT  L   F  L L+NAL I G ++D NF LA+RNIPNI++LP  G
Sbjct: 121 GALIVLDQAVVASPKTSALKASFEKLGLNNALFITGAEVDTNFALASRNIPNIDVLPTAG 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVYDILR  KLVL+ +A+EA+E RF
Sbjct: 181 LNVYDILRRHKLVLTTAAVEAIEARF 206


>gi|163796918|ref|ZP_02190875.1| 50S ribosomal protein L2 [alpha proteobacterium BAL199]
 gi|159177907|gb|EDP62456.1| 50S ribosomal protein L2 [alpha proteobacterium BAL199]
          Length = 206

 Score =  188 bits (478), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 129/206 (62%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L V NLD E  G I + + IF L P++ ILARV+ WQ  ++R G  K+K  SE++ T 
Sbjct: 1   MKLEVTNLDAEKTGEIDLDDSIFGLDPRRDILARVVNWQLAKRRSGNHKTKSISEISGTT 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K + QKGTGRAR  S   +QFRGG    GPV     H LPKKVR L L+ ALS K  S 
Sbjct: 61  KKPFRQKGTGRARQGSIRATQFRGGQTVHGPVVRSHAHDLPKKVRKLGLKCALSAKLKSG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++V+D   + E KTK L  +F  L   + L+IDG +L+  F  AARNIP +++LP QG 
Sbjct: 121 QLIVLDAASTDEAKTKLLAAKFEKLGWQSVLVIDGPELNEGFARAARNIPRVDVLPQQGA 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR   LVL++ A+E LE R K
Sbjct: 181 NVYDILRRETLVLTRGAVEHLEARLK 206


>gi|329889130|ref|ZP_08267473.1| 50S ribosomal protein L4 [Brevundimonas diminuta ATCC 11568]
 gi|328844431|gb|EGF93995.1| 50S ribosomal protein L4 [Brevundimonas diminuta ATCC 11568]
          Length = 212

 Score =  188 bits (477), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 143/206 (69%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQG-ILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           ++LSV  LDG+  G + +S+ +F +   +G +LAR + WQ  ++R G  K + R+E + T
Sbjct: 1   MKLSVIKLDGKAAGDVELSDAVFGISDIRGDLLARYVNWQLAKRRAGTHKVQTRNENSRT 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G KMY QKGTG ARH S+   QF GG +AFGPV     ++LPKKVR+LALRHALS K  +
Sbjct: 61  GKKMYKQKGTGGARHGSRRAPQFVGGSRAFGPVVRDHGYSLPKKVRALALRHALSSKAKA 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            D++V+D++  KE KT  L   F  L  + ALII G +++ NF LAARNIP+I++LP  G
Sbjct: 121 GDLVVVDSVSVKEAKTASLRETFGKLGWTKALIIAGPEVETNFGLAARNIPHIDVLPNAG 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVYDILR  KLVL+K+A+EA+E RF
Sbjct: 181 LNVYDILRADKLVLTKAAVEAIEARF 206


>gi|110180288|gb|ABG54387.1| 23S ribosomal protein L4 [Brucella ceti]
          Length = 176

 Score =  187 bits (476), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 134/206 (65%), Gaps = 30/206 (14%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L++  L+G+D G + ++E+IF L P+  IL RV+RWQ  R++ G  K++GR       
Sbjct: 1   MDLTITTLEGKDAGKVKLNEEIFGLDPRDDILQRVVRWQLARRQQGSHKAQGR------- 53

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
                                  GGG+A GPV     H LPKKV +L LRHALS K  ++
Sbjct: 54  -----------------------GGGQAHGPVVRNHDHDLPKKVLALGLRHALSAKAKAS 90

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           D+++ID+L S + KTK LV++F  L L NAL+I G ++D NFQ AA NIPNI++LPVQGI
Sbjct: 91  DLIIIDDLASADAKTKQLVSQFAKLGLENALLIGGAEIDANFQRAASNIPNIDVLPVQGI 150

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR  KLVLSK+A+EALE+RFK
Sbjct: 151 NVYDILRRGKLVLSKAAVEALEERFK 176


>gi|288957423|ref|YP_003447764.1| large subunit ribosomal protein L4 [Azospirillum sp. B510]
 gi|288909731|dbj|BAI71220.1| large subunit ribosomal protein L4 [Azospirillum sp. B510]
          Length = 206

 Score =  187 bits (475), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 98/206 (47%), Positives = 132/206 (64%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++ +++NL+ E  G I +S+ +F L  +  +LAR++ WQ  ++R G  K+KG SE++ T 
Sbjct: 1   MKATIKNLNNEAVGEIELSDAVFGLPARTDLLARMVNWQLAKRRSGNHKTKGISEISGTT 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K Y QKGTGRAR  S    QFRGG   FGPV     H L KKVR LAL+ ALS K    
Sbjct: 61  KKPYGQKGTGRARQGSIRSPQFRGGATIFGPVVRSHAHELTKKVRKLALKTALSAKAAEG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++V++   ++  KTK L  R   L L++ALIIDG  LD NF  A+RNIP I++LP QG 
Sbjct: 121 KLIVLEAAAAETHKTKELAARLATLGLTSALIIDGANLDENFAKASRNIPLIDVLPEQGA 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR   LVL+++A+E LE R K
Sbjct: 181 NVYDILRRDTLVLTRNAVEQLEARLK 206


>gi|209964041|ref|YP_002296956.1| 50S ribosomal protein L4 [Rhodospirillum centenum SW]
 gi|226730714|sp|B6IRQ7|RL4_RHOCS RecName: Full=50S ribosomal protein L4
 gi|209957507|gb|ACI98143.1| ribosomal protein L4 [Rhodospirillum centenum SW]
          Length = 206

 Score =  187 bits (474), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 133/206 (64%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++ +V+NL+ E  G I +++++F L  +Q IL R++ WQ  ++R G  K+KG SE+A T 
Sbjct: 1   MKTTVKNLNNETVGEIELADEVFGLPTRQDILTRMVLWQLAKRRQGTHKTKGISEIAGTT 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K + QKGTGRAR  S    QFRGG + FGPV     H L KKVR LAL+ ALS K    
Sbjct: 61  KKPWRQKGTGRARQGSTRSPQFRGGARIFGPVVRSHEHDLTKKVRKLALKTALSTKAAEG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            + V++   +   KTK L  + + L L++ALIIDG  LD  F  AARNIP++++LP QG 
Sbjct: 121 KLFVLEAAKADTHKTKALAAQLKTLGLTSALIIDGANLDETFVRAARNIPHLDVLPEQGA 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR   LVL+++A+E LE R K
Sbjct: 181 NVYDILRRDVLVLTRNAVEQLEARLK 206


>gi|295688907|ref|YP_003592600.1| 50S 50S ribosomal protein L4/L1e [Caulobacter segnis ATCC 21756]
 gi|295430810|gb|ADG09982.1| ribosomal protein L4/L1e [Caulobacter segnis ATCC 21756]
          Length = 212

 Score =  186 bits (472), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 135/206 (65%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQG-ILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           ++L V  LDG   G + + + IF +   +G IL RV+ WQ  ++R G  K + R+EV+ T
Sbjct: 1   MKLDVIKLDGGKAGSVDLDDAIFGIDDIRGDILQRVVTWQLAKRRSGNHKIQVRNEVSRT 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
             KMY QKGTG ARH S+  +QF GG KA GPV       LPKK+R+LAL+HALS K  S
Sbjct: 61  SKKMYKQKGTGGARHGSRRAAQFVGGAKAHGPVVRSHAFDLPKKIRALALKHALSSKAKS 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             ++V+D+ V  + KT  L   F  + L NAL+I G ++D NF+LAARNIPN+++LP  G
Sbjct: 121 GSLVVLDSAVLTDPKTAALRANFDKIGLKNALVIAGPEVDANFKLAARNIPNVDVLPNAG 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVYD+LR   LVL+K A+EA+  RF
Sbjct: 181 LNVYDVLRRQTLVLTKDAVEAISARF 206


>gi|310817007|ref|YP_003964971.1| 50S ribosomal protein L4 [Ketogulonicigenium vulgare Y25]
 gi|308755742|gb|ADO43671.1| 50S ribosomal protein L4 [Ketogulonicigenium vulgare Y25]
          Length = 206

 Score =  185 bits (469), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 96/200 (48%), Positives = 125/200 (62%)

Query: 8   NLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQ 67
           NLDG   G + +++ IFAL+P+  IL R++RWQ  R + G  K  G+SEV+Y+  K+Y Q
Sbjct: 7   NLDGGAAGSVELNDAIFALEPRADILHRLVRWQRARAQQGTHKVLGKSEVSYSTKKIYRQ 66

Query: 68  KGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVID 127
           KGTG ARH SK    FR GG   GP P    H L KK R+L L+HALS K  + +++VI+
Sbjct: 67  KGTGGARHGSKKAPIFRHGGVYKGPTPRSHEHDLTKKFRALGLKHALSAKAKAGELVVIE 126

Query: 128 NLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDIL 187
                E KT  L  +   L    AL+IDG  +D  F  AARNI N+++LP  G NVYDIL
Sbjct: 127 AATVAEAKTALLAKQLSNLGWKRALVIDGAAVDEGFARAARNIANLDILPSMGANVYDIL 186

Query: 188 RCSKLVLSKSAIEALEDRFK 207
           R   LVL+K+A+EALE R K
Sbjct: 187 RSDTLVLTKAAVEALEARLK 206


>gi|159042833|ref|YP_001531627.1| 50S ribosomal protein L4 [Dinoroseobacter shibae DFL 12]
 gi|189029501|sp|A8LM49|RL4_DINSH RecName: Full=50S ribosomal protein L4
 gi|157910593|gb|ABV92026.1| 50S ribosomal protein L4/L1e [Dinoroseobacter shibae DFL 12]
          Length = 205

 Score =  184 bits (466), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 96/206 (46%), Positives = 129/206 (62%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L V  LDGE  G + + E +F L+P+  IL RV+RWQ  + + G  K K RSEV+Y+ 
Sbjct: 1   MKLDVIKLDGEAAGSVELDEALFGLEPRADILHRVVRWQRNKAQAGTHKVKTRSEVSYST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH ++S   FR GG   GP P    H LPKK R L L+HALS K  + 
Sbjct: 61  KKIYRQKGTGGARHGARSAPIFRKGGIYKGPTPRSHAHDLPKKFRKLGLKHALSAKAKAG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           +++VID + + E KT  L  + + L    AL+IDG Q+D  F  AA NI  +++LP  G 
Sbjct: 121 ELVVID-MATSEGKTATLAKQIKNLGWKRALVIDGAQVDAGFAKAAANIDTLDVLPSMGA 179

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDIL+   LVL+K+ +EALE R K
Sbjct: 180 NVYDILKRDTLVLTKAGVEALEARLK 205


>gi|260577180|ref|ZP_05845157.1| ribosomal protein L4/L1e [Rhodobacter sp. SW2]
 gi|259020654|gb|EEW23973.1| ribosomal protein L4/L1e [Rhodobacter sp. SW2]
          Length = 206

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 128/206 (62%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L V  LDG   G I++ E +F L+P+  IL RV+RWQ  + + G   +  R+EV+Y+ 
Sbjct: 1   MKLDVIKLDGGKAGSITLDEALFGLEPRADILHRVVRWQRAKAQAGTHSTLTRAEVSYST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH SK    FR GG   GP P    H LPKK R+L LRHALS K  + 
Sbjct: 61  KKIYKQKGTGGARHGSKKAPIFRHGGVVKGPTPRSHAHDLPKKFRALGLRHALSAKAQAG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           +++++D     + K+  L    + L     LIIDG ++D NF LAARNI  I++LP  G 
Sbjct: 121 ELIILDVATMADAKSSILAKAAKELGWKRVLIIDGAEVDANFALAARNIEGIDVLPSMGA 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDIL+  +LV++K+ +EALE R K
Sbjct: 181 NVYDILKRDQLVITKAGVEALEARLK 206


>gi|126732273|ref|ZP_01748073.1| 50S ribosomal protein L4 [Sagittula stellata E-37]
 gi|126707142|gb|EBA06208.1| 50S ribosomal protein L4 [Sagittula stellata E-37]
          Length = 205

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 130/206 (63%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L V NLDG   G + + E +F L+P+  IL RV+RWQ  + + G  K K RSEV+Y+ 
Sbjct: 1   MKLDVINLDGGSAGEVELDEALFGLEPRADILHRVVRWQRNKAQAGTHKVKTRSEVSYST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH S+    FR GG   GP P    H LPKKVR+L L+ ALSDK  + 
Sbjct: 61  KKIYRQKGTGGARHGSRKAPIFRKGGIYKGPTPRSHAHELPKKVRALGLKMALSDKARNG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++VID+ +    KTK L  +   L    ALIIDG +++ NF  AARNI  +++LP  G 
Sbjct: 121 ALIVIDS-IDGASKTKALAAQVSKLGWKRALIIDGAEVNENFAKAARNIEGLDVLPTIGA 179

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDIL+   LV++K+ +EALE R K
Sbjct: 180 NVYDILKRDTLVITKAGVEALEARLK 205


>gi|254449666|ref|ZP_05063103.1| ribosomal protein L4/L1 family [Octadecabacter antarcticus 238]
 gi|198264072|gb|EDY88342.1| ribosomal protein L4/L1 family [Octadecabacter antarcticus 238]
          Length = 205

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 97/199 (48%), Positives = 124/199 (62%), Gaps = 1/199 (0%)

Query: 9   LDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQK 68
           LDG+  G + + E IF L+P+  IL RV+RWQ    + G  K K RSEV Y+  K+Y QK
Sbjct: 8   LDGKAAGSVELDEAIFGLEPRIDILHRVVRWQRNNAQAGTHKVKTRSEVKYSTKKIYRQK 67

Query: 69  GTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDN 128
           GTG ARH ++S   FRGGG   GP P    H L KK R L LRHALS K  + +++++D+
Sbjct: 68  GTGGARHGARSAPIFRGGGIYKGPTPRSHGHELTKKFRKLGLRHALSAKVAAGELVIVDS 127

Query: 129 LVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILR 188
           +  K+ KT  L  +  AL     LIID   ++ NF +AARNI  IN LPV G NVYDILR
Sbjct: 128 IDMKDAKTSALAKQVGALGWKRCLIID-ATVNENFAVAARNITTINALPVMGANVYDILR 186

Query: 189 CSKLVLSKSAIEALEDRFK 207
              LVL+K+ +EALE R K
Sbjct: 187 SDTLVLTKAGVEALEARLK 205


>gi|254438218|ref|ZP_05051712.1| ribosomal protein L4/L1 family [Octadecabacter antarcticus 307]
 gi|198253664|gb|EDY77978.1| ribosomal protein L4/L1 family [Octadecabacter antarcticus 307]
          Length = 205

 Score =  182 bits (462), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 97/199 (48%), Positives = 124/199 (62%), Gaps = 1/199 (0%)

Query: 9   LDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQK 68
           LDG+  G + + E IF L+P+  IL RV+RWQ    + G  K K RSEV Y+  K+Y QK
Sbjct: 8   LDGKAAGSVELDEAIFGLEPRIDILHRVVRWQRNNAQAGTHKVKTRSEVKYSTKKIYRQK 67

Query: 69  GTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDN 128
           GTG ARH ++S   FRGGG   GP P    H L KK R L LRHALS K  + +++++DN
Sbjct: 68  GTGGARHGARSAPIFRGGGIYKGPTPRSHGHELTKKFRKLGLRHALSAKVAAGELVIVDN 127

Query: 129 LVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILR 188
           +  K+ KT  L     AL     LIID   ++ +F +AARNI +IN LPV G NVYDILR
Sbjct: 128 IDIKDAKTSALAKTVGALGWKRCLIID-ATVNEDFAVAARNITSINALPVMGANVYDILR 186

Query: 189 CSKLVLSKSAIEALEDRFK 207
              LVL+K+ +EALE R K
Sbjct: 187 SDTLVLTKAGVEALEARLK 205


>gi|114799746|ref|YP_761528.1| 50S ribosomal protein L4 [Hyphomonas neptunium ATCC 15444]
 gi|123128466|sp|Q0BYB5|RL4_HYPNA RecName: Full=50S ribosomal protein L4
 gi|114739920|gb|ABI78045.1| ribosomal protein L4 [Hyphomonas neptunium ATCC 15444]
          Length = 214

 Score =  182 bits (461), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 130/206 (63%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQG-ILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           +EL+V+ L G+  G I + + IF +   +G IL R +RWQ  R++ G  K+K RSEV  T
Sbjct: 1   MELAVKTLAGDAAGNIDLDDAIFGIDEIRGDILQRTVRWQLARRQAGTHKAKSRSEVNRT 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
             K   QKG+G ARH S++   F GGG A GP      H LPKK+R +AL HALS K   
Sbjct: 61  TKKSIKQKGSGGARHGSRNAPIFVGGGIAHGPRVRSHAHDLPKKIRKMALAHALSSKAKD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           + IMVID       KTK L+  F+ L + NALII G +++ NF  AARNIPNI++LPV G
Sbjct: 121 SSIMVIDTCELDSPKTKGLIQAFKDLGIENALIISGTEVNENFARAARNIPNIDVLPVAG 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVYDILR   LV++K A E ++ RF
Sbjct: 181 LNVYDILRRRTLVITKEAAEGIKARF 206


>gi|17987041|ref|NP_539675.1| 50S ribosomal protein L4 [Brucella melitensis bv. 1 str. 16M]
 gi|17982697|gb|AAL51939.1| lsu ribosomal protein l1e (= l4p) [Brucella melitensis bv. 1 str.
           16M]
          Length = 201

 Score =  182 bits (461), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 121/171 (70%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L++  L+G+D G + ++E+IF L P+  IL RV+RWQ  R++ G  K++GR +V+ TG
Sbjct: 1   MDLTITTLEGKDAGKVKLNEEIFGLDPRDDILQRVVRWQLARRQQGSHKAQGRGDVSRTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           SKMY QKGTGRARH S    QFRGGG+A GPV     H LPKKVR+L LRHALS K  ++
Sbjct: 61  SKMYKQKGTGRARHHSARAPQFRGGGQAHGPVVRNHDHDLPKKVRALGLRHALSAKAKAS 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPN 172
           D+++ID+L S + KTK LV++F  L L NAL+I G ++D NFQ AA   P 
Sbjct: 121 DLIIIDDLASADAKTKQLVSQFAKLGLENALLIGGAEIDANFQRAAFEYPE 171


>gi|89053075|ref|YP_508526.1| 50S ribosomal protein L4 [Jannaschia sp. CCS1]
 gi|109893599|sp|Q28UW1|RL4_JANSC RecName: Full=50S ribosomal protein L4
 gi|88862624|gb|ABD53501.1| LSU ribosomal protein L4P [Jannaschia sp. CCS1]
          Length = 206

 Score =  182 bits (461), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 126/206 (61%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +++ V  LDG+  G + + E +F L+P+  IL RV+RWQ    + G  K K R EV+Y+ 
Sbjct: 1   MKVDVIKLDGKKAGSVDLDEALFGLEPRADILHRVVRWQRNNAQAGTHKVKTRREVSYST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH ++S   FRGGG   GP P    H L KK R L LRHALS K    
Sbjct: 61  KKIYRQKGTGGARHGARSAPIFRGGGVYKGPTPRSHGHELTKKFRKLGLRHALSAKAAEG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++VI+++   E KT  L  + + +    ALIIDG  +D NF  AARNI  +++LP  G 
Sbjct: 121 RLVVIESIAMDEAKTSALAKQVKEMGWKRALIIDGSDVDANFAQAARNIEGLDVLPTMGA 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDIL+   LV++K+ +EALE R K
Sbjct: 181 NVYDILKRDTLVITKAGVEALEARLK 206


>gi|83594019|ref|YP_427771.1| 50S ribosomal protein L4 [Rhodospirillum rubrum ATCC 11170]
 gi|109893631|sp|Q2RQW1|RL4_RHORT RecName: Full=50S ribosomal protein L4
 gi|83576933|gb|ABC23484.1| LSU ribosomal protein L4P [Rhodospirillum rubrum ATCC 11170]
          Length = 206

 Score =  180 bits (457), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 130/202 (64%)

Query: 6   VRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMY 65
           V+ LDG+D G I +S+ +F L  +  +L R++RWQ  R++ G  K+KG SE++ T +K +
Sbjct: 5   VKTLDGKDAGSIELSDSVFGLPVRTDLLHRMVRWQLARRQAGTHKTKGISEISGTTAKPF 64

Query: 66  VQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMV 125
            QKGTG AR  SK   QFRGG   FGPV     H L KKVR L L+ ALS K  +  ++V
Sbjct: 65  KQKGTGHARQGSKRSPQFRGGATIFGPVVRSHAHDLNKKVRKLGLKTALSAKAQAGQLIV 124

Query: 126 IDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYD 185
           +D  +S+  KTK L+ + + L L   L IDG +++  F LAARNI  +++LP QG NVYD
Sbjct: 125 LDQAISESGKTKDLLAQLKVLGLEKVLFIDGPEVNEKFALAARNIIGLDVLPQQGANVYD 184

Query: 186 ILRCSKLVLSKSAIEALEDRFK 207
           ILR   LVL+K A++ LE+R +
Sbjct: 185 ILRRDTLVLTKEAVKHLEERLQ 206


>gi|85703988|ref|ZP_01035091.1| 50S ribosomal protein L4 [Roseovarius sp. 217]
 gi|85671308|gb|EAQ26166.1| 50S ribosomal protein L4 [Roseovarius sp. 217]
          Length = 205

 Score =  180 bits (457), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 128/206 (62%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L V  LDG   G + + EDIF L+P+  IL RV+RWQ  + + G  K K RSE +Y+ 
Sbjct: 1   MKLDVIKLDGGTAGSVDLGEDIFGLEPRADILHRVVRWQRNKAQAGTHKVKTRSETSYST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH  K+   FR GG   GP P    H LPKKVR+L L+HALS K  + 
Sbjct: 61  KKIYRQKGTGGARHGDKNAPIFRHGGIYKGPTPRSHAHDLPKKVRALGLKHALSAKAKAG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           ++++ID + S   KT  L  + + L    AL+IDG Q++  F  AA NI  +++LP  G 
Sbjct: 121 ELVIID-VASSNGKTGELAKQVKNLGWKRALVIDGAQVNAEFARAAANIEGLDVLPSMGA 179

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDIL+   LVL+K+ +EALE R K
Sbjct: 180 NVYDILKRDTLVLTKAGVEALEARLK 205


>gi|255262953|ref|ZP_05342295.1| ribosomal protein, L4/L1 family [Thalassiobium sp. R2A62]
 gi|255105288|gb|EET47962.1| ribosomal protein, L4/L1 family [Thalassiobium sp. R2A62]
          Length = 206

 Score =  179 bits (453), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 93/199 (46%), Positives = 123/199 (61%)

Query: 9   LDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQK 68
           +DG   G + + E IF L+P+  IL RV+RWQ    + G  K K RSEV Y+  K+Y QK
Sbjct: 8   MDGGKAGSVDLDEAIFGLEPRIDILHRVVRWQRNNAQAGTHKVKTRSEVKYSTKKIYRQK 67

Query: 69  GTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDN 128
           GTG ARH ++S   FRGGG   GP      H L KK R L LRHALS K  + ++++ID 
Sbjct: 68  GTGGARHGARSAPIFRGGGVYKGPTVRSHGHELTKKFRKLGLRHALSAKATAGELVIIDV 127

Query: 129 LVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILR 188
              K+ KT  L  + + L    ALIIDG +++ NF +AARNI  +++LP  G NVYDIL+
Sbjct: 128 ADLKDAKTSALAKQVKDLGWKRALIIDGAEVNENFAVAARNIDTVDILPSMGANVYDILK 187

Query: 189 CSKLVLSKSAIEALEDRFK 207
              LVL+K+ +EALE R K
Sbjct: 188 SDTLVLTKAGVEALEARLK 206


>gi|23014087|ref|ZP_00053924.1| COG0088: Ribosomal protein L4 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 206

 Score =  178 bits (451), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 96/206 (46%), Positives = 128/206 (62%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++ +V +LD +  G I ++++IF L  +  IL R + WQ  +++ G  K+K  SE++ T 
Sbjct: 1   MKTNVISLDNQTVGEIELADEIFGLPVRGDILFRAVNWQLAKRQSGNHKTKTISEISGTT 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K + QKG GRAR  S   +QFRGG   FGPV     H LPKKVR LAL+ ALS K    
Sbjct: 61  KKPFAQKGGGRARQGSLRSAQFRGGSTIFGPVVRSHAHDLPKKVRKLALKTALSAKVADG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++V+DN  +   KTK L  R   L LS+ L IDG  +D NF LA+RNIP +++LP QG 
Sbjct: 121 KLIVVDNATAGSPKTKDLAARLGKLGLSSVLFIDGAAVDGNFALASRNIPYVDVLPQQGA 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR   LVL+K A+ ALE R K
Sbjct: 181 NVYDILRRETLVLTKDAVAALEARLK 206


>gi|114570344|ref|YP_757024.1| 50S ribosomal protein L4 [Maricaulis maris MCS10]
 gi|122315785|sp|Q0ANQ1|RL4_MARMM RecName: Full=50S ribosomal protein L4
 gi|114340806|gb|ABI66086.1| LSU ribosomal protein L4P [Maricaulis maris MCS10]
          Length = 211

 Score =  177 bits (450), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 131/206 (63%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKP-QQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           +++ V+ L  +D G I + + +F ++  +  +L RV++WQ   ++ G  K+ GRSE+  T
Sbjct: 1   MKIEVKTLAAKDAGAIDLDDAVFGIEEVRSDLLQRVVKWQLAARQQGTHKTLGRSEINRT 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
             +   QKG G ARH ++S  QF GGGKA GP      H LPKKVR+L LRHALS K  +
Sbjct: 61  KKRFGRQKGGGTARHGARSAPQFVGGGKAHGPRVRSHAHELPKKVRALGLRHALSAKLGA 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             +++ID+      +TK L T F  L +SNAL+I G +++ NF  AARN+P I++LP QG
Sbjct: 121 KSLVIIDDAALDAPQTKALRTSFEGLGISNALVISGAEVNENFAKAARNLPCIDVLPAQG 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVYD+LR   LVL+K+A+E +  R 
Sbjct: 181 LNVYDVLRRDTLVLTKAAVEQIHARL 206


>gi|260425505|ref|ZP_05779485.1| ribosomal protein, L4/L1 family [Citreicella sp. SE45]
 gi|260423445|gb|EEX16695.1| ribosomal protein, L4/L1 family [Citreicella sp. SE45]
          Length = 205

 Score =  177 bits (449), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 129/206 (62%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L V  LDG   G + ++++IF L+P+  IL RV+RWQ  + + G  K K RSEV+Y+ 
Sbjct: 1   MKLDVIKLDGTAAGEVELTDEIFDLEPRADILHRVVRWQRNKAQAGTHKVKTRSEVSYST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH S+    FR GG   GP P    H LPKKVR+L L+ ALS K  S 
Sbjct: 61  KKIYRQKGTGGARHGSRKAPIFRKGGIYKGPTPRSHAHDLPKKVRALGLKMALSAKAKSG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++VID   S E KTK L  + ++L    ALIIDG  ++  F  AA NI  +++LP  G 
Sbjct: 121 ALVVIDTADS-EGKTKALAAQVKSLGWKRALIIDGAAVNEAFAKAAANIDGLDVLPSMGA 179

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDIL+   LVL+K+ +EALE R K
Sbjct: 180 NVYDILKRDTLVLTKAGVEALEARLK 205


>gi|294085959|ref|YP_003552719.1| 50S ribosomal protein L4 [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292665534|gb|ADE40635.1| 50S ribosomal protein L4 [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 258

 Score =  177 bits (449), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 107/206 (51%), Positives = 135/206 (65%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L+V+ LD +  G I+V + +FA+ P+  +LARV++WQ  ++R G  K K RSEVA T 
Sbjct: 54  MKLNVKTLDNKAAGDITVDDTVFAVAPRADLLARVVKWQLAKRRAGSHKVKSRSEVARTT 113

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +KM+ QKGTGRARH + SV QFRGGG   GPV     HALPKKVR   LR ALS K    
Sbjct: 114 AKMFRQKGTGRARHGAASVVQFRGGGVVHGPVVRDHGHALPKKVRRAGLRSALSSKASEG 173

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++V+D LVSK  KT  L  +   L   NALII G +LD  F  AA NIP +++LP QGI
Sbjct: 174 KLIVLDKLVSK-GKTAALRAQLSKLGAENALIIGGEELDAGFVNAASNIPLVDVLPQQGI 232

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR   L+LSK A   LE+R K
Sbjct: 233 NVYDILRRDVLILSKDAAAHLEERLK 258


>gi|83941499|ref|ZP_00953961.1| 50S ribosomal protein L4 [Sulfitobacter sp. EE-36]
 gi|83847319|gb|EAP85194.1| 50S ribosomal protein L4 [Sulfitobacter sp. EE-36]
          Length = 205

 Score =  177 bits (448), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 128/206 (62%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L V  LDG   G + + E +F L+P+  IL RV+RWQ    + G  K K RSEV+Y+ 
Sbjct: 1   MKLDVIKLDGGAAGSVDLDEALFGLEPRADILHRVVRWQRNNAQQGTHKVKTRSEVSYST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH ++S   FR GG   GP P    H L KK R L LRHALS K  + 
Sbjct: 61  KKIYRQKGTGGARHGARSAPIFRSGGIYKGPTPRSHGHDLTKKFRKLGLRHALSSKAKTG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           ++++ID++ S + KT  L  + + L    ALIIDG  ++ NF  AARNI  +++LP  G 
Sbjct: 121 NLVIIDDVTS-DGKTAALAKQVKNLGWKRALIIDGASVNENFLQAARNIEGLDILPTMGA 179

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDIL+   LV++K+ IEALE R K
Sbjct: 180 NVYDILKRDTLVITKAGIEALEARLK 205


>gi|83854977|ref|ZP_00948507.1| 50S ribosomal protein L4 [Sulfitobacter sp. NAS-14.1]
 gi|83842820|gb|EAP81987.1| 50S ribosomal protein L4 [Sulfitobacter sp. NAS-14.1]
          Length = 205

 Score =  176 bits (447), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 127/206 (61%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L V  LDG   G + + E +F L+P+  IL RV+RWQ    + G  K K RSEV+Y+ 
Sbjct: 1   MKLDVIKLDGGAAGSVDLDEALFGLEPRADILHRVVRWQRNNAQQGTHKVKTRSEVSYST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH ++S   FR GG   GP P    H L KK R L LRHALS K  + 
Sbjct: 61  KKIYRQKGTGGARHGARSAPIFRSGGIYKGPTPRSHGHDLTKKFRKLGLRHALSSKAKTG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           ++++ID+  S + KT  L  + + L    ALIIDG  ++ NF  AARNI  +++LP  G 
Sbjct: 121 NLVIIDDATS-DGKTAALAKQVKNLGWKRALIIDGASVNENFLQAARNIEGLDILPTMGA 179

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDIL+   LV++K+ IEALE R K
Sbjct: 180 NVYDILKRDTLVITKAGIEALEARLK 205


>gi|83949794|ref|ZP_00958527.1| 50S ribosomal protein L4 [Roseovarius nubinhibens ISM]
 gi|83837693|gb|EAP76989.1| 50S ribosomal protein L4 [Roseovarius nubinhibens ISM]
          Length = 205

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 94/206 (45%), Positives = 127/206 (61%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L V  LDG   G + + EDIF L+P+  IL RV+RWQ  + + G  K K RSE +Y+ 
Sbjct: 1   MKLDVIKLDGGKAGSVDLGEDIFGLEPRADILHRVVRWQRNKAQQGTHKVKTRSETSYST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH  ++   FR GG   GP P    H LPKKVR L L+HALS K  + 
Sbjct: 61  KKIYRQKGTGGARHGDRNAPIFRKGGIYKGPTPRSHAHDLPKKVRMLGLKHALSAKVKAG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           ++++I+   S   KT  L  + + L    ALIIDG +++  F  AARNI  +++LP  G 
Sbjct: 121 ELVIIEAADS-AGKTSALAKQVKDLGWKRALIIDGAEVNAEFAKAARNIEGLDVLPSMGA 179

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDIL+   LVL+K+ +EALE R K
Sbjct: 180 NVYDILKRDTLVLTKAGVEALEARLK 205


>gi|99080088|ref|YP_612242.1| 50S ribosomal protein L4 [Ruegeria sp. TM1040]
 gi|122398432|sp|Q1GK36|RL4_SILST RecName: Full=50S ribosomal protein L4
 gi|99036368|gb|ABF62980.1| LSU ribosomal protein L4P [Ruegeria sp. TM1040]
          Length = 205

 Score =  176 bits (445), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 96/206 (46%), Positives = 125/206 (60%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L V  LDG   G I +SED+F L+P+  IL RV+RWQ    + G  K K RSE +Y+ 
Sbjct: 1   MKLDVIKLDGGKAGDIELSEDLFGLEPRADILHRVVRWQRNNAQAGTHKVKTRSETSYST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH  ++   FR GG   GP P    H L KK R L LRHALS K  + 
Sbjct: 61  KKIYRQKGTGGARHGDRNAPIFRKGGIYKGPTPRSHGHDLTKKFRKLGLRHALSAKAKAG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           +++VI+N    E KT  L  +   L    AL+IDG  ++  F  AA+NI  +++LP  G 
Sbjct: 121 ELVVIEN-AEAEGKTAALAKQVANLGWKRALVIDGAAVNEGFARAAKNIEGLDILPSMGA 179

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDIL+   LVL+KSA+EALE R K
Sbjct: 180 NVYDILKRDTLVLTKSAVEALEARLK 205


>gi|89070556|ref|ZP_01157845.1| 50S ribosomal protein L4 [Oceanicola granulosus HTCC2516]
 gi|89043863|gb|EAR50061.1| 50S ribosomal protein L4 [Oceanicola granulosus HTCC2516]
          Length = 206

 Score =  174 bits (442), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 90/206 (43%), Positives = 124/206 (60%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++  V  LDG   G + + E++F L+P+  IL RV+RWQ    + G  K K R E +Y+ 
Sbjct: 1   MKADVIKLDGGKAGSVELDEELFGLEPRTDILHRVVRWQRNNAQQGTHKVKTRRETSYST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH  ++   FR GG   GP P    H L KK R L LRHALS K  + 
Sbjct: 61  KKIYRQKGTGGARHGDRNAPIFRKGGVYKGPTPRSHGHELTKKFRKLGLRHALSAKQKAG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           +++VID +   E KT  L  + + L    AL+IDG  ++ +F  AARN+ N+++LP  G 
Sbjct: 121 ELVVIDTIEIAEAKTSQLAKQVKNLGWKRALVIDGAAVNEDFAKAARNLANLDVLPSMGA 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDIL+   LVL+K+ +EALE R K
Sbjct: 181 NVYDILKSDTLVLTKAGVEALEARLK 206


>gi|83858565|ref|ZP_00952087.1| 50S ribosomal protein L4 [Oceanicaulis alexandrii HTCC2633]
 gi|83853388|gb|EAP91240.1| 50S ribosomal protein L4 [Oceanicaulis alexandrii HTCC2633]
          Length = 212

 Score =  174 bits (442), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 128/206 (62%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKP-QQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           ++L V  LD    G I +S+ +F ++  +  IL R ++WQ  R++ G  K+K R E+A T
Sbjct: 1   MKLDVVTLDAGKAGSIDLSDAVFGIEEVRADILQRAVKWQLSRRQAGTHKTKERGEIART 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
             K   QKG G ARH S++   F GGG A GP        LPKKVR+LAL+HALS K  +
Sbjct: 61  KKKFGRQKGGGGARHGSRNAPIFVGGGVAHGPRVRSHATELPKKVRALALKHALSTKAGA 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             ++++D     E KTK L  +F  L  SNALIIDG  LD NF  AARNIP I++LP QG
Sbjct: 121 KQLVILDEARLDEAKTKALTEKFSKLGWSNALIIDGETLDENFARAARNIPLIDVLPAQG 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVYD+LR   LVL+K+A+E + +R 
Sbjct: 181 LNVYDVLRRDVLVLTKAAVEKINERL 206


>gi|259416401|ref|ZP_05740321.1| ribosomal protein, L4/L1 family [Silicibacter sp. TrichCH4B]
 gi|259347840|gb|EEW59617.1| ribosomal protein, L4/L1 family [Silicibacter sp. TrichCH4B]
          Length = 205

 Score =  174 bits (442), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 125/206 (60%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L V  LDG   G I +SED+F L+P+  IL R++RWQ    + G  K K RSE +Y+ 
Sbjct: 1   MKLDVIKLDGGKAGDIELSEDLFGLEPRADILHRMVRWQRNNAQAGTHKVKTRSETSYST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH  ++   FR GG   GP P    H L KK R L LRHALS K  + 
Sbjct: 61  KKIYRQKGTGGARHGDRNAPIFRKGGIYKGPTPRSHGHDLTKKFRKLGLRHALSAKAKAG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           +++VI+N    E KT  L  +   L    AL+IDG  ++  F  AA+NI  +++LP  G 
Sbjct: 121 ELVVIEN-AEAEGKTAALAKQVANLGWKRALVIDGAAVNEGFARAAKNIEGLDILPSMGA 179

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDIL+   LVL+KSA+EALE R K
Sbjct: 180 NVYDILKRDTLVLTKSAVEALEARLK 205


>gi|149203512|ref|ZP_01880482.1| 50S ribosomal protein L4 [Roseovarius sp. TM1035]
 gi|149143345|gb|EDM31384.1| 50S ribosomal protein L4 [Roseovarius sp. TM1035]
          Length = 205

 Score =  174 bits (442), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 92/206 (44%), Positives = 125/206 (60%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L V  LDG   G + + EDIF L+P+  IL RV+RWQ  + + G  K K RSE +Y+ 
Sbjct: 1   MKLDVIKLDGGTAGSVDLGEDIFGLEPRADILHRVVRWQRNKAQAGTHKVKTRSETSYST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH  K+   FR GG   GP P    H LPKKVR+L L+HALS K  + 
Sbjct: 61  KKIYRQKGTGGARHGDKNAPIFRHGGIYKGPTPRSHAHDLPKKVRALGLKHALSAKAKAG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++++D   S   KT  L  + + L     L+IDG Q++  F  AA NI  +++LP  G 
Sbjct: 121 ALVILDE-ASSNGKTGELAKQVKNLGWKRVLVIDGAQVNAEFARAAANIEGLDVLPSMGA 179

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDIL+   LV++K+ +EALE R K
Sbjct: 180 NVYDILKRDTLVITKAGVEALEARLK 205


>gi|254487620|ref|ZP_05100825.1| ribosomal protein, L4/L1 family [Roseobacter sp. GAI101]
 gi|214044489|gb|EEB85127.1| ribosomal protein, L4/L1 family [Roseobacter sp. GAI101]
          Length = 205

 Score =  174 bits (442), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 127/206 (61%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L V  LDG   G I + E +F L+P+  IL RV+RWQ    + G  K K RSEV+Y+ 
Sbjct: 1   MKLDVIKLDGGSAGSIDLDEALFGLEPRADILHRVVRWQRNNAQQGTHKVKTRSEVSYST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH ++S   FR GG   GP P    H L KK R L LRHALS    + 
Sbjct: 61  KKIYRQKGTGGARHGARSAPIFRSGGIYKGPTPRSHGHELTKKFRKLGLRHALSSMAKNG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           ++++ID+  S + KT  L  + ++L    ALIIDG  ++ NF  AARNI  +++LP  G 
Sbjct: 121 NLVIIDDATS-DGKTSALAKQVKSLGWKRALIIDGASVNENFLQAARNIEGLDILPSVGA 179

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDIL+   LV++K+ IEALE R K
Sbjct: 180 NVYDILKRDTLVITKAGIEALEARLK 205


>gi|83312228|ref|YP_422492.1| 50S ribosomal protein L4 [Magnetospirillum magneticum AMB-1]
 gi|109893601|sp|Q2W2J2|RL4_MAGMM RecName: Full=50S ribosomal protein L4
 gi|82947069|dbj|BAE51933.1| Ribosomal protein L4 [Magnetospirillum magneticum AMB-1]
          Length = 206

 Score =  174 bits (441), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 94/206 (45%), Positives = 127/206 (61%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++ +V +LD +  G I ++++IF +  +  IL R + WQ  +++ G  K+K  SE++ T 
Sbjct: 1   MKTNVISLDNQTVGEIELADEIFGVPVRGDILFRAVNWQLAKRQSGNHKTKTISEISGTT 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K + QKG GRAR  S   +QFRGG   FGPV     H LPKKVR LAL+ ALS K    
Sbjct: 61  KKPFAQKGGGRARQGSLRSAQFRGGSTIFGPVVRSHAHDLPKKVRKLALKTALSAKVADG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++V+D   +   KTK L  R   L LS+ L IDG  +D NF LA+RNIP +++LP QG 
Sbjct: 121 KLIVVDAASAGSPKTKDLAARLGKLGLSSVLFIDGAAVDGNFALASRNIPYVDVLPTQGA 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR   LVL+K A+ ALE R K
Sbjct: 181 NVYDILRRDTLVLTKDAVAALEARLK 206


>gi|86135763|ref|ZP_01054342.1| 50S ribosomal protein L4 [Roseobacter sp. MED193]
 gi|85826637|gb|EAQ46833.1| 50S ribosomal protein L4 [Roseobacter sp. MED193]
          Length = 205

 Score =  174 bits (441), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 94/206 (45%), Positives = 127/206 (61%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L V NLDG   G I ++ D+F L+P+  IL RV+RWQ    + G  K K RSEV Y+ 
Sbjct: 1   MKLDVMNLDGSKAGDIELNADLFGLEPRADILHRVVRWQRNNAQAGTHKVKTRSEVKYST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH ++S   FRGGG   GPV     H L KK R L LRHALS K  + 
Sbjct: 61  KKIYRQKGTGGARHGARSAPIFRGGGIYKGPVVRSHGHELTKKFRKLGLRHALSAKAKAG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           +++VI +  + E KT  L  +   L    AL+IDG +++  F  A+RNI  +++LP  G 
Sbjct: 121 ELVVISD-AAAEGKTGALAKQVANLGWKRALVIDGAEVNEGFLKASRNIEGLDILPTMGA 179

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDIL+   LV++K+ +EALE R K
Sbjct: 180 NVYDILKRDTLVITKAGLEALEARLK 205


>gi|126724862|ref|ZP_01740705.1| 50S ribosomal protein L4 [Rhodobacterales bacterium HTCC2150]
 gi|126706026|gb|EBA05116.1| 50S ribosomal protein L4 [Rhodobacterales bacterium HTCC2150]
          Length = 206

 Score =  174 bits (441), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 90/205 (43%), Positives = 128/205 (62%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L V  LDG+  G + ++ED+F L+ +  IL RV+R+Q  +++ G  K K RSEV Y+ 
Sbjct: 1   MKLDVIKLDGKKAGSVDLAEDLFGLEARADILHRVVRYQLAKRQAGTHKVKTRSEVKYST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH ++S   FRGGG   GP P    H L KK R+L LRHALS K  + 
Sbjct: 61  KKIYRQKGTGGARHGARSAPIFRGGGVYKGPTPRSHAHDLNKKFRALGLRHALSAKAGAG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++V+D  V  + KT  L    + L    AL+IDG +++ NF  A+ NI  +++LP  G 
Sbjct: 121 QLVVLDEAVVADGKTGVLAKMVKELGWKRALVIDGAEVNANFAQASANIDGLDVLPSMGA 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRF 206
           NVYDIL+   LV++K+ +EALE R 
Sbjct: 181 NVYDILKRDTLVVTKAGLEALEARL 205


>gi|149915845|ref|ZP_01904369.1| 50S ribosomal protein L4 [Roseobacter sp. AzwK-3b]
 gi|149810168|gb|EDM70014.1| 50S ribosomal protein L4 [Roseobacter sp. AzwK-3b]
          Length = 205

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 92/206 (44%), Positives = 126/206 (61%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L V  LDG   G + + EDIF L P+  IL RV+RWQ  + + G  K K RSE +Y+ 
Sbjct: 1   MKLDVIKLDGGKAGSVDLGEDIFGLDPRADILHRVVRWQRNKAQQGTHKVKTRSETSYST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH  ++   FR GG   GP P    H LPKKVR L L+HALS K  + 
Sbjct: 61  KKIYRQKGTGGARHGDRNAPIFRKGGIYKGPTPRSHAHDLPKKVRMLGLKHALSAKAKAG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           +++V+D   S + KT  L  + + L     LIIDG +++ +F  AA NI  +++LP  G 
Sbjct: 121 ELVVLDAATS-DGKTGALAKQIKDLGWKRVLIIDGAEVNADFARAAANIEGVDVLPSMGA 179

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDIL+   LV++K+ +EALE R K
Sbjct: 180 NVYDILKRDTLVITKAGVEALEARLK 205


>gi|260432430|ref|ZP_05786401.1| ribosomal protein, L4/L1 family [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416258|gb|EEX09517.1| ribosomal protein, L4/L1 family [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 205

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 94/206 (45%), Positives = 123/206 (59%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L V  LDG+  G I + E +F L+P+  IL RV+RWQ    + G  K K RSE +Y+ 
Sbjct: 1   MKLDVIKLDGKKAGDIELDEALFGLEPRADILHRVVRWQRNNAQAGTHKVKTRSETSYST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH  ++   FR GG   GP P    H LPKK R L LRHALS K  + 
Sbjct: 61  KKIYRQKGTGGARHGDRNAPIFRKGGVYKGPTPRSHGHDLPKKFRKLGLRHALSAKAKAG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           +++VID     E KT  L  +   L    AL+IDG  ++  F  AARNI  +++LP  G 
Sbjct: 121 ELVVID-AAEAEGKTAALAKQVANLGWKRALVIDGATVNEGFARAARNIEGLDILPSMGA 179

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDIL+   LVL+K+ +EALE R K
Sbjct: 180 NVYDILKRDTLVLTKAGVEALEARLK 205


>gi|254460398|ref|ZP_05073814.1| ribosomal protein L4/L1 family [Rhodobacterales bacterium HTCC2083]
 gi|206676987|gb|EDZ41474.1| ribosomal protein L4/L1 family [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 205

 Score =  173 bits (438), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 127/206 (61%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L V  LDG   G + + E +F L+P+  IL RV+RWQ    + G  K K RSEV Y+ 
Sbjct: 1   MKLDVIKLDGGKAGSVDLDEALFGLEPRADILHRVVRWQRNNAQAGTHKVKTRSEVKYST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH ++S   FRGGG   GPV     H LPKKVR+L L+ ALS K  + 
Sbjct: 61  KKIYRQKGTGGARHGARSAPIFRGGGIYKGPVVRSHGHDLPKKVRALGLKLALSAKAKAG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           +++VID   +   KT  L  +  A+    ALIIDG  ++ +F  AARNI  +++LP  G 
Sbjct: 121 ELVVIDE-AAGAMKTSALAKQVSAMGWKRALIIDGASVNEDFMQAARNIEGLDILPSMGA 179

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDIL+   LV++K+ IEALE R K
Sbjct: 180 NVYDILKRDTLVITKAGIEALEARLK 205


>gi|126739690|ref|ZP_01755382.1| 50S ribosomal protein L4 [Roseobacter sp. SK209-2-6]
 gi|126719336|gb|EBA16046.1| 50S ribosomal protein L4 [Roseobacter sp. SK209-2-6]
          Length = 205

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 92/206 (44%), Positives = 127/206 (61%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L V  LDG   G I +SED+F L+P+  IL R++RWQ    + G  K K RSE +Y+ 
Sbjct: 1   MKLDVIKLDGGKAGDIELSEDLFGLEPRADILHRLVRWQRNNAQAGTHKVKTRSETSYST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH  ++   FR GG   GP P    H L KK R L LRHALS K  + 
Sbjct: 61  KKIYRQKGTGGARHGDRNAPIFRKGGIYKGPTPRSHGHDLTKKFRKLGLRHALSAKAKAG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           +++VI++  S E KT  L  + + L    AL+IDG  ++ +F  A+RNI  +++LP  G 
Sbjct: 121 ELVVIEDAAS-EGKTAALAKQVKDLGWKRALVIDGASVNEDFLKASRNIEGLDILPTMGA 179

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDIL+   LV++K+ +EALE R K
Sbjct: 180 NVYDILKRDTLVITKAGVEALEARLK 205


>gi|254510767|ref|ZP_05122834.1| ribosomal protein, L4/L1 family [Rhodobacteraceae bacterium KLH11]
 gi|221534478|gb|EEE37466.1| ribosomal protein, L4/L1 family [Rhodobacteraceae bacterium KLH11]
          Length = 205

 Score =  172 bits (437), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 94/206 (45%), Positives = 126/206 (61%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L V  LDG   G I ++ D+F L+P+  IL RV+RWQ    + G  K K RSE +Y+ 
Sbjct: 1   MKLDVIKLDGGKAGDIELNADLFGLEPRADILHRVVRWQRNNAQAGTHKVKTRSETSYST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH  ++   FRGGG   GPV     H LPKK R L LRHALS K  + 
Sbjct: 61  KKIYRQKGTGGARHGDRNAPIFRGGGIYKGPVVRSHGHDLPKKFRKLGLRHALSAKAKAG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           +++VI+N    E KT  L  +   L    AL+IDG  ++  F  A++NI  +++LP  G 
Sbjct: 121 ELVVIEN-AEAEGKTAALAKQVANLGWKRALVIDGATVNEGFLKASKNIEGLDILPSMGA 179

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDIL+   LVL+K+A+EALE R K
Sbjct: 180 NVYDILKRDTLVLTKAAVEALEARLK 205


>gi|146278567|ref|YP_001168726.1| 50S ribosomal protein L4 [Rhodobacter sphaeroides ATCC 17025]
 gi|166199854|sp|A4WVK7|RL4_RHOS5 RecName: Full=50S ribosomal protein L4
 gi|145556808|gb|ABP71421.1| LSU ribosomal protein L4P [Rhodobacter sphaeroides ATCC 17025]
          Length = 206

 Score =  172 bits (436), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 88/206 (42%), Positives = 123/206 (59%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++  V  LD    G I + + IF L+P+  IL RV+RWQ  + + G     G+S+V+Y+ 
Sbjct: 1   MKAEVIKLDASSAGSIELDDAIFGLEPRADILHRVVRWQRAKAQAGTHSVLGKSDVSYST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH SK    FR GG   GP P    H L KK R+L L+HALS K  + 
Sbjct: 61  KKIYRQKGTGGARHGSKKAPIFRHGGVYKGPTPRSHAHDLNKKFRALGLKHALSSKATTG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           +++VI+++   E KT  L    + L     L+IDG  ++ NF  AARN+  I++LP  G 
Sbjct: 121 NLIVIEDIAMSEAKTALLAKAVKELGWKRVLVIDGADINENFAKAARNLEGIDVLPSIGA 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDIL+   LV++K+ +EALE R K
Sbjct: 181 NVYDILKRDTLVITKAGVEALEARLK 206


>gi|304321441|ref|YP_003855084.1| 50S ribosomal protein L4 [Parvularcula bermudensis HTCC2503]
 gi|303300343|gb|ADM09942.1| 50S ribosomal protein L4 [Parvularcula bermudensis HTCC2503]
          Length = 220

 Score =  171 bits (433), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 89/205 (43%), Positives = 126/205 (61%), Gaps = 1/205 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +++ V  LD    G + + +DIF L+P+  IL R + WQ  +++ G  K+K R EV  T 
Sbjct: 1   MQIDVLTLDASKAGDLDLRDDIFGLEPRADILHRYVVWQQAKRQQGTHKAKERGEVTGTT 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K   QKG+G ARH ++   QF GGGKA GP      H LPKKVR LALRHALS K  + 
Sbjct: 61  KKFVRQKGSGGARHGNRKAPQFVGGGKAHGPRVRSHAHDLPKKVRRLALRHALSAKQGAA 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           ++++ID     + KTK L  + + L + N+L+ID   +D  F  AARN+  +++LPV G 
Sbjct: 121 ELIIIDEATVADVKTKVLAEKLQKLGVRNSLVIDQS-VDEGFARAARNLDGVDVLPVIGA 179

Query: 182 NVYDILRCSKLVLSKSAIEALEDRF 206
           NVYDILR  KL+L+++A+E L  R 
Sbjct: 180 NVYDILRHDKLILTRAAVEGLYARL 204


>gi|84503641|ref|ZP_01001679.1| 50S ribosomal protein L4 [Oceanicola batsensis HTCC2597]
 gi|84387938|gb|EAQ00990.1| 50S ribosomal protein L4 [Oceanicola batsensis HTCC2597]
          Length = 205

 Score =  171 bits (433), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 124/206 (60%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L V  LDG   G + + ++IF L+P+  IL RV+RWQ    + G  K K RSE +Y+ 
Sbjct: 1   MKLDVIKLDGSSAGSVDLGDEIFGLEPRADILHRVVRWQRNNAQQGTHKVKTRSETSYST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH  ++   FR GG   GPVP    H LPKK R L L+HALS K    
Sbjct: 61  KKIYRQKGTGGARHGDRNAPIFRKGGIYKGPVPRSHGHDLPKKFRKLGLKHALSAKVKEG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            +++ID   S E KT  L  + +AL    ALIIDG  ++  F  AA NI  +++LP  G 
Sbjct: 121 SLVIIDAAES-EGKTNALAKQVKALGWKRALIIDGAAVNEGFAKAAANIDGLDVLPSVGA 179

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDIL+   LV++K+ +EALE R K
Sbjct: 180 NVYDILKRDTLVITKAGVEALEARLK 205


>gi|84685436|ref|ZP_01013334.1| 50S ribosomal protein L4 [Maritimibacter alkaliphilus HTCC2654]
 gi|84666593|gb|EAQ13065.1| 50S ribosomal protein L4 [Rhodobacterales bacterium HTCC2654]
          Length = 205

 Score =  171 bits (433), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 94/206 (45%), Positives = 122/206 (59%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L V  LDG   G + + E +F L+P+  IL RV+RWQ    + G  K K RSE +Y+ 
Sbjct: 1   MKLDVIKLDGGKAGSVELDEALFGLEPRADILHRVVRWQRNNAQQGTHKVKTRSETSYST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH  ++   FR GG   GP P    H L KK R L L+HALS K    
Sbjct: 61  KKIYRQKGTGGARHGDRNAPIFRKGGIYKGPTPRSHGHELTKKFRKLGLKHALSAKAQEG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            I+VID     + KTK L    + L    ALIIDG +++ NF  AARNI  +++LP  G 
Sbjct: 121 AIVVIDT-AEADGKTKVLAKLVKDLGWKRALIIDGAEVNENFAKAARNIEGLDVLPSMGA 179

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDIL+   LVL+K+ +EALE R K
Sbjct: 180 NVYDILKRDTLVLTKAGVEALEARLK 205


>gi|56698635|ref|YP_169012.1| 50S ribosomal protein L4 [Ruegeria pomeroyi DSS-3]
 gi|81558238|sp|Q5LLU7|RL4_SILPO RecName: Full=50S ribosomal protein L4
 gi|56680372|gb|AAV97038.1| ribosomal protein L4 [Ruegeria pomeroyi DSS-3]
          Length = 205

 Score =  171 bits (432), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 94/206 (45%), Positives = 123/206 (59%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L V  LDG   G I + E +F L+P+  IL RV+RWQ    + G  K   +SEV+Y+ 
Sbjct: 1   MKLDVIKLDGTKAGNIDLDEALFGLEPRADILHRVVRWQRNNAQAGTHKVLTKSEVSYST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH S+    FR GG   GP P    H L KK R L LRHALS K  + 
Sbjct: 61  KKIYRQKGTGGARHGSRKSPTFRHGGVYKGPTPRSHGHDLTKKFRKLGLRHALSAKAKAG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           +++VI+N    E KT  L  +   L    AL+IDG  ++  F  AARNI  +++LP  G 
Sbjct: 121 ELVVIEN-AEAEGKTAALAKQVANLGWKRALVIDGAAVNEGFARAARNIEGLDILPSMGA 179

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDIL+   LVL+K+A+EALE R K
Sbjct: 180 NVYDILKRDTLVLTKAAVEALEARLK 205


>gi|163739438|ref|ZP_02146848.1| 50S ribosomal protein L4 [Phaeobacter gallaeciensis BS107]
 gi|161387191|gb|EDQ11550.1| 50S ribosomal protein L4 [Phaeobacter gallaeciensis BS107]
          Length = 205

 Score =  171 bits (432), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 123/206 (59%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L V  LDG   G I +  ++F L+P+  IL RV+RWQ    + G  K K RSE +Y+ 
Sbjct: 1   MKLDVIKLDGGKAGDIELDAELFGLEPRTDILHRVVRWQRNNAQAGTHKVKTRSETSYST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH  ++   FR GG   GP P    H L KK R L LRHALS K  + 
Sbjct: 61  KKIYRQKGTGGARHGDRNAPIFRKGGIYKGPTPRSHGHDLTKKFRKLGLRHALSAKAKAG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           +++VI+N  S   KT  L  + + L    AL+IDG  +D  F  AARNI  +++LP  G 
Sbjct: 121 ELVVIENADS-AGKTAALAKQVKDLGWKRALVIDGASVDEGFARAARNIEGLDILPTMGA 179

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDIL+   LVL+K+ +EALE R K
Sbjct: 180 NVYDILKRDTLVLTKAGVEALEARLK 205


>gi|163745538|ref|ZP_02152898.1| 50S ribosomal protein L4 [Oceanibulbus indolifex HEL-45]
 gi|161382356|gb|EDQ06765.1| 50S ribosomal protein L4 [Oceanibulbus indolifex HEL-45]
          Length = 205

 Score =  170 bits (431), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 92/206 (44%), Positives = 122/206 (59%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L V  LDG + G + + E +F L+P+  IL RV+RWQ    + G  K K RSE +Y+ 
Sbjct: 1   MKLDVIKLDGGNAGSVDLDEALFGLEPRADILHRVVRWQRNNAQQGTHKVKTRSETSYST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH  ++   FR GG   GP P    H L KK R L LRHALS K  + 
Sbjct: 61  KKIYRQKGTGGARHGDRNAPIFRKGGIYKGPTPRSHGHELTKKFRKLGLRHALSAKAKAG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            +++ID   S E KT  L  +   L     L+IDG  ++ NF  AARNI  +++LP  G 
Sbjct: 121 SLVIIDEATS-EGKTAALAKQVSNLGWKRTLVIDGASVNENFAQAARNIEGLDILPSMGA 179

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDIL+   LV++K+ IEALE R K
Sbjct: 180 NVYDILKRDTLVITKAGIEALEARLK 205


>gi|163740232|ref|ZP_02147626.1| 50S ribosomal protein L4 [Phaeobacter gallaeciensis 2.10]
 gi|161386090|gb|EDQ10465.1| 50S ribosomal protein L4 [Phaeobacter gallaeciensis 2.10]
          Length = 205

 Score =  170 bits (430), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 123/206 (59%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L V  LDG   G I +  ++F L+P+  IL RV+RWQ    + G  K K RSE +Y+ 
Sbjct: 1   MKLDVIKLDGGKVGDIELDAELFGLEPRTDILHRVVRWQRNNAQAGTHKVKTRSETSYST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH  ++   FR GG   GP P    H L KK R L LRHALS K  + 
Sbjct: 61  KKIYRQKGTGGARHGDRNAPIFRKGGIYKGPTPRSHGHDLTKKFRKLGLRHALSAKAKAG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           +++VI+N  S   KT  L  + + L    AL+IDG  +D  F  AARNI  +++LP  G 
Sbjct: 121 ELVVIENADS-AGKTAALAKQVKDLGWKRALVIDGASVDEGFARAARNIEGLDILPTMGA 179

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDIL+   LVL+K+ +EALE R K
Sbjct: 180 NVYDILKRDTLVLTKAGVEALEARLK 205


>gi|254294439|ref|YP_003060462.1| ribosomal protein L4/L1e [Hirschia baltica ATCC 49814]
 gi|254042970|gb|ACT59765.1| ribosomal protein L4/L1e [Hirschia baltica ATCC 49814]
          Length = 309

 Score =  169 bits (428), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 90/206 (43%), Positives = 131/206 (63%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKP-QQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           ++L V NLD +  G + +++ +F ++  +  IL R++R+Q  +++ G  K++ RSEV  T
Sbjct: 1   MKLDVINLDAKKAGSVELNDAVFGIEDVRPDILQRMVRYQLAKRQAGTHKTQTRSEVNKT 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
            ++   QKG G ARH S++   F GGG A GP      H L KK R+LAL+HALS K   
Sbjct: 61  KTRFGRQKGGGGARHGSRNAPIFVGGGVAHGPKVRSHAHDLTKKFRALALKHALSAKVKD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           + ++V++     E KTK L  +F AL L NAL+I G  LD NF  AARNIPNI++LP  G
Sbjct: 121 SSLIVLEEAAVSEVKTKALRAQFEALGLKNALVIGGESLDDNFAKAARNIPNIDVLPFAG 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVYD++R   LVL+K A++A+  RF
Sbjct: 181 LNVYDVMRRHTLVLTKEAVDAVHARF 206


>gi|163733827|ref|ZP_02141269.1| 50S ribosomal protein L4 [Roseobacter litoralis Och 149]
 gi|161392938|gb|EDQ17265.1| 50S ribosomal protein L4 [Roseobacter litoralis Och 149]
          Length = 205

 Score =  169 bits (427), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 124/206 (60%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L V  LDG   G + + E +F L+P+  IL RV+RWQ    + G  K K RSEV Y+ 
Sbjct: 1   MKLDVIKLDGAKAGSVDLDEALFGLEPRADILHRVVRWQRNNAQAGTHKVKTRSEVNYST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH ++S   FRGGG   GP      H L KK R L L HALS K  + 
Sbjct: 61  KKIYRQKGTGGARHGARSAPIFRGGGVYKGPKVRSHGHELTKKFRKLGLCHALSAKMKAG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           ++++ID+ VS + KT  L  +   L    ALIIDG  ++  F  AARNI  +++LP  G 
Sbjct: 121 ELVIIDD-VSSDGKTSALAKQVANLGWKRALIIDGATVNETFAQAARNIDGLDILPTMGA 179

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDIL+   LV++K+ +EALE R K
Sbjct: 180 NVYDILKRDTLVITKAGVEALEARLK 205


>gi|114771268|ref|ZP_01448688.1| 50S ribosomal protein L4 [alpha proteobacterium HTCC2255]
 gi|114548193|gb|EAU51080.1| 50S ribosomal protein L4 [alpha proteobacterium HTCC2255]
          Length = 206

 Score =  168 bits (426), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 126/206 (61%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++ +V  LD +  G I + + +F L+P+  IL RV+R+Q  +++ G  K K RSE +Y+ 
Sbjct: 1   MKANVIKLDAKSAGSIDLDDSVFGLEPRADILHRVVRYQLAKRQAGTHKVKTRSETSYST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH  ++   FRGGG   GP      H L KK R L L+HALS K  + 
Sbjct: 61  KKIYNQKGTGGARHGDRNAPIFRGGGVYKGPKVRSHAHDLTKKFRKLGLKHALSAKATAG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           +++VID++ +K  KT  L      L     LIIDG  ++ NF LA+RNI  +++LP  G 
Sbjct: 121 ELIVIDSVEAKTSKTADLAKVVTNLGWKKVLIIDGTDVNENFLLASRNIDGLDILPSAGA 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDIL+ + LVL+K+  EALE R K
Sbjct: 181 NVYDILKSNTLVLTKAGAEALEARLK 206


>gi|77462260|ref|YP_351764.1| 50S ribosomal protein L4 [Rhodobacter sphaeroides 2.4.1]
 gi|126461136|ref|YP_001042250.1| 50S ribosomal protein L4 [Rhodobacter sphaeroides ATCC 17029]
 gi|221638114|ref|YP_002524376.1| 50S ribosomal protein L4 [Rhodobacter sphaeroides KD131]
 gi|109893632|sp|Q3J5S1|RL4_RHOS4 RecName: Full=50S ribosomal protein L4
 gi|166199853|sp|A3PGL2|RL4_RHOS1 RecName: Full=50S ribosomal protein L4
 gi|254803750|sp|B9KL92|RL4_RHOSK RecName: Full=50S ribosomal protein L4
 gi|77386678|gb|ABA77863.1| LSU ribosomal protein L4P [Rhodobacter sphaeroides 2.4.1]
 gi|126102800|gb|ABN75478.1| LSU ribosomal protein L4P [Rhodobacter sphaeroides ATCC 17029]
 gi|221158895|gb|ACL99874.1| 50S ribosomal protein L4 [Rhodobacter sphaeroides KD131]
          Length = 206

 Score =  168 bits (426), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 86/206 (41%), Positives = 123/206 (59%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++  V  LD    G I + + IF L+P+  IL RV+RWQ  + + G     G+S+V+Y+ 
Sbjct: 1   MKAEVIKLDASPAGSIELDDAIFGLEPRADILHRVVRWQRAKAQAGTHSVLGKSDVSYST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH SK    FR GG   GP P    H L KK R+L L+HALS K  + 
Sbjct: 61  KKIYRQKGTGGARHGSKKAPIFRHGGVYKGPTPRSHAHDLNKKFRALGLKHALSSKATTG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           +++V++++   E KT  L    + L     L+IDG  ++ NF  AARN+  +++LP  G 
Sbjct: 121 NLIVLEDIALAEGKTAMLAKAVKELGWKRVLVIDGADINENFAKAARNLEGVDVLPSIGA 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDIL+   LV++K+ +EALE R K
Sbjct: 181 NVYDILKRDTLVITKAGVEALEARLK 206


>gi|254463733|ref|ZP_05077144.1| ribosomal protein L4/L1 family [Rhodobacterales bacterium Y4I]
 gi|206684641|gb|EDZ45123.1| ribosomal protein L4/L1 family [Rhodobacterales bacterium Y4I]
          Length = 205

 Score =  168 bits (426), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 92/206 (44%), Positives = 126/206 (61%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L V  LDG   G I +SED+F L+P+  IL RV+RWQ    + G  K K RSE +Y+ 
Sbjct: 1   MKLDVIKLDGGKAGDIELSEDLFGLEPRADILHRVVRWQRNNAQQGTHKVKTRSETSYST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH  ++   FR GG   GPV     H L KK R L LRHALS K  + 
Sbjct: 61  KKIYRQKGTGGARHGDRNAPIFRKGGIYKGPVVRSHGHELTKKFRKLGLRHALSAKAKAG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           ++++I++  + E KT  L  + + L    ALIIDG  ++  F  A+RNI  +++LP  G 
Sbjct: 121 ELVIIEDAAA-EGKTAALAKQVKNLGWKRALIIDGASVNEGFLQASRNIEGLDILPTIGA 179

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDIL+   LV++K+ +EALE R K
Sbjct: 180 NVYDILKRDTLVITKAGVEALEARLK 205


>gi|294675857|ref|YP_003576472.1| 50S ribosomal protein L4 [Rhodobacter capsulatus SB 1003]
 gi|294474677|gb|ADE84065.1| 50S ribosomal protein L4 [Rhodobacter capsulatus SB 1003]
          Length = 206

 Score =  168 bits (425), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 123/206 (59%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L V  LDG   G I + E +F L+P+  IL RV+RWQ  + + G     G+S+V+Y+ 
Sbjct: 1   MKLDVIKLDGGTAGSIELDEALFGLEPRADILHRVVRWQRAKAQAGTHSVLGKSDVSYST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH SK    FR GG   GP P    H L KK R+L LRHALS K  S 
Sbjct: 61  KKIYRQKGTGGARHGSKKAPIFRHGGVYKGPTPRSHAHDLTKKFRALGLRHALSAKAKSG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++VI+     E KT  L    + L     L+IDG  ++ NF LAARN+  I++LP  G 
Sbjct: 121 SLVVIEAADMAEAKTALLAKAAKELGWKKVLVIDGASVNENFALAARNLDGIDVLPTMGA 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDIL+   LV++K+ +EALE R K
Sbjct: 181 NVYDILKRDTLVITKAGVEALEARLK 206


>gi|110678719|ref|YP_681726.1| 50S ribosomal protein L4 [Roseobacter denitrificans OCh 114]
 gi|123172736|sp|Q16AF3|RL4_ROSDO RecName: Full=50S ribosomal protein L4
 gi|109454835|gb|ABG31040.1| ribosomal protein L4 [Roseobacter denitrificans OCh 114]
          Length = 205

 Score =  168 bits (425), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 123/206 (59%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L V  LDG   G + + E +F L+P+  IL RV+RWQ    + G  K K RSEV Y+ 
Sbjct: 1   MKLDVIKLDGAKAGSVDLDEALFGLEPRADILHRVVRWQRNNAQAGTHKVKTRSEVNYST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH ++S   FRGGG   GP      H L KK R L L HALS K  + 
Sbjct: 61  KKIYRQKGTGGARHGARSAPIFRGGGVYKGPKVRSHGHELTKKFRKLGLCHALSAKMKAG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           ++++ID  VS + KT  L  +   L    ALIIDG  ++  F  AARNI  +++LP  G 
Sbjct: 121 ELVIIDE-VSSDGKTAALAKQVANLGWKRALIIDGATVNETFAQAARNIDGLDILPTMGA 179

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDIL+   LV++K+ +EALE R K
Sbjct: 180 NVYDILKRDTLVITKAGVEALEARLK 205


>gi|119383512|ref|YP_914568.1| 50S ribosomal protein L4 [Paracoccus denitrificans PD1222]
 gi|166234698|sp|A1B028|RL4_PARDP RecName: Full=50S ribosomal protein L4
 gi|119373279|gb|ABL68872.1| LSU ribosomal protein L4P [Paracoccus denitrificans PD1222]
          Length = 206

 Score =  165 bits (417), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 127/206 (61%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L V  LD    G I +S+DIF L+P+  +L RV+RWQ  + + G     G+S+V+Y+ 
Sbjct: 1   MKLDVITLDAGKAGDIDLSDDIFGLEPRADLLHRVVRWQRAKAQAGTHSVLGKSDVSYST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH S+    FR GG   GP P      LPKKVR+L L+HALS K  + 
Sbjct: 61  KKIYRQKGTGGARHGSRKAPIFRHGGVYKGPTPRSHAFDLPKKVRALGLKHALSAKAAAG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           +++V+D+L   E KT  +    +       L+IDG +++ NF  AARN+  +++LP  G 
Sbjct: 121 ELVVVDSLNIAEAKTAAVAKAVKENGWKRVLVIDGAEVNENFARAARNLEGVDVLPSMGA 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR   LVL+++ +EALE R K
Sbjct: 181 NVYDILRRDTLVLTRAGVEALEARLK 206


>gi|144900885|emb|CAM77749.1| 50S ribosomal protein L4 [Magnetospirillum gryphiswaldense MSR-1]
          Length = 205

 Score =  164 bits (415), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 131/206 (63%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++  V +LD +  G I +S+D+F L  +  +L R++ +Q  ++R G  K+KG SE++ T 
Sbjct: 1   MKTKVISLDNQSVGEIDLSDDVFGLAVRNDLLHRMVSYQLSKRRSGTHKTKGISEISGTT 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K + QKG GRAR  S   +QFRGG   FGPV       +PKKVR LAL+ ALS K    
Sbjct: 61  KKPFNQKGGGRARQGSLRSAQFRGGATIFGPVVRSHAFDMPKKVRKLALKVALSAKAAEG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++V+DN  +   KTK L  +F+AL  ++ L+IDG  +D NF LA+RNIP++++LP  G 
Sbjct: 121 KLVVLDNATAAAPKTKALAAQFKALGWASVLVIDGA-VDGNFALASRNIPHVDVLPEVGA 179

Query: 182 NVYDILRCSKLVLSKSAIEALEDRFK 207
           NVYDILR   LVL+K A+ ALE R K
Sbjct: 180 NVYDILRRDTLVLTKDAVAALEARLK 205


>gi|307294975|ref|ZP_07574817.1| ribosomal protein L4/L1e [Sphingobium chlorophenolicum L-1]
 gi|306879449|gb|EFN10667.1| ribosomal protein L4/L1e [Sphingobium chlorophenolicum L-1]
          Length = 207

 Score =  161 bits (408), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 88/205 (42%), Positives = 126/205 (61%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++++V+ LD +  G + +++ +F ++P+  IL RV+ WQ  ++R     ++ RS+VA TG
Sbjct: 1   MKVNVQTLDAQAAGDLELNDAVFGVEPRTDILHRVVLWQLEKRRAPTRATRERSDVARTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K   QKG G ARH  +    F GGGKA G       H L KKVR+L L+ ALS K  + 
Sbjct: 61  KKFGRQKGGGTARHGDRKAPVFIGGGKAHGARARTFGHDLNKKVRALGLKMALSTKAKNG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++V+DNL   E KTK LV     L+L+ AL IDG  ++ +F  A+ NI  +NLLP  G 
Sbjct: 121 SLIVLDNLDVAEGKTKALVAHLAKLNLNKALFIDGDAVNVSFAKASANIVGVNLLPAVGA 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRF 206
           NVYDILR   LVL+++A+E LE RF
Sbjct: 181 NVYDILRADSLVLTRAAVEKLEARF 205


>gi|149922210|ref|ZP_01910648.1| 50S ribosomal protein L4 [Plesiocystis pacifica SIR-1]
 gi|149816950|gb|EDM76435.1| 50S ribosomal protein L4 [Plesiocystis pacifica SIR-1]
          Length = 218

 Score =  161 bits (407), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 89/208 (42%), Positives = 131/208 (62%), Gaps = 5/208 (2%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +L+V++L+G D   I VS+++FA + ++ +L  V+RWQ  +KR G +K+K RSEV  T
Sbjct: 1   MAKLNVKDLEGNDVAEIEVSDEVFAAEVKEHLLWEVVRWQRAKKRAGTAKTKERSEVHGT 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
            SKMY QKGTG ARH S+ V+ FRGGG+  GP P     ++ KK R+ ALR ALS +   
Sbjct: 61  RSKMYRQKGTGNARHGSRRVNVFRGGGQVHGPRPRDYTFSVNKKARAGALRSALSLRASE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLA--ARNIPNINLLPV 178
            +++VI +    + KT+ L      L+   +L++DG     N  LA  ARN+P    +  
Sbjct: 121 GNLVVIRDFEVPDAKTRNLAAALGKLNAPKSLLVDGGD---NMSLARSARNLPTAQHIVP 177

Query: 179 QGINVYDILRCSKLVLSKSAIEALEDRF 206
           +G+NVYDILR  KL++S+S++ ALE R 
Sbjct: 178 EGVNVYDILRFPKLLISESSLRALEARL 205


>gi|224370690|ref|YP_002604854.1| 50S ribosomal protein L4 [Desulfobacterium autotrophicum HRM2]
 gi|259491553|sp|C0Q9X2|RL4_DESAH RecName: Full=50S ribosomal protein L4
 gi|223693407|gb|ACN16690.1| RplD [Desulfobacterium autotrophicum HRM2]
          Length = 207

 Score =  160 bits (406), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 91/207 (43%), Positives = 128/207 (61%), Gaps = 3/207 (1%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + V N  GE      +++++F++  ++ +L  V+R Q  R+R G +KSKGRSEV+ +
Sbjct: 1   MAAVDVLNRSGEKVSEAFLADEVFSIPVKKSVLHDVVRMQLARRRSGTAKSKGRSEVSGS 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
             K+Y QKGTG AR  S      RGGG  FGP P    +A+PKKVR+LAL+ ALS K  +
Sbjct: 61  TRKLYRQKGTGNARSGSVKSPLRRGGGVIFGPAPRSYAYAIPKKVRALALKMALSSKLAA 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALI-IDGCQLDRNFQLAARNIPNINLLPVQ 179
           N++ VID       KTK   +    L L N LI IDG   DRN  L+ARNIP++ ++  +
Sbjct: 121 NELSVIDTFAMDSIKTKEFDSIIDHLGLKNTLIVIDGD--DRNLVLSARNIPDVKVIRTE 178

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRF 206
           G+NVYDIL+   L+L +SAI+ +E RF
Sbjct: 179 GLNVYDILKYDNLLLIESAIKEIEGRF 205


>gi|148554273|ref|YP_001261855.1| 50S ribosomal protein L4 [Sphingomonas wittichii RW1]
 gi|166199910|sp|A5V601|RL4_SPHWW RecName: Full=50S ribosomal protein L4
 gi|148499463|gb|ABQ67717.1| LSU ribosomal protein L4P [Sphingomonas wittichii RW1]
          Length = 208

 Score =  160 bits (405), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 90/206 (43%), Positives = 130/206 (63%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +++ V+ LD +  G I +++++FA++P+  ILARV++WQ   +R     ++ RS+VA TG
Sbjct: 1   MKVKVQTLDAKASGDIELNDEVFAVEPRADILARVVQWQLHNRRAPARAARERSDVARTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K   QKG G ARH  +    F GGGKA GP   +   +L KKVR+L L+ ALS K    
Sbjct: 61  KKFGRQKGGGTARHGDRRAPVFIGGGKAHGPRARVFESSLNKKVRALGLKMALSSKAKDG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDL-SNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            ++V+D L  K+ KTK L+ +   L   + AL+IDG  +D  FQLA+ NI  IN+LP  G
Sbjct: 121 KLVVVDTLELKDAKTKALIAKIGKLGFGATALVIDGEAVDNGFQLASSNIHTINVLPAIG 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
            NVYDIL+   LVL+++A+E LE RF
Sbjct: 181 ANVYDILKHETLVLTRAAVEKLEARF 206


>gi|294010614|ref|YP_003544074.1| ribosomal protein L4 [Sphingobium japonicum UT26S]
 gi|292673944|dbj|BAI95462.1| ribosomal protein L4 [Sphingobium japonicum UT26S]
          Length = 207

 Score =  158 bits (399), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 86/205 (41%), Positives = 123/205 (60%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +++ V+ LD    G + +++ +F ++P+  IL RV+ WQ  ++R     ++ RS+VA TG
Sbjct: 1   MKVKVQTLDAAAAGEVELNDAVFGVEPRTDILHRVVTWQLEKRRAPARATRERSDVARTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K   QKG G ARH  +    F GGGKA G       H L KKVR+L L+ ALS K    
Sbjct: 61  KKFGRQKGGGTARHGDRKAPVFIGGGKAHGARARTFGHDLNKKVRALGLKMALSSKAKDG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++V+DNL   E KTK LV     L+L+ AL IDG  ++ +F  A+ NI  ++LLP  G 
Sbjct: 121 SLIVLDNLDVAEGKTKALVAHLAKLNLNKALFIDGDAVNVSFAKASANIIGVDLLPAVGA 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRF 206
           NVYDIL+   LVL+++A+E LE RF
Sbjct: 181 NVYDILKADSLVLTRAAVEKLEARF 205


>gi|132978|sp|P28601|RL4_BACST RecName: Full=50S ribosomal protein L4; Short=BL4
 gi|40103|emb|CAA47403.1| ribosomal protein L4 [Geobacillus stearothermophilus]
          Length = 207

 Score =  158 bits (399), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 83/204 (40%), Positives = 125/204 (61%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N +G+  G I +++ +F ++P + +L   +  Q    R G  K+K R+EV+  
Sbjct: 1   MPKVALYNQNGQTVGEIELNDAVFGIEPNKHVLFEAVIMQRASMRQGTHKTKNRAEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGPVP    + LPKKVR LA++ ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRAPQWRGGGTVFGPVPRSYSYKLPKKVRRLAIKSALSSKVLE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           NDI+V+D L  +  KTK +V     L +    +I   +L+ N  L+ARNIP + ++P  G
Sbjct: 121 NDIVVLDQLSLEAPKTKEMVKILNNLSVDRKALIVTDELNENVYLSARNIPGVKVVPANG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           INV D+L   KLV++K+A+E +E+
Sbjct: 181 INVLDVLNHDKLVITKAAVEKVEE 204


>gi|205372068|ref|ZP_03224885.1| 50S ribosomal protein L4 [Bacillus coahuilensis m4-4]
          Length = 207

 Score =  156 bits (394), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 86/204 (42%), Positives = 121/204 (59%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++S+ N  G   G I +++ IF ++P Q ++   +  Q    R G  K KGRSEVA  
Sbjct: 1   MPKVSLLNQTGSQVGDIELNDSIFGIEPNQSVMFDAVIMQRASLRQGNHKVKGRSEVAGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LPKKVR LA++ ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGIVFGPTPRSYSYKLPKKVRRLAIKSALSTKVVE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            +I+V+D L     KTK  V   + L L N +++    LD N  L+ARNIP + ++P  G
Sbjct: 121 ENIIVLDQLTFAAPKTKEFVAVLKNLSLDNKVLVVTDGLDENVALSARNIPGVTVVPSNG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           I+V D+L   KLV++K+A+E +E+
Sbjct: 181 ISVLDVLGHDKLVMTKAAVEKVEE 204


>gi|94498477|ref|ZP_01305033.1| 50S ribosomal protein L4 [Sphingomonas sp. SKA58]
 gi|94422020|gb|EAT07065.1| 50S ribosomal protein L4 [Sphingomonas sp. SKA58]
          Length = 207

 Score =  156 bits (394), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 85/205 (41%), Positives = 124/205 (60%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++++V+ LD +  G + +++ +F ++P+  IL RV+ WQ  ++R     ++ RS+VA TG
Sbjct: 1   MKVNVQTLDAQTAGELELNDAVFGVEPRTDILHRVVTWQLEKRRAPARATRERSDVARTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K   QKG G ARH  +    F GGGKA G       H L KKVR+L L+ ALS K    
Sbjct: 61  KKFGRQKGGGTARHGDRKAPIFIGGGKAHGARARDFGHDLNKKVRALGLKMALSAKAKDG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++V+D+    E KTK LV     L+L+ AL IDG  ++ +F  A+ NI  +NLLP  G 
Sbjct: 121 SLIVLDSFDVAEGKTKTLVAHLAKLNLNKALFIDGDAVNVSFAKASANIVGVNLLPAVGA 180

Query: 182 NVYDILRCSKLVLSKSAIEALEDRF 206
           NVYDIL+   LVL+++A+E LE RF
Sbjct: 181 NVYDILKADSLVLTRAAVEKLEARF 205


>gi|103488294|ref|YP_617855.1| 50S ribosomal protein L4 [Sphingopyxis alaskensis RB2256]
 gi|123252916|sp|Q1GPA0|RL4_SPHAL RecName: Full=50S ribosomal protein L4
 gi|98978371|gb|ABF54522.1| LSU ribosomal protein L4P [Sphingopyxis alaskensis RB2256]
          Length = 208

 Score =  155 bits (391), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 86/205 (41%), Positives = 123/205 (60%), Gaps = 1/205 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +++ V+ LDG+    I +++D+F L  +  IL RV+ WQ  ++R     ++ RS+VA TG
Sbjct: 1   MKIKVQTLDGKAGADIDLNDDVFGLDARADILHRVVAWQLEKRRGPARAARERSDVARTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K   QKG G ARH  +    F GGGKA GP      H+L KK+R+L L+ ALSDK    
Sbjct: 61  KKFGRQKGGGTARHGDRRAPIFIGGGKAHGPRARTFGHSLNKKIRTLGLKMALSDKAKGG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSN-ALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            ++VID L  K+ KTK L  +   LDL   AL IDG  +  +F +A+ N+  ++ LP  G
Sbjct: 121 KLVVIDTLELKDAKTKALAGKLGKLDLGKRALFIDGDAVHESFAMASANLIGVDALPAIG 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDR 205
            NVYDI+R   LVL+++A+E LE R
Sbjct: 181 ANVYDIVRADTLVLTRAAVEKLEAR 205


>gi|239825694|ref|YP_002948318.1| 50S ribosomal protein L4 [Geobacillus sp. WCH70]
 gi|259491561|sp|C5D3R8|RL4_GEOSW RecName: Full=50S ribosomal protein L4
 gi|239805987|gb|ACS23052.1| ribosomal protein L4/L1e [Geobacillus sp. WCH70]
          Length = 207

 Score =  154 bits (390), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 82/204 (40%), Positives = 123/204 (60%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N  GE  G I +++ +F ++P + +L   +  Q    R G  K+K R+EV+  
Sbjct: 1   MPKVALYNQSGETIGEIELNDSVFGIEPNKHVLFEAVIMQRASLRQGTHKTKNRAEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGPVP    + LPKKVR LA++ ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRAPQWRGGGTVFGPVPRSYSYKLPKKVRRLAIKSALSSKVLE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+I+V+DNL  +  KTK +V     L +    +I    ++ N  L+ARNIP + ++   G
Sbjct: 121 NNIVVLDNLTLEAPKTKEMVKILNNLSVDRKALIVTDDVNENVTLSARNIPGVTVVTANG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           INV D+L   KLV++K+A+E +E+
Sbjct: 181 INVLDVLNHDKLVITKAAVEKVEE 204


>gi|302772867|ref|XP_002969851.1| hypothetical protein SELMODRAFT_227946 [Selaginella moellendorffii]
 gi|300162362|gb|EFJ28975.1| hypothetical protein SELMODRAFT_227946 [Selaginella moellendorffii]
          Length = 215

 Score =  154 bits (390), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 82/204 (40%), Positives = 122/204 (59%), Gaps = 1/204 (0%)

Query: 4   LSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSK 63
           L V N + EDKG ++++ DIF +  ++ I+  V++WQ  ++R G   +K R EVA +  K
Sbjct: 6   LPVTNWEQEDKGTVTIAGDIFDVPIRKDIVHHVVKWQRAKRRKGTHSTKTRGEVAGSTRK 65

Query: 64  MYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDI 123
           ++ QKGTG+ARH S+   QFRGGG A GP P    + L KKVR L L+ ALS +     +
Sbjct: 66  IHKQKGTGKARHGSRRAPQFRGGGVAHGPKPRSYEYKLNKKVRRLGLKIALSARVAERKL 125

Query: 124 MVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQ-LDRNFQLAARNIPNINLLPVQGIN 182
           M+ DN+     KT+ L+     L     LI+DG + + R   LA RN+  +N++P +G+N
Sbjct: 126 MLFDNVDLPTHKTRQLMKLVPNLGCRRVLIVDGVEKMGREITLACRNVKEVNVIPAKGLN 185

Query: 183 VYDILRCSKLVLSKSAIEALEDRF 206
           VY IL    LV+S +A+  +EDR 
Sbjct: 186 VYSILLHDTLVMSVAAVREIEDRL 209


>gi|56418642|ref|YP_145960.1| 50S ribosomal protein L4 [Geobacillus kaustophilus HTA426]
 gi|261417608|ref|YP_003251290.1| 50S ribosomal protein L4 [Geobacillus sp. Y412MC61]
 gi|297528483|ref|YP_003669758.1| ribosomal protein L4/L1e [Geobacillus sp. C56-T3]
 gi|319765266|ref|YP_004130767.1| ribosomal protein L4/L1e [Geobacillus sp. Y412MC52]
 gi|81558135|sp|Q5L3Z6|RL4_GEOKA RecName: Full=50S ribosomal protein L4
 gi|56378484|dbj|BAD74392.1| 50S ribosomal protein L4 [Geobacillus kaustophilus HTA426]
 gi|261374065|gb|ACX76808.1| ribosomal protein L4/L1e [Geobacillus sp. Y412MC61]
 gi|297251735|gb|ADI25181.1| ribosomal protein L4/L1e [Geobacillus sp. C56-T3]
 gi|317110132|gb|ADU92624.1| ribosomal protein L4/L1e [Geobacillus sp. Y412MC52]
          Length = 207

 Score =  154 bits (389), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 82/204 (40%), Positives = 124/204 (60%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N +G+  G I +++ +F ++P + +L   +  Q    R G  K+K R+EV+  
Sbjct: 1   MPKVALYNQNGQTVGEIELNDAVFGIEPNKHVLFEAVIMQRASMRQGTHKTKNRAEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGPVP    + LPKKVR LA++ ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRAPQWRGGGTVFGPVPRSYSYKLPKKVRRLAIKSALSSKVLE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           NDI+V+D L  +  KTK +V     L +    +I   +L+ N  L+ARNIP + ++   G
Sbjct: 121 NDIVVLDQLSLEAPKTKEMVKILNNLSVDRKALIVTDELNENVYLSARNIPGVKVVAANG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           INV D+L   KLV++K+A+E +E+
Sbjct: 181 INVLDVLNHDKLVITKAAVEKVEE 204


>gi|297717844|gb|ADI50065.1| LSU ribosomal protein L4p [Candidatus Odyssella thessalonicensis
           L13]
          Length = 206

 Score =  154 bits (388), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 87/206 (42%), Positives = 126/206 (61%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +++ V N++ +  G I ++ +IF L+P+  IL+RV+ WQ  ++R G  K+K   +V  + 
Sbjct: 1   MKIDVINIEAKKAGDIELNPEIFGLQPRVDILSRVIEWQLAKRRSGNHKTKEVGDVRGST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH SK   QFRGG   FGPV     ++LPKKVR L L+ ALS K  + 
Sbjct: 61  RKIYRQKGTGNARHGSKRQVQFRGGCVVFGPVVRSHAYSLPKKVRKLGLKIALSAKTQAG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDG-CQLDRNFQLAARNIPNINLLPVQG 180
           +++V+D+      KTK L+    AL   NAL+ID     D     AA N+   ++LP  G
Sbjct: 121 ELIVVDSFKVATGKTKDLLKIITALQAPNALLIDAIANSDNPVVKAAANLEKFDVLPHNG 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
            NVYDI+R  KL+++K AI+ALE+R 
Sbjct: 181 ANVYDIMRKEKLIVTKEAIKALEERL 206


>gi|295401919|ref|ZP_06811882.1| ribosomal protein L4/L1e [Geobacillus thermoglucosidasius C56-YS93]
 gi|312109262|ref|YP_003987578.1| ribosomal protein L4/L1e [Geobacillus sp. Y4.1MC1]
 gi|294976049|gb|EFG51664.1| ribosomal protein L4/L1e [Geobacillus thermoglucosidasius C56-YS93]
 gi|311214363|gb|ADP72967.1| ribosomal protein L4/L1e [Geobacillus sp. Y4.1MC1]
          Length = 207

 Score =  153 bits (386), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 82/204 (40%), Positives = 123/204 (60%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N +GE  G I +++ +F ++P + +L   +  Q    R G  K+K R+EV+  
Sbjct: 1   MPKVALYNQNGETIGEIELNDSVFGIEPNKHVLFEAVIMQRASLRQGTHKTKNRAEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGPVP    + LPKKVR LA++ ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRAPQWRGGGTVFGPVPRSYSYKLPKKVRRLAIKSALSSKVLE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+I+V+DNL  +  KTK +V     L +    +I     + N  L+ARNIP + ++   G
Sbjct: 121 NNIVVLDNLTLEAPKTKEMVKILNNLSVDRKALIVTDVANENVALSARNIPGVTVVTANG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           INV D+L   KLV++K+A+E +E+
Sbjct: 181 INVLDLLNHDKLVITKAAVEKVEE 204


>gi|152973957|ref|YP_001373474.1| 50S ribosomal protein L4 [Bacillus cereus subsp. cytotoxis NVH
           391-98]
 gi|189029490|sp|A7GK21|RL4_BACCN RecName: Full=50S ribosomal protein L4
 gi|152022709|gb|ABS20479.1| ribosomal protein L4/L1e [Bacillus cytotoxicus NVH 391-98]
          Length = 207

 Score =  153 bits (386), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 79/204 (38%), Positives = 121/204 (59%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +++V N  G   G I ++E IF ++P + +L   +  Q    R G  K K RSEV+  
Sbjct: 1   MPKVTVYNQTGSQVGEIELAEAIFGIEPNEAVLFEAVVMQRASLRQGTHKVKNRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LPKKVR LA++ AL+ K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGTVFGPTPRSYAYKLPKKVRRLAIKSALATKVVE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+I+V+++LV    KTK +V   + L +    +I    ++   +L+ARNIP + ++   G
Sbjct: 121 NNIVVLEDLVLNAPKTKDMVAVLKGLAVEKKALIVTADVNEAVELSARNIPGVTVITADG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV D+L   KL+++K+A+E +E+
Sbjct: 181 VNVLDVLHHDKLIMTKAAVEKVEE 204


>gi|302807160|ref|XP_002985293.1| hypothetical protein SELMODRAFT_181558 [Selaginella moellendorffii]
 gi|300147121|gb|EFJ13787.1| hypothetical protein SELMODRAFT_181558 [Selaginella moellendorffii]
          Length = 215

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 82/204 (40%), Positives = 121/204 (59%), Gaps = 1/204 (0%)

Query: 4   LSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSK 63
           L V N + EDKG ++++ DIF +  ++ I+  V++WQ  ++R G   +K R EVA +  K
Sbjct: 6   LPVTNWEQEDKGTVTIAGDIFDVPIRKDIVHHVVKWQRAKRRKGTHSTKTRGEVAGSTRK 65

Query: 64  MYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDI 123
           +  QKGTG+ARH S+   QFRGGG A GP P    + L KKVR L L+ ALS +     +
Sbjct: 66  INKQKGTGKARHGSRRAPQFRGGGVAHGPKPRSYEYKLNKKVRRLGLKIALSARVAERKL 125

Query: 124 MVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQ-LDRNFQLAARNIPNINLLPVQGIN 182
           M+ DN+     KT+ L+     L     LI+DG + + R   LA RN+  +N++P +G+N
Sbjct: 126 MLFDNVDLPTHKTRQLMKLVPNLGCRRVLIVDGVEKMGREITLACRNVKEVNVIPAKGLN 185

Query: 183 VYDILRCSKLVLSKSAIEALEDRF 206
           VY IL    LV+S +A+  +EDR 
Sbjct: 186 VYSILLHDTLVMSVAAVREIEDRL 209


>gi|196251023|ref|ZP_03149705.1| ribosomal protein L4/L1e [Geobacillus sp. G11MC16]
 gi|196209495|gb|EDY04272.1| ribosomal protein L4/L1e [Geobacillus sp. G11MC16]
          Length = 207

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 82/204 (40%), Positives = 124/204 (60%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N +G+  G I +++ +F ++P + +L   +  Q    R G  K+K R+EV+  
Sbjct: 1   MPKVALYNQNGQTIGEIELNDAVFGIEPNKHVLFEAVIMQRASMRQGTHKTKNRAEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGPVP    + LPKKVR LA++ ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGTVFGPVPRSYSYKLPKKVRRLAIKSALSSKVLE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           NDI+V+D L  +  KTK +V     L +    +I   +L+ N  L+ARNIP + ++   G
Sbjct: 121 NDIVVLDQLSLEAPKTKEMVKILNNLAVDRKALIVTDELNENVYLSARNIPGVKVVAANG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           INV D+L   KLV++K+A+E +E+
Sbjct: 181 INVLDVLNHDKLVITKAAVEKVEE 204


>gi|212637955|ref|YP_002314475.1| 50S ribosomal protein L4 [Anoxybacillus flavithermus WK1]
 gi|226730612|sp|B7GJ68|RL4_ANOFW RecName: Full=50S ribosomal protein L4
 gi|212559435|gb|ACJ32490.1| Ribosomal protein L4 [Anoxybacillus flavithermus WK1]
          Length = 207

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 82/204 (40%), Positives = 123/204 (60%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N +GE+ G I +++ +F ++P + +L   +  Q    R G  K+K R+EV+  
Sbjct: 1   MPKVALYNQNGENIGEIELNDAVFGIEPNKHVLFEAVIMQRASLRQGTHKTKNRAEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGPVP    + LPKKVR LA++ ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPVPRSYSYKLPKKVRRLAIKSALSSKVLE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N I+V+DNL  +  KTK +V     L +    +I     + N  L+ARNIP + ++   G
Sbjct: 121 NSIVVLDNLTLEAPKTKEMVKILNNLSVDRKALIVTADANENVILSARNIPGVTVVTASG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           INV D+L   KLV++K+A+E +E+
Sbjct: 181 INVLDVLNHDKLVITKAAVEKVEE 204


>gi|138893786|ref|YP_001124239.1| 50S ribosomal protein L4 [Geobacillus thermodenitrificans NG80-2]
 gi|166234670|sp|A4IJJ0|RL4_GEOTN RecName: Full=50S ribosomal protein L4
 gi|134265299|gb|ABO65494.1| Ribosomal protein L4 [Geobacillus thermodenitrificans NG80-2]
          Length = 207

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 82/204 (40%), Positives = 124/204 (60%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N +G+  G I +++ +F ++P + +L   +  Q    R G  K+K R+EV+  
Sbjct: 1   MPKVALYNQNGQTIGEIELNDAVFGIEPNKHVLFEAVIMQRASMRQGTHKTKNRAEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGPVP    + LPKKVR LA++ ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGTVFGPVPRSYSYKLPKKVRRLAIKSALSSKVLE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           NDI+V+D L  +  KTK +V     L +    +I   +L+ N  L+ARNIP + ++   G
Sbjct: 121 NDIVVLDQLSLEAPKTKEMVKILNNLAVDRKALIVTDELNENVYLSARNIPGVKVVAANG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           INV D+L   KLV++K+A+E +E+
Sbjct: 181 INVLDVLSHDKLVITKAAVEKVEE 204


>gi|91205876|ref|YP_538231.1| 50S ribosomal protein L4 [Rickettsia bellii RML369-C]
 gi|157826765|ref|YP_001495829.1| 50S ribosomal protein L4 [Rickettsia bellii OSU 85-389]
 gi|109893633|sp|Q1RHM2|RL4_RICBR RecName: Full=50S ribosomal protein L4
 gi|166199856|sp|A8GVB5|RL4_RICB8 RecName: Full=50S ribosomal protein L4
 gi|91069420|gb|ABE05142.1| 50S ribosomal protein L4 [Rickettsia bellii RML369-C]
 gi|157802069|gb|ABV78792.1| 50S ribosomal protein L4 [Rickettsia bellii OSU 85-389]
          Length = 207

 Score =  152 bits (384), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 88/203 (43%), Positives = 120/203 (59%), Gaps = 1/203 (0%)

Query: 6   VRNLDGEDKGVISVSEDIFALK-PQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKM 64
           + NL  E+ G IS++EDIFA++  +  I+ +V+ WQ  +   G  K+K  SEV+ T  K 
Sbjct: 5   ILNLANEEIGEISLNEDIFAVEFIRDDIIKQVVDWQRAKAMAGTHKTKTVSEVSGTTKKP 64

Query: 65  YVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIM 124
           + QKGTG AR  S    Q RGGG   GPV       LPKKVR L L HALS+KF    ++
Sbjct: 65  FKQKGTGNARQGSLRSVQMRGGGVIHGPVVRSHATKLPKKVRKLGLIHALSEKFSEGKLL 124

Query: 125 VIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVY 184
           VID+L  +  KT  LV         +  +IDG ++D NF LAA+NI N  ++P  G NVY
Sbjct: 125 VIDSLKLETPKTSNLVNILNKFQGKSFFVIDGNEVDVNFSLAAQNIYNTVVVPQIGANVY 184

Query: 185 DILRCSKLVLSKSAIEALEDRFK 207
           DI+R   ++LS+ A+  LE+R K
Sbjct: 185 DIIRHEYVLLSQEAVNVLEERLK 207


>gi|229083431|ref|ZP_04215779.1| 50S ribosomal protein L4 [Bacillus cereus Rock3-44]
 gi|228699864|gb|EEL52501.1| 50S ribosomal protein L4 [Bacillus cereus Rock3-44]
          Length = 207

 Score =  152 bits (384), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 79/204 (38%), Positives = 120/204 (58%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +++V N  G   G I ++E IF ++P + +L   +  Q    R G  K K RSEV   
Sbjct: 1   MPKVTVYNQTGSQVGEIELAEAIFGIEPNEAVLFEAVMMQRASLRQGTHKVKTRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LPKKVR LA++ AL+ K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGTVFGPTPRSYAYKLPKKVRRLAIKSALATKVVE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+I+V+++LV    KTK +V   + L +    +I     + + +L+ARNIP + ++   G
Sbjct: 121 NNIVVLEDLVLNAPKTKDMVAVLKGLPVEKKALIVTADANESVELSARNIPGVTVITADG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV D+L   KL+++K+A+E +E+
Sbjct: 181 VNVLDVLHHDKLIMTKAAVEKVEE 204


>gi|163938119|ref|YP_001643003.1| 50S ribosomal protein L4 [Bacillus weihenstephanensis KBAB4]
 gi|229009620|ref|ZP_04166846.1| 50S ribosomal protein L4 [Bacillus mycoides DSM 2048]
 gi|229015513|ref|ZP_04172511.1| 50S ribosomal protein L4 [Bacillus cereus AH1273]
 gi|229021722|ref|ZP_04178304.1| 50S ribosomal protein L4 [Bacillus cereus AH1272]
 gi|229053957|ref|ZP_04195391.1| 50S ribosomal protein L4 [Bacillus cereus AH603]
 gi|229131119|ref|ZP_04260031.1| 50S ribosomal protein L4 [Bacillus cereus BDRD-ST196]
 gi|229165099|ref|ZP_04292894.1| 50S ribosomal protein L4 [Bacillus cereus AH621]
 gi|226730619|sp|A9VP78|RL4_BACWK RecName: Full=50S ribosomal protein L4
 gi|163860316|gb|ABY41375.1| ribosomal protein L4/L1e [Bacillus weihenstephanensis KBAB4]
 gi|228618362|gb|EEK75392.1| 50S ribosomal protein L4 [Bacillus cereus AH621]
 gi|228652332|gb|EEL08257.1| 50S ribosomal protein L4 [Bacillus cereus BDRD-ST196]
 gi|228721375|gb|EEL72896.1| 50S ribosomal protein L4 [Bacillus cereus AH603]
 gi|228739590|gb|EEL90004.1| 50S ribosomal protein L4 [Bacillus cereus AH1272]
 gi|228745800|gb|EEL95804.1| 50S ribosomal protein L4 [Bacillus cereus AH1273]
 gi|228751642|gb|EEM01442.1| 50S ribosomal protein L4 [Bacillus mycoides DSM 2048]
          Length = 207

 Score =  152 bits (383), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 79/204 (38%), Positives = 120/204 (58%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +++V N  G   G I ++E IF ++P + +L   +  Q    R G  K K RSEV   
Sbjct: 1   MPKVTVYNQTGSQVGEIELAEAIFGIEPNEAVLFEAVMMQRASLRQGTHKVKTRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LPKKVR LA++ AL+ K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGTVFGPTPRSYAYKLPKKVRRLAIKSALATKVVE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+I+V+++LV    KTK +V   + L +    +I     + + +L+ARNIP + ++   G
Sbjct: 121 NNIVVLEDLVLNAPKTKDMVAVLKGLTVEKKALIVTADANESVELSARNIPGVTVITADG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV D+L   KL+++K+A+E +E+
Sbjct: 181 VNVLDVLHHDKLIMTKAAVEKVEE 204


>gi|58038854|ref|YP_190818.1| 50S ribosomal protein L4 [Gluconobacter oxydans 621H]
 gi|81557183|sp|Q5FTY4|RL4_GLUOX RecName: Full=50S ribosomal protein L4
 gi|58001268|gb|AAW60162.1| LSU ribosomal protein L4P [Gluconobacter oxydans 621H]
          Length = 204

 Score =  151 bits (382), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 82/205 (40%), Positives = 121/205 (59%), Gaps = 2/205 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +E  ++ LD    G +++ E+IFA+ P+  I+ARV+ WQ  ++R G  ++KG  E++ T 
Sbjct: 1   MEYDIKTLDNGSAGSVALPEEIFAVTPRSDIMARVVHWQLAKRRAGTHRTKGMGEISGTT 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K Y QKGTG AR  S    QFR GG   GPV     + LPKKVR L L  ALS K    
Sbjct: 61  KKPYRQKGTGSARQGSLRAPQFRTGGVVHGPVVRDHGYDLPKKVRRLGLICALSQKAAEG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++V+D   +   KT+    + +AL  ++ALI+DG  +D  F  A  N+P I++LP  G 
Sbjct: 121 KLIVLDA-ANGVTKTREAAAKIKALGWTSALIVDGA-VDEQFARAIANLPKIDVLPTIGA 178

Query: 182 NVYDILRCSKLVLSKSAIEALEDRF 206
           NVYDIL    LV++++ +E L++R 
Sbjct: 179 NVYDILNHDVLVITRAGLEGLKERL 203


>gi|258542028|ref|YP_003187461.1| 50S ribosomal protein L4 [Acetobacter pasteurianus IFO 3283-01]
 gi|256633106|dbj|BAH99081.1| LSU ribosomal protein L4P [Acetobacter pasteurianus IFO 3283-01]
 gi|256636163|dbj|BAI02132.1| LSU ribosomal protein L4P [Acetobacter pasteurianus IFO 3283-03]
 gi|256639218|dbj|BAI05180.1| LSU ribosomal protein L4P [Acetobacter pasteurianus IFO 3283-07]
 gi|256642272|dbj|BAI08227.1| LSU ribosomal protein L4P [Acetobacter pasteurianus IFO 3283-22]
 gi|256645327|dbj|BAI11275.1| LSU ribosomal protein L4P [Acetobacter pasteurianus IFO 3283-26]
 gi|256648382|dbj|BAI14323.1| LSU ribosomal protein L4P [Acetobacter pasteurianus IFO 3283-32]
 gi|256651435|dbj|BAI17369.1| LSU ribosomal protein L4P [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654426|dbj|BAI20353.1| LSU ribosomal protein L4P [Acetobacter pasteurianus IFO 3283-12]
          Length = 204

 Score =  151 bits (382), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 121/205 (59%), Gaps = 2/205 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +E+ ++ LD    G  ++ ++IFA+ P+  I+ARV+ WQ  ++R G  K KG  EV+ T 
Sbjct: 1   MEIEIKTLDNSSAGSATLPDEIFAVAPRADIMARVVHWQLAKRRAGTHKVKGMGEVSGTT 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K Y QKGTG AR  S    Q+R GG   GPV     + LPKKVR L L  ALS K    
Sbjct: 61  KKPYRQKGTGSARQGSLRAPQYRTGGAVHGPVVRDHGYDLPKKVRRLGLISALSQKAKDG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++V+ +  S   KT  L  + ++L  ++ALI+D   +D NF  AARN+P I++LP  G 
Sbjct: 121 KLIVLQS-ASGVDKTSELAKKLKSLGWTSALIVDAA-VDENFGRAARNLPKIDILPTIGA 178

Query: 182 NVYDILRCSKLVLSKSAIEALEDRF 206
           NVYDIL    L ++++ +E L++R 
Sbjct: 179 NVYDILNHEVLAITQAGLEGLKERL 203


>gi|149184312|ref|ZP_01862630.1| 50S ribosomal protein L4 [Erythrobacter sp. SD-21]
 gi|148831632|gb|EDL50065.1| 50S ribosomal protein L4 [Erythrobacter sp. SD-21]
          Length = 207

 Score =  151 bits (381), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 86/206 (41%), Positives = 124/206 (60%), Gaps = 2/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +++ V+ +DG+  G I +++D+F ++P+  IL RV+ WQ   +R     ++ RS+VA TG
Sbjct: 1   MKVKVQKIDGKASGDIELNDDVFGVEPRADILHRVVTWQLENRRGTARPTRERSDVARTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K   QKG G ARH  +    F GGGKA G        +L KK+R+L L+ ALS K   +
Sbjct: 61  KKFGRQKGGGTARHGDRGAPIFIGGGKAHGARKRDFEQSLNKKIRALGLKMALSSK-AKD 119

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSN-ALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            ++V+D+L  K+ KTK L   F     S   LIIDG  ++  F+ AA N+P +N+LP  G
Sbjct: 120 GLVVVDSLELKDAKTKALKGHFDKNGWSGKVLIIDGESVNDGFKKAAGNLPGVNVLPAMG 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
            NVYDIL+   LVL+K A+E LE RF
Sbjct: 180 ANVYDILKHDTLVLTKDAVEKLEGRF 205


>gi|228989320|ref|ZP_04149311.1| 50S ribosomal protein L4 [Bacillus pseudomycoides DSM 12442]
 gi|228995502|ref|ZP_04155170.1| 50S ribosomal protein L4 [Bacillus mycoides Rock3-17]
 gi|229003127|ref|ZP_04160973.1| 50S ribosomal protein L4 [Bacillus mycoides Rock1-4]
 gi|228758090|gb|EEM07289.1| 50S ribosomal protein L4 [Bacillus mycoides Rock1-4]
 gi|228764231|gb|EEM13110.1| 50S ribosomal protein L4 [Bacillus mycoides Rock3-17]
 gi|228770398|gb|EEM18971.1| 50S ribosomal protein L4 [Bacillus pseudomycoides DSM 12442]
          Length = 207

 Score =  151 bits (381), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 79/204 (38%), Positives = 119/204 (58%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +++V N  G   G I ++E IF ++P + +L   +  Q    R G  K K RSEV   
Sbjct: 1   MPKVTVYNQTGSQVGEIELAEAIFGIEPNEAVLFEAVMMQRASLRQGTHKVKTRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LPKKVR LA++ AL+ K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGTVFGPTPRSYAYKLPKKVRRLAIKSALATKVVE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+I+V+++LV    KTK +V   + L +    +I     +   +L+ARNIP + ++   G
Sbjct: 121 NNIVVLEDLVLNAPKTKDMVAVLKGLTVEKKALIVTADANEAVELSARNIPGVTVITADG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV D+L   KL+++K+A+E +E+
Sbjct: 181 VNVLDVLHHDKLIMTKAAVEKVEE 204


>gi|296282583|ref|ZP_06860581.1| 50S ribosomal protein L4 [Citromicrobium bathyomarinum JL354]
          Length = 207

 Score =  151 bits (381), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 83/206 (40%), Positives = 126/206 (61%), Gaps = 2/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++++V+ +DG   G I +++ +F ++P+  IL RV+ WQ  ++R     ++ RS+VA TG
Sbjct: 1   MKIAVQKIDGGKAGEIELNDAVFGVEPRADILHRVVTWQLEKRRGTARPTRERSDVARTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K   QKG+G ARH  +    F GGGKA G        +L KK+RSL LR ALS K   +
Sbjct: 61  KKFGRQKGSGGARHGDRGAPIFIGGGKAHGARKRDFDPSLNKKIRSLGLRMALSSK-AKD 119

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSN-ALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            ++++D+L  K+ KTK L   F     +   L+IDG  ++  F++AA N+P +N++P  G
Sbjct: 120 GLVIVDSLELKDAKTKALKGHFEKAGFNGKVLVIDGESVNDGFKMAAGNLPGVNVIPAVG 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
            NVYDIL+   LVL+K A+E LE RF
Sbjct: 180 ANVYDILKHDTLVLTKDAVEKLEARF 205


>gi|30018381|ref|NP_830012.1| 50S ribosomal protein L4 [Bacillus cereus ATCC 14579]
 gi|30260302|ref|NP_842679.1| 50S ribosomal protein L4 [Bacillus anthracis str. Ames]
 gi|42779192|ref|NP_976439.1| 50S ribosomal protein L4 [Bacillus cereus ATCC 10987]
 gi|47525367|ref|YP_016716.1| 50S ribosomal protein L4 [Bacillus anthracis str. 'Ames Ancestor']
 gi|49183145|ref|YP_026397.1| 50S ribosomal protein L4 [Bacillus anthracis str. Sterne]
 gi|49476718|ref|YP_034463.1| 50S ribosomal protein L4 [Bacillus thuringiensis serovar konkukian
           str. 97-27]
 gi|52145106|ref|YP_081722.1| 50S ribosomal protein L4 [Bacillus cereus E33L]
 gi|118475880|ref|YP_893031.1| 50S ribosomal protein L4 [Bacillus thuringiensis str. Al Hakam]
 gi|206972278|ref|ZP_03233225.1| 50S ribosomal protein L4 [Bacillus cereus AH1134]
 gi|217957686|ref|YP_002336230.1| 50S ribosomal protein L4 [Bacillus cereus AH187]
 gi|218234634|ref|YP_002364960.1| 50S ribosomal protein L4 [Bacillus cereus B4264]
 gi|218895246|ref|YP_002443657.1| ribosomal protein L4 [Bacillus cereus G9842]
 gi|218901315|ref|YP_002449149.1| ribosomal protein L4 [Bacillus cereus AH820]
 gi|222093881|ref|YP_002527931.1| 50S ribosomal protein l4 [Bacillus cereus Q1]
 gi|225862163|ref|YP_002747541.1| 50S ribosomal protein L4 [Bacillus cereus 03BB102]
 gi|227812784|ref|YP_002812793.1| 50S ribosomal protein L4 [Bacillus anthracis str. CDC 684]
 gi|228898864|ref|ZP_04063146.1| 50S ribosomal protein L4 [Bacillus thuringiensis IBL 4222]
 gi|228905908|ref|ZP_04069805.1| 50S ribosomal protein L4 [Bacillus thuringiensis IBL 200]
 gi|228912850|ref|ZP_04076497.1| 50S ribosomal protein L4 [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
 gi|228919061|ref|ZP_04082440.1| 50S ribosomal protein L4 [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228925364|ref|ZP_04088460.1| 50S ribosomal protein L4 [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228931613|ref|ZP_04094519.1| 50S ribosomal protein L4 [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228937414|ref|ZP_04100060.1| 50S ribosomal protein L4 [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|228943917|ref|ZP_04106302.1| 50S ribosomal protein L4 [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|228950659|ref|ZP_04112793.1| 50S ribosomal protein L4 [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|228956552|ref|ZP_04118348.1| 50S ribosomal protein L4 [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|228963211|ref|ZP_04124380.1| 50S ribosomal protein L4 [Bacillus thuringiensis serovar sotto str.
           T04001]
 gi|228970300|ref|ZP_04130959.1| 50S ribosomal protein L4 [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228976870|ref|ZP_04137282.1| 50S ribosomal protein L4 [Bacillus thuringiensis Bt407]
 gi|228983366|ref|ZP_04143579.1| 50S ribosomal protein L4 [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|229027959|ref|ZP_04184112.1| 50S ribosomal protein L4 [Bacillus cereus AH1271]
 gi|229041016|ref|ZP_04189779.1| 50S ribosomal protein L4 [Bacillus cereus AH676]
 gi|229067876|ref|ZP_04201193.1| 50S ribosomal protein L4 [Bacillus cereus F65185]
 gi|229074172|ref|ZP_04207218.1| 50S ribosomal protein L4 [Bacillus cereus Rock4-18]
 gi|229089242|ref|ZP_04220523.1| 50S ribosomal protein L4 [Bacillus cereus Rock3-42]
 gi|229094833|ref|ZP_04225838.1| 50S ribosomal protein L4 [Bacillus cereus Rock3-29]
 gi|229100910|ref|ZP_04231714.1| 50S ribosomal protein L4 [Bacillus cereus Rock3-28]
 gi|229107797|ref|ZP_04237433.1| 50S ribosomal protein L4 [Bacillus cereus Rock1-15]
 gi|229113787|ref|ZP_04243222.1| 50S ribosomal protein L4 [Bacillus cereus Rock1-3]
 gi|229119773|ref|ZP_04249034.1| 50S ribosomal protein L4 [Bacillus cereus 95/8201]
 gi|229125628|ref|ZP_04254660.1| 50S ribosomal protein L4 [Bacillus cereus BDRD-Cer4]
 gi|229136957|ref|ZP_04265584.1| 50S ribosomal protein L4 [Bacillus cereus BDRD-ST26]
 gi|229142917|ref|ZP_04271358.1| 50S ribosomal protein L4 [Bacillus cereus BDRD-ST24]
 gi|229148520|ref|ZP_04276776.1| 50S ribosomal protein L4 [Bacillus cereus m1550]
 gi|229153889|ref|ZP_04282019.1| 50S ribosomal protein L4 [Bacillus cereus ATCC 4342]
 gi|229159284|ref|ZP_04287308.1| 50S ribosomal protein L4 [Bacillus cereus R309803]
 gi|229170962|ref|ZP_04298563.1| 50S ribosomal protein L4 [Bacillus cereus MM3]
 gi|229176711|ref|ZP_04304115.1| 50S ribosomal protein L4 [Bacillus cereus 172560W]
 gi|229182505|ref|ZP_04309756.1| 50S ribosomal protein L4 [Bacillus cereus BGSC 6E1]
 gi|229188396|ref|ZP_04315444.1| 50S ribosomal protein L4 [Bacillus cereus ATCC 10876]
 gi|229194501|ref|ZP_04321304.1| 50S ribosomal protein L4 [Bacillus cereus m1293]
 gi|229602888|ref|YP_002864762.1| 50S ribosomal protein L4 [Bacillus anthracis str. A0248]
 gi|254684385|ref|ZP_05148245.1| 50S ribosomal protein L4 [Bacillus anthracis str. CNEVA-9066]
 gi|254720833|ref|ZP_05182625.1| 50S ribosomal protein L4 [Bacillus anthracis str. A1055]
 gi|254733588|ref|ZP_05191308.1| 50S ribosomal protein L4 [Bacillus anthracis str. Western North
           America USA6153]
 gi|254739508|ref|ZP_05197205.1| 50S ribosomal protein L4 [Bacillus anthracis str. Kruger B]
 gi|254751227|ref|ZP_05203265.1| 50S ribosomal protein L4 [Bacillus anthracis str. Vollum]
 gi|254756766|ref|ZP_05208795.1| 50S ribosomal protein L4 [Bacillus anthracis str. Australia 94]
 gi|296500945|ref|YP_003662645.1| 50S ribosomal protein L4 [Bacillus thuringiensis BMB171]
 gi|300119577|ref|ZP_07057121.1| 50S ribosomal protein L4 [Bacillus cereus SJ1]
 gi|301051848|ref|YP_003790059.1| 50S ribosomal protein L4 [Bacillus anthracis CI]
 gi|46576767|sp|Q81J41|RL4_BACCR RecName: Full=50S ribosomal protein L4
 gi|46576769|sp|Q81VS9|RL4_BACAN RecName: Full=50S ribosomal protein L4
 gi|81570005|sp|Q73F95|RL4_BACC1 RecName: Full=50S ribosomal protein L4
 gi|81614034|sp|Q6HPQ7|RL4_BACHK RecName: Full=50S ribosomal protein L4
 gi|81689839|sp|Q63H89|RL4_BACCZ RecName: Full=50S ribosomal protein L4
 gi|166234634|sp|A0R8I1|RL4_BACAH RecName: Full=50S ribosomal protein L4
 gi|226730615|sp|B7JKC0|RL4_BACC0 RecName: Full=50S ribosomal protein L4
 gi|226730616|sp|B7IT20|RL4_BACC2 RecName: Full=50S ribosomal protein L4
 gi|226730617|sp|B7HJ49|RL4_BACC4 RecName: Full=50S ribosomal protein L4
 gi|226730618|sp|B7HQU5|RL4_BACC7 RecName: Full=50S ribosomal protein L4
 gi|254803712|sp|C3P9Q6|RL4_BACAA RecName: Full=50S ribosomal protein L4
 gi|254803713|sp|C3LJ83|RL4_BACAC RecName: Full=50S ribosomal protein L4
 gi|254803714|sp|C1ET40|RL4_BACC3 RecName: Full=50S ribosomal protein L4
 gi|254803715|sp|B9IZJ5|RL4_BACCQ RecName: Full=50S ribosomal protein L4
 gi|29893921|gb|AAP07213.1| LSU ribosomal protein L1E/L4P [Bacillus cereus ATCC 14579]
 gi|30253623|gb|AAP24165.1| 50S ribosomal protein L4 [Bacillus anthracis str. Ames]
 gi|42735107|gb|AAS39047.1| ribosomal protein L4 [Bacillus cereus ATCC 10987]
 gi|47500515|gb|AAT29191.1| ribosomal protein L4 [Bacillus anthracis str. 'Ames Ancestor']
 gi|49177072|gb|AAT52448.1| ribosomal protein L4 [Bacillus anthracis str. Sterne]
 gi|49328274|gb|AAT58920.1| ribosomal protein L4 (50S ribosomal protein L4) [Bacillus
           thuringiensis serovar konkukian str. 97-27]
 gi|51978575|gb|AAU20125.1| ribosomal protein L4 (50S ribosomal protein L4) [Bacillus cereus
           E33L]
 gi|118415105|gb|ABK83524.1| LSU ribosomal protein L4P [Bacillus thuringiensis str. Al Hakam]
 gi|206732852|gb|EDZ50027.1| 50S ribosomal protein L4 [Bacillus cereus AH1134]
 gi|217062939|gb|ACJ77189.1| ribosomal protein L4 [Bacillus cereus AH187]
 gi|218162591|gb|ACK62583.1| ribosomal protein L4 [Bacillus cereus B4264]
 gi|218538801|gb|ACK91199.1| ribosomal protein L4 [Bacillus cereus AH820]
 gi|218543914|gb|ACK96308.1| ribosomal protein L4 [Bacillus cereus G9842]
 gi|221237929|gb|ACM10639.1| ribosomal protein L4 (50S ribosomal protein L4) [Bacillus cereus
           Q1]
 gi|225787946|gb|ACO28163.1| 50S ribosomal protein L4 [Bacillus cereus 03BB102]
 gi|227006772|gb|ACP16515.1| 50S ribosomal protein L4 [Bacillus anthracis str. CDC 684]
 gi|228588967|gb|EEK46982.1| 50S ribosomal protein L4 [Bacillus cereus m1293]
 gi|228595070|gb|EEK52841.1| 50S ribosomal protein L4 [Bacillus cereus ATCC 10876]
 gi|228600960|gb|EEK58529.1| 50S ribosomal protein L4 [Bacillus cereus BGSC 6E1]
 gi|228606754|gb|EEK64171.1| 50S ribosomal protein L4 [Bacillus cereus 172560W]
 gi|228612502|gb|EEK69723.1| 50S ribosomal protein L4 [Bacillus cereus MM3]
 gi|228624176|gb|EEK80978.1| 50S ribosomal protein L4 [Bacillus cereus R309803]
 gi|228629570|gb|EEK86267.1| 50S ribosomal protein L4 [Bacillus cereus ATCC 4342]
 gi|228634936|gb|EEK91509.1| 50S ribosomal protein L4 [Bacillus cereus m1550]
 gi|228640538|gb|EEK96927.1| 50S ribosomal protein L4 [Bacillus cereus BDRD-ST24]
 gi|228646495|gb|EEL02702.1| 50S ribosomal protein L4 [Bacillus cereus BDRD-ST26]
 gi|228657820|gb|EEL13626.1| 50S ribosomal protein L4 [Bacillus cereus BDRD-Cer4]
 gi|228663674|gb|EEL19253.1| 50S ribosomal protein L4 [Bacillus cereus 95/8201]
 gi|228669658|gb|EEL25065.1| 50S ribosomal protein L4 [Bacillus cereus Rock1-3]
 gi|228675646|gb|EEL30854.1| 50S ribosomal protein L4 [Bacillus cereus Rock1-15]
 gi|228682489|gb|EEL36562.1| 50S ribosomal protein L4 [Bacillus cereus Rock3-28]
 gi|228688576|gb|EEL42449.1| 50S ribosomal protein L4 [Bacillus cereus Rock3-29]
 gi|228694081|gb|EEL47763.1| 50S ribosomal protein L4 [Bacillus cereus Rock3-42]
 gi|228708942|gb|EEL61069.1| 50S ribosomal protein L4 [Bacillus cereus Rock4-18]
 gi|228715235|gb|EEL67094.1| 50S ribosomal protein L4 [Bacillus cereus F65185]
 gi|228727313|gb|EEL78507.1| 50S ribosomal protein L4 [Bacillus cereus AH676]
 gi|228733347|gb|EEL84176.1| 50S ribosomal protein L4 [Bacillus cereus AH1271]
 gi|228776356|gb|EEM24709.1| 50S ribosomal protein L4 [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|228782840|gb|EEM31006.1| 50S ribosomal protein L4 [Bacillus thuringiensis Bt407]
 gi|228789409|gb|EEM37329.1| 50S ribosomal protein L4 [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228796469|gb|EEM43908.1| 50S ribosomal protein L4 [Bacillus thuringiensis serovar sotto str.
           T04001]
 gi|228803117|gb|EEM49939.1| 50S ribosomal protein L4 [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|228809010|gb|EEM55495.1| 50S ribosomal protein L4 [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|228815750|gb|EEM61986.1| 50S ribosomal protein L4 [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|228822247|gb|EEM68229.1| 50S ribosomal protein L4 [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|228828041|gb|EEM73769.1| 50S ribosomal protein L4 [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228834286|gb|EEM79827.1| 50S ribosomal protein L4 [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228840586|gb|EEM85848.1| 50S ribosomal protein L4 [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228846786|gb|EEM91791.1| 50S ribosomal protein L4 [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
 gi|228853723|gb|EEM98483.1| 50S ribosomal protein L4 [Bacillus thuringiensis IBL 200]
 gi|228860764|gb|EEN05142.1| 50S ribosomal protein L4 [Bacillus thuringiensis IBL 4222]
 gi|229267296|gb|ACQ48933.1| 50S ribosomal protein L4 [Bacillus anthracis str. A0248]
 gi|296321997|gb|ADH04925.1| 50S ribosomal protein L4 [Bacillus thuringiensis BMB171]
 gi|298723049|gb|EFI63947.1| 50S ribosomal protein L4 [Bacillus cereus SJ1]
 gi|300374017|gb|ADK02921.1| 50S ribosomal protein L4 [Bacillus cereus biovar anthracis str. CI]
 gi|324324102|gb|ADY19362.1| 50S ribosomal protein L4 [Bacillus thuringiensis serovar finitimus
           YBT-020]
 gi|326937906|gb|AEA13802.1| 50S ribosomal protein L4 [Bacillus thuringiensis serovar chinensis
           CT-43]
          Length = 207

 Score =  150 bits (380), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 78/204 (38%), Positives = 120/204 (58%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +++V N  G   G I ++E IF ++P + +L   +  Q    R G  K K RSEV   
Sbjct: 1   MPKVTVYNQTGSQVGEIELAEAIFGIEPNEAVLFEAVMMQRASLRQGTHKVKTRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LPKKVR LA++ AL+ K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGTVFGPTPRSYAYKLPKKVRRLAIKSALATKVVE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+I+V+++LV    KTK ++   + L +    +I     + + +L+ARNIP + ++   G
Sbjct: 121 NNIVVLEDLVLNAPKTKDMLAVLKGLTVEKKALIVTADANESVELSARNIPGVTVITADG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV D+L   KL+++K+A+E +E+
Sbjct: 181 VNVLDVLHHDKLIMTKAAVEKVEE 204


>gi|114327219|ref|YP_744376.1| 50S ribosomal protein L4 [Granulibacter bethesdensis CGDNIH1]
 gi|122327801|sp|Q0BUP9|RL4_GRABC RecName: Full=50S ribosomal protein L4
 gi|114315393|gb|ABI61453.1| LSU ribosomal protein L1E (= L4P) [Granulibacter bethesdensis
           CGDNIH1]
          Length = 215

 Score =  150 bits (380), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 84/205 (40%), Positives = 116/205 (56%), Gaps = 1/205 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +++ ++ LD    G   + ++IFA  P+  I+ARV+ WQ   +R G  K KG  EV+ T 
Sbjct: 1   MQIEIKTLDNGSAGTAELPDEIFAATPRADIMARVVHWQLACRRAGTHKVKGMGEVSGTT 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K Y QKGTG AR  S    QFR GG   GPV     + LPKKVR L L  ALS K    
Sbjct: 61  KKPYRQKGTGNARQGSLRAPQFRTGGAVHGPVVRDHGYDLPKKVRRLGLISALSQKQAEG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++VID     E KT+ L  + RAL   +ALI+DG  +D  F  A+R++  +++LP  G 
Sbjct: 121 KLVVIDTAAGME-KTRDLAAKLRALGWRSALIVDGASVDEGFARASRSLLAVDVLPTIGA 179

Query: 182 NVYDILRCSKLVLSKSAIEALEDRF 206
           NVYDIL    L ++ + +EAL+ R 
Sbjct: 180 NVYDILNHDVLAITVAGVEALKARL 204


>gi|157804034|ref|YP_001492583.1| 50S ribosomal protein L4 [Rickettsia canadensis str. McKiel]
 gi|166199857|sp|A8EZL5|RL4_RICCK RecName: Full=50S ribosomal protein L4
 gi|157785297|gb|ABV73798.1| 50S ribosomal protein L4 [Rickettsia canadensis str. McKiel]
          Length = 207

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 85/203 (41%), Positives = 122/203 (60%), Gaps = 1/203 (0%)

Query: 6   VRNLDGEDKGVISVSEDIFALK-PQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKM 64
           + +L  E+ G IS+++DIFA++  +  I+ +V+ WQ  +   G  K+K  SEV+ T  K 
Sbjct: 5   ILSLANEEVGEISLNKDIFAVEFIRDDIIKQVIDWQRAKAMSGNHKTKTVSEVSGTTKKP 64

Query: 65  YVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIM 124
           + QKGTG AR  S    Q RGGG A GP+       LPKKVR L L HALS+KF    ++
Sbjct: 65  FKQKGTGNARQGSLRSVQMRGGGLAHGPIVRSHATQLPKKVRKLGLIHALSEKFAEGKLL 124

Query: 125 VIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVY 184
           VID+L   + KT +LV         +  +IDG ++D NF LAA+NI N  ++P  G NVY
Sbjct: 125 VIDSLKLDKPKTSFLVNILNKFQGQSFFVIDGNEVDINFSLAAKNIYNTVIVPQIGANVY 184

Query: 185 DILRCSKLVLSKSAIEALEDRFK 207
           DI+R   ++LS+ A+  LE+R +
Sbjct: 185 DIIRHEYVLLSQEAVNVLEERLR 207


>gi|157826062|ref|YP_001493782.1| 50S ribosomal protein L4 [Rickettsia akari str. Hartford]
 gi|166199855|sp|A8GPE9|RL4_RICAH RecName: Full=50S ribosomal protein L4
 gi|157800020|gb|ABV75274.1| 50S ribosomal protein L4 [Rickettsia akari str. Hartford]
          Length = 207

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 86/201 (42%), Positives = 120/201 (59%), Gaps = 1/201 (0%)

Query: 8   NLDGEDKGVISVSEDIFALK-PQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYV 66
           +L  E+ G IS++EDIFA++  +  ++ +V+ WQ  +   G  K+K  SEV+ T  K + 
Sbjct: 7   SLANEEVGEISLNEDIFAVEFIRDDVIKQVIDWQRAKAMSGNHKTKTVSEVSGTTKKPFK 66

Query: 67  QKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVI 126
           QKGTG AR  S    Q RGGG A GP     V  LPKKVR L L HALS+KF    ++VI
Sbjct: 67  QKGTGNARQGSLRSVQMRGGGVAHGPRVRSHVTKLPKKVRKLGLIHALSEKFAEGRLLVI 126

Query: 127 DNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDI 186
           D+L   + KT  LV         +  +IDG ++D NF LAA+NI N  ++P  G NVYDI
Sbjct: 127 DSLKLDQPKTSALVNILSKFQGKSFFVIDGNEVDTNFSLAAKNIYNTAIVPQIGANVYDI 186

Query: 187 LRCSKLVLSKSAIEALEDRFK 207
           +R   ++LS+ A+  LE+R +
Sbjct: 187 IRYEYVLLSQEAVSVLEERLR 207


>gi|87199271|ref|YP_496528.1| 50S ribosomal protein L4 [Novosphingobium aromaticivorans DSM
           12444]
 gi|109893614|sp|Q2G8X9|RL4_NOVAD RecName: Full=50S ribosomal protein L4
 gi|87134952|gb|ABD25694.1| LSU ribosomal protein L4P [Novosphingobium aromaticivorans DSM
           12444]
          Length = 207

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 92/207 (44%), Positives = 126/207 (60%), Gaps = 4/207 (1%)

Query: 2   IELSVRNLDGE-DKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           +++ V NLDG   KG + +S+D+F L+P+  IL RV+ WQ   +R    K++ RS+VA T
Sbjct: 1   MKVQVLNLDGTAGKGEVELSDDVFGLEPRADILHRVVTWQLENRRGIARKARERSDVART 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K   QKG G ARH  +    F GGGKA GP       +L KKVR+L L+ ALS K   
Sbjct: 61  GKKFGRQKGGGTARHGDRKAPIFIGGGKAHGPRVREFNISLNKKVRALGLKMALSSK-AK 119

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLS-NALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
             ++V+DNL   + KTK LV +    +     L+IDG  ++ NF  AARNI  +N+LP  
Sbjct: 120 AGLVVVDNL-DVDAKTKALVGQLAKANWGKKVLVIDGEGVNDNFAKAARNIVGVNVLPAI 178

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRF 206
           G NVYDIL+   LVL+++A+E LE RF
Sbjct: 179 GANVYDILKHDTLVLTRAAVEKLEARF 205


>gi|329114216|ref|ZP_08242978.1| 50S ribosomal protein L4 [Acetobacter pomorum DM001]
 gi|326696292|gb|EGE47971.1| 50S ribosomal protein L4 [Acetobacter pomorum DM001]
          Length = 204

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 82/205 (40%), Positives = 121/205 (59%), Gaps = 2/205 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +E+ ++ LD    G  ++ ++IFA+ P+  I+ARV+ WQ  ++R G  K KG  EV+ T 
Sbjct: 1   MEIEIKTLDNSSAGSATLPDEIFAVAPRADIMARVVHWQLAKRRAGTHKVKGMGEVSGTT 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K Y QKGTG AR  S    Q+R GG   GPV     + LPKKVR L L  ALS K    
Sbjct: 61  KKPYRQKGTGSARQGSLRAPQYRTGGAVHGPVVRDHGYDLPKKVRRLGLISALSQKAKDG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++V+ +  S   KT  L  + ++L  ++ALI+D   +D +F  AARN+P I++LP  G 
Sbjct: 121 KLIVLQS-ASGVDKTSELAKKLKSLGWTSALIVDAA-VDESFGRAARNLPKIDILPTIGA 178

Query: 182 NVYDILRCSKLVLSKSAIEALEDRF 206
           NVYDIL    L ++++ +E L++R 
Sbjct: 179 NVYDILNHEVLAITQAGLEGLKERL 203


>gi|89100348|ref|ZP_01173213.1| 50S ribosomal protein L4 [Bacillus sp. NRRL B-14911]
 gi|89084969|gb|EAR64105.1| 50S ribosomal protein L4 [Bacillus sp. NRRL B-14911]
          Length = 207

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 81/204 (39%), Positives = 117/204 (57%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N  G   G I ++E IF ++P   +L   +  Q    R G  K+K RSEVA  
Sbjct: 1   MPKVALLNQAGSQVGEIELNETIFGIEPNNHVLFEAVVMQRASLRQGTHKTKIRSEVAGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LPKKVR LA++ ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGTVFGPTPRSYSYKLPKKVRRLAIKSALSSKVAE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            +I+V++NL  +  KTK        L +    +I    LD N  L+ARNIP + ++   G
Sbjct: 121 ENILVLENLALETPKTKDFKGVLTGLSVDKKALIVTADLDENVALSARNIPGVTVVTATG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV D+L   KL+++K+A+E +E+
Sbjct: 181 VNVLDVLSHDKLIMTKAAVEKVEE 204


>gi|289449461|ref|YP_003475783.1| 50S ribosomal protein L4 [Clostridiales genomosp. BVAB3 str.
           UPII9-5]
 gi|289184008|gb|ADC90433.1| 50S ribosomal protein L4 [Clostridiales genomosp. BVAB3 str.
           UPII9-5]
          Length = 207

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 77/206 (37%), Positives = 127/206 (61%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ V NLDG   G I +S+ +F ++P Q ++ +V++ Q   +R G   +K RSEV+  
Sbjct: 1   MAKVDVYNLDGAVIGQIELSDAVFGIEPNQSVMHQVVKNQLANRRQGTGSTKTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G + + QKGTGRARH S   +Q+ GGG  FGP P    + + KKVR LA++ ALS K   
Sbjct: 61  GKRPWRQKGTGRARHGSTRSAQYVGGGIIFGPKPRDYHYTVSKKVRRLAIKSALSTKLQE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             ++V++N    E KTK  VT  + L++++ +++   + + N +LAARNI  + L     
Sbjct: 121 KQLIVVENFELAEAKTKNFVTALKKLNVTDRVLVVENEKNVNLELAARNIAKVQLSRANT 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INV+D+L+   L++SK+A+E +++ +
Sbjct: 181 INVFDLLKNEVLLISKAAVEKIQEVY 206


>gi|167463901|ref|ZP_02328990.1| 50S ribosomal protein L4 [Paenibacillus larvae subsp. larvae
           BRL-230010]
 gi|322381125|ref|ZP_08055128.1| 50S ribosomal protein L4-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
 gi|321154701|gb|EFX46972.1| 50S ribosomal protein L4-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
          Length = 208

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 77/204 (37%), Positives = 116/204 (56%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N+ G   G + +S+ +F ++P   +L   +  Q    R G  K+KGRSEV   
Sbjct: 1   MPKVALYNVQGTQVGEVELSDAVFGIEPHVHVLHEAVVMQQASLRQGTHKTKGRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q++GGG  FGP P    + LPKKVR LA++ ALS K   
Sbjct: 61  GRKPWKQKGTGRARQGSIRAPQWKGGGTVFGPTPRSYAYKLPKKVRRLAIKSALSSKVID 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+I+V+D+L   + KTK        L +    ++   + D N   +ARNIP +  L   G
Sbjct: 121 NEIVVLDDLAMAQPKTKEFAAILTNLKVERKALVVASEHDENVARSARNIPGVKFLAADG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           INV D+L   KL+++K A++ +E+
Sbjct: 181 INVLDVLGYDKLIITKDAVQKVEE 204


>gi|85709056|ref|ZP_01040122.1| 50S ribosomal protein L4 [Erythrobacter sp. NAP1]
 gi|85690590|gb|EAQ30593.1| 50S ribosomal protein L4 [Erythrobacter sp. NAP1]
          Length = 207

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 83/206 (40%), Positives = 123/206 (59%), Gaps = 2/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +++ V+ +DG+  G I +S+D+F ++P+  IL RV+ WQ   +R     ++ RS+VA TG
Sbjct: 1   MKVKVQKIDGKASGDIELSDDVFGVEPRADILHRVVTWQLENRRATARPTRERSDVARTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K   QKG+G ARH  +    F GGGKA G        +L KK+R+L L+ ALS K   +
Sbjct: 61  KKFGAQKGSGGARHGDRGAPIFIGGGKAHGARKRDFNQSLNKKIRALGLKMALSTK-AKD 119

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSN-ALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            ++V+D+L  KE KT+ L   F     +   L+IDG  ++  F+ AA N+  +N+LP  G
Sbjct: 120 GLVVLDSLELKEAKTQALKGHFDKHGFAGKVLVIDGESVNDGFKQAAGNLKGVNVLPAAG 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
            NVYDIL    L+L+K A+E LE RF
Sbjct: 180 ANVYDILNHDTLILTKDAVEKLEARF 205


>gi|326388198|ref|ZP_08209801.1| 50S ribosomal protein L4 [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326207364|gb|EGD58178.1| 50S ribosomal protein L4 [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 207

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 87/206 (42%), Positives = 121/206 (58%), Gaps = 2/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +++ V  LDG   G + +S+ +F L+P+  IL RV+ WQ   +R    K++ RS+VA TG
Sbjct: 1   MKVQVLTLDGTAAGDVELSDAVFGLEPRADILHRVVTWQLENRRGIARKARERSDVARTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K   QKG G ARH  +    F GGGKA GP       +L KKVR+L L+ ALS K    
Sbjct: 61  KKFGRQKGGGTARHGDRKAPVFIGGGKAHGPRVREFNISLNKKVRALGLKMALSAK-AKT 119

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLS-NALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            ++V+D L   + KTK LV +F         L++DG  ++  F  AARNI  +N+LP  G
Sbjct: 120 GLVVVDTLDLADAKTKVLVGKFAKAGFGKKVLVVDGEAVNEGFARAARNIVGVNVLPAIG 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
            NVYDIL+   LVL+++A+E LE RF
Sbjct: 180 ANVYDILKHDTLVLTRAAVEKLEARF 205


>gi|67458671|ref|YP_246295.1| 50S ribosomal protein L4 [Rickettsia felis URRWXCal2]
 gi|75536864|sp|Q4UMS8|RL4_RICFE RecName: Full=50S ribosomal protein L4
 gi|67004204|gb|AAY61130.1| 50S ribosomal protein L4 [Rickettsia felis URRWXCal2]
          Length = 207

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 86/201 (42%), Positives = 119/201 (59%), Gaps = 1/201 (0%)

Query: 8   NLDGEDKGVISVSEDIFALK-PQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYV 66
           +L  E+ G IS++EDIFA++  +  I+ +V+ WQ  +   G  K+K  SEV+ T  K + 
Sbjct: 7   SLANEEVGEISLNEDIFAVEFIRDDIIKQVIDWQRAKAMSGNHKTKTVSEVSGTTKKPFK 66

Query: 67  QKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVI 126
           QKGTG AR  S    Q RGGG A GP        LPKKVR L L HALS+KF    ++VI
Sbjct: 67  QKGTGNARQGSLRSVQMRGGGVAHGPRVRSHATKLPKKVRKLGLIHALSEKFAEGKLLVI 126

Query: 127 DNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDI 186
           D+L   + KT  LV         +  +IDG ++D NF LAA+NI N  ++P  G NVYDI
Sbjct: 127 DSLKLDKPKTSVLVNILNKFQGKSFFVIDGNEVDTNFSLAAKNIYNTVIVPQIGANVYDI 186

Query: 187 LRCSKLVLSKSAIEALEDRFK 207
           +R   ++LS+ A+  LE+R +
Sbjct: 187 IRHEYVLLSQEAVSVLEERLR 207


>gi|295398289|ref|ZP_06808331.1| ribosomal protein L4/L1 family protein [Aerococcus viridans ATCC
           11563]
 gi|294973428|gb|EFG49213.1| ribosomal protein L4/L1 family protein [Aerococcus viridans ATCC
           11563]
          Length = 207

 Score =  148 bits (374), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 123/204 (60%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +++   DG   G I++++++FA++P +  +  V+  Q    R G  K KGRSEV+  
Sbjct: 1   MANITLFKQDGSQAGEITLNDEVFAIEPNENAIYDVVIMQQASLRQGTHKVKGRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+ GGG+AFGP P    + LP+KVR LALR ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWVGGGRAFGPTPRSYAYKLPRKVRRLALRSALSTKVAE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+ +V+D L  +  KTK        L + N +++   + + N QL+ARN+PN+ ++    
Sbjct: 121 NNFIVVDELAFETPKTKLFQEVLNNLQVENKVLVVINKDNDNAQLSARNLPNVKVVDENN 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV+D++   K++++K+A+  +E+
Sbjct: 181 VNVFDLVNSEKVIITKAALSNVEE 204


>gi|330993847|ref|ZP_08317779.1| 50S ribosomal protein L4 [Gluconacetobacter sp. SXCC-1]
 gi|329759115|gb|EGG75627.1| 50S ribosomal protein L4 [Gluconacetobacter sp. SXCC-1]
          Length = 204

 Score =  148 bits (373), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 81/205 (39%), Positives = 118/205 (57%), Gaps = 2/205 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++  ++ LD    G  S+ ++IFA  P+  ILARV+ WQ  ++R G  K KG  E++ T 
Sbjct: 1   MDYEIKTLDNGSAGTASLPDEIFAATPRPDILARVVHWQLAKRRAGTHKVKGMGEISGTT 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K Y QKGTG AR  S    Q+R GG   GPV     + LPKKVR L L  ALS K    
Sbjct: 61  KKPYRQKGTGSARQGSLRSPQYRTGGVVHGPVVRDHGYDLPKKVRRLGLIFALSQKAAEG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++V+D   +   K+  L  + + L  ++ALI+D   ++ NF  AARN+P I++LP  G 
Sbjct: 121 KLVVLD-AATASGKSAELAKKLKVLGWTSALIVDAA-VEENFGRAARNLPKIDILPTIGA 178

Query: 182 NVYDILRCSKLVLSKSAIEALEDRF 206
           NVYDIL    L ++++ +E L++R 
Sbjct: 179 NVYDILNHDVLAITRAGVEGLKERL 203


>gi|296533988|ref|ZP_06896504.1| ribosomal protein L4/L1 family protein [Roseomonas cervicalis ATCC
           49957]
 gi|296265654|gb|EFH11763.1| ribosomal protein L4/L1 family protein [Roseomonas cervicalis ATCC
           49957]
          Length = 206

 Score =  147 bits (372), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 82/206 (39%), Positives = 120/206 (58%), Gaps = 2/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L V  LD    G I + + +FA  P+  I+ARV+ WQ  ++R G  K KG  EV+ T 
Sbjct: 1   MQLPVITLDNGQAGEIDLPDALFAAAPRADIMARVVHWQLAKRRAGTHKVKGMGEVSGTT 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K Y QKGTG AR  S    QFR GG   GPV     ++L KKVR L L  ALS K    
Sbjct: 61  KKPYRQKGTGNARQGSLRAPQFRTGGAVHGPVVRDHGYSLNKKVRRLGLISALSQKAAEG 120

Query: 122 DIMVIDN-LVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            ++V+D   +  + KT  + ++ +AL   +AL++D  Q++  F  A RN+ N+N+LP  G
Sbjct: 121 KLVVLDTAALGADAKTSAMASKVKALGWKSALVVD-AQVEDGFGRAVRNLKNVNVLPSMG 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
            NVYDIL+   L +++ A++AL++R 
Sbjct: 180 ANVYDILKHDVLAVTRQAVDALKERL 205


>gi|162149173|ref|YP_001603634.1| 50S ribosomal protein L4 [Gluconacetobacter diazotrophicus PAl 5]
 gi|209545083|ref|YP_002277312.1| 50S ribosomal protein L4 [Gluconacetobacter diazotrophicus PAl 5]
 gi|189029506|sp|A9H3R2|RL4_GLUDA RecName: Full=50S ribosomal protein L4
 gi|161787750|emb|CAP57346.1| 50S ribosomal protein L4 [Gluconacetobacter diazotrophicus PAl 5]
 gi|209532760|gb|ACI52697.1| ribosomal protein L4/L1e [Gluconacetobacter diazotrophicus PAl 5]
          Length = 204

 Score =  147 bits (372), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 80/205 (39%), Positives = 116/205 (56%), Gaps = 2/205 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++  ++ LD    G   + ++IF + P+  I+ARV+ WQ  ++R G  K KG  EV+ T 
Sbjct: 1   MDYEIKTLDNGSAGTAVLPDEIFGVTPRADIMARVVHWQLAKRRAGTHKVKGMGEVSGTT 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K Y QKGTG AR  S    Q+R GG   GPV     + LPKKVR L L  ALS K    
Sbjct: 61  KKPYRQKGTGSARQGSLRAPQYRTGGAVHGPVVRDHGYDLPKKVRRLGLISALSQKAAEG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++V+D   +   +T  L  + +AL   +ALI+D   ++ NF  AARN+P I+ LP  G 
Sbjct: 121 KLVVLD-AATASGRTSELAAKVKALGWKSALIVD-ATVEENFGRAARNLPKIDALPTIGA 178

Query: 182 NVYDILRCSKLVLSKSAIEALEDRF 206
           NVYDIL    L ++++ +E L++R 
Sbjct: 179 NVYDILNHDVLAITRAGVEGLKERL 203


>gi|58336631|ref|YP_193216.1| 50S ribosomal protein L4 [Lactobacillus acidophilus NCFM]
 gi|227903188|ref|ZP_04020993.1| 50S ribosomal protein L4 [Lactobacillus acidophilus ATCC 4796]
 gi|75433039|sp|Q5FM89|RL4_LACAC RecName: Full=50S ribosomal protein L4
 gi|58253948|gb|AAV42185.1| 50S ribosomal protein L4 [Lactobacillus acidophilus NCFM]
 gi|227868993|gb|EEJ76414.1| 50S ribosomal protein L4 [Lactobacillus acidophilus ATCC 4796]
          Length = 205

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 119/204 (58%), Gaps = 2/204 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  L V + +G+D G +++++ +F ++P   ++   +  Q   KR G SK K RS V   
Sbjct: 1   MANLKVMDQNGKDSGEVTLNDKVFGIEPNDNVVFEAIIRQRAGKRQGTSKVKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + +P+K R LA++  LS K   
Sbjct: 61  GKKPWRQKGTGRARQGSIRAPQWRGGGTVFGPTPRSYAYTMPRKQRRLAIKSVLSQKLID 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           ND++V+D L     KTK LV+   +L+    ++I     D N QL+ARN+  + ++PV G
Sbjct: 121 NDLIVLDKLTMSAPKTKELVSMLNSLNADGKVLI--VSDDNNVQLSARNLAKVKVVPVNG 178

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV D +   KL+L++ A++ +E+
Sbjct: 179 LNVEDAVNYGKLILTQDAVKKIEE 202


>gi|227879244|ref|ZP_03997114.1| 50S ribosomal protein L4 [Lactobacillus crispatus JV-V01]
 gi|256849182|ref|ZP_05554615.1| 50S ribosomal protein L4 [Lactobacillus crispatus MV-1A-US]
 gi|262047198|ref|ZP_06020156.1| 50S ribosomal protein L4/L1 [Lactobacillus crispatus MV-3A-US]
 gi|293380378|ref|ZP_06626449.1| 50S ribosomal protein L4 [Lactobacillus crispatus 214-1]
 gi|295692161|ref|YP_003600771.1| 50S ribosomal protein l4 [Lactobacillus crispatus ST1]
 gi|227861138|gb|EEJ68787.1| 50S ribosomal protein L4 [Lactobacillus crispatus JV-V01]
 gi|256713958|gb|EEU28946.1| 50S ribosomal protein L4 [Lactobacillus crispatus MV-1A-US]
 gi|260572443|gb|EEX29005.1| 50S ribosomal protein L4/L1 [Lactobacillus crispatus MV-3A-US]
 gi|290923061|gb|EFD99992.1| 50S ribosomal protein L4 [Lactobacillus crispatus 214-1]
 gi|295030267|emb|CBL49746.1| 50S ribosomal protein L4 [Lactobacillus crispatus ST1]
          Length = 205

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 118/204 (57%), Gaps = 2/204 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  L V + +G+D G +++++ +F ++P + ++   +  Q   KR G SK K RS V   
Sbjct: 1   MANLKVMDQNGKDSGEVTLNDKVFGIEPNESVVFEAIIRQRAGKRQGTSKVKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + +P+K R LA++  LS K   
Sbjct: 61  GKKPWRQKGTGRARQGSIRAPQWRGGGTVFGPTPRSYAYTMPRKQRRLAIKSVLSQKLID 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           ND++V+D L     KTK LV+    L+    ++I     D N QL+ARN+  + ++PV G
Sbjct: 121 NDLIVLDKLTMSAPKTKELVSMLNGLNADGKVLI--VSDDNNVQLSARNLTKVKVVPVNG 178

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV D +   KL+L + A++ +E+
Sbjct: 179 LNVEDAVNYGKLILDQDAVKKIEE 202


>gi|315037531|ref|YP_004031099.1| 50S ribosomal protein L4 [Lactobacillus amylovorus GRL 1112]
 gi|325956004|ref|YP_004286614.1| 50S ribosomal protein L4 [Lactobacillus acidophilus 30SC]
 gi|312275664|gb|ADQ58304.1| 50S ribosomal protein L4 [Lactobacillus amylovorus GRL 1112]
 gi|325332569|gb|ADZ06477.1| 50S ribosomal protein L4 [Lactobacillus acidophilus 30SC]
 gi|327182827|gb|AEA31274.1| 50S ribosomal protein L4 [Lactobacillus amylovorus GRL 1118]
          Length = 205

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 77/204 (37%), Positives = 118/204 (57%), Gaps = 2/204 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  L V + +G+D G +++++ +F ++P   ++   +  Q   KR G SK K RS V   
Sbjct: 1   MANLKVMDQNGKDSGEVTLNDKVFGIEPNDNVVFEAIIRQRAGKRQGTSKVKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + +P+K R LA++  LS K   
Sbjct: 61  GKKPWRQKGTGRARQGSIRAPQWRGGGTVFGPTPRSYAYTMPRKQRRLAIKSVLSQKLID 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           ND++V+D L     KTK LV+   +L+    ++I     D N QL+ARN+  +  +PV G
Sbjct: 121 NDLIVLDKLTMSAPKTKELVSMLNSLNADGKVLI--VTDDNNVQLSARNLAKVKAVPVNG 178

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV D +   KL+LS+ A++ +E+
Sbjct: 179 LNVEDAVNYGKLILSQDAVKKIEE 202


>gi|319654869|ref|ZP_08008944.1| 50S ribosomal protein L4 [Bacillus sp. 2_A_57_CT2]
 gi|317393432|gb|EFV74195.1| 50S ribosomal protein L4 [Bacillus sp. 2_A_57_CT2]
          Length = 207

 Score =  146 bits (369), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 81/204 (39%), Positives = 118/204 (57%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N  G   G I +++ IF ++P Q +L   +  Q    R G  K+K RSEVA  
Sbjct: 1   MPKVALFNQSGSKVGDIELNDAIFGIEPNQHVLFEAIVMQRASLRQGTHKTKIRSEVAGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGPVP    + LPKKVR LA++ ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGTVFGPVPRSYSYKLPKKVRRLAIKSALSSKVLE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            +I+V++ L  +  KTK        L + +  +I    LD N  L+ARNIP + ++   G
Sbjct: 121 ENILVLEGLAFETPKTKDFKGVLTGLSVDSKALIVTADLDENVALSARNIPGVTVVSASG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           I V D+L   KL+++K+A+E +E+
Sbjct: 181 ITVLDVLNHDKLIMTKAAVEKVEE 204


>gi|85374464|ref|YP_458526.1| 50S ribosomal protein L4 [Erythrobacter litoralis HTCC2594]
 gi|122544174|sp|Q2N9B2|RL4_ERYLH RecName: Full=50S ribosomal protein L4
 gi|84787547|gb|ABC63729.1| ribosomal protein L4 [Erythrobacter litoralis HTCC2594]
          Length = 207

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 83/206 (40%), Positives = 124/206 (60%), Gaps = 2/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +++ V+ +DG+  G + + + +F ++P+  IL RV+ WQ   +R     ++ RS+VA TG
Sbjct: 1   MKVKVQKIDGKAAGDVELDDAVFGVEPRADILHRVVTWQLENRRGTARPTRERSDVARTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +K   QKG+G ARH  +    F GGGKA G        +L KK+R+L L+ ALS K   +
Sbjct: 61  AKFGRQKGSGNARHGDRGAPIFIGGGKAHGARKRDFNPSLNKKIRALGLKMALSSK-AKD 119

Query: 122 DIMVIDNLVSKECKTKYLVTRF-RALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            ++V+D+L  K+ KTK L   F +A      L+IDG  ++  F  AA N+P +N+LP  G
Sbjct: 120 GLVVVDSLDLKDAKTKVLKGHFDKAGWNGKVLVIDGESVNEGFSKAAGNLPGVNVLPAMG 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
            NVYDIL+   LVL+K A+E LE RF
Sbjct: 180 ANVYDILKHDTLVLTKDAVEKLEARF 205


>gi|294496986|ref|YP_003560686.1| 50S ribosomal protein L4 [Bacillus megaterium QM B1551]
 gi|294346923|gb|ADE67252.1| 50S ribosomal protein L4 [Bacillus megaterium QM B1551]
          Length = 207

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 79/204 (38%), Positives = 120/204 (58%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N +GE+ G I + + +F ++P   +L   +  Q   +R G SK K RSEV   
Sbjct: 1   MPKVALFNQNGENVGEIELQDAVFGIEPNNKVLFDAIVMQRASQRQGTSKVKNRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGPVP    + LPKKVR LA++ ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPVPRSYSYKLPKKVRRLAIKSALSTKVQD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N I+V++ L     KTK +V   + L +    ++    L+ N  L+ARNIP + ++   G
Sbjct: 121 NSIVVLEALSFDAPKTKEMVAVLKNLTVERKALVVTADLNENVALSARNIPGVTVVAANG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           ++V D++   KLV++K A+E +E+
Sbjct: 181 LSVLDVMNHDKLVITKDAVEKVEE 204


>gi|218779761|ref|YP_002431079.1| 50S ribosomal protein L4 [Desulfatibacillum alkenivorans AK-01]
 gi|226730651|sp|B8FET4|RL4_DESAA RecName: Full=50S ribosomal protein L4
 gi|218761145|gb|ACL03611.1| ribosomal protein L4/L1e [Desulfatibacillum alkenivorans AK-01]
          Length = 206

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 119/206 (57%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ V N+ GE    I ++++IF ++ +  +L  V+  Q   +R G    K RS+V  +
Sbjct: 1   MAKVEVCNMSGEKVSEIDLADEIFGVEVKGSVLHEVVVMQLANRRAGTVCVKNRSDVRGS 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
             K+Y QKGTGRAR         RGGG  FGP P    + +PKKVR  AL+ ALS K   
Sbjct: 61  TRKLYRQKGTGRARKGDIKSPVLRGGGVVFGPHPRDYSYKVPKKVRKAALKMALSSKLAD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N + V+DN+   E KTK       A+ +  ALI+   + ++N +L+ARN+  + ++P  G
Sbjct: 121 NSLKVVDNMDLPEIKTKAFAEAMAAMGVDTALIVTTGE-EKNLELSARNVKGVKVMPTAG 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVYDIL+   L+L++ AIEA+E R 
Sbjct: 180 LNVYDILKYGNLILAQGAIEAIEGRL 205


>gi|241889133|ref|ZP_04776437.1| ribosomal protein, L4/L1 family [Gemella haemolysans ATCC 10379]
 gi|241864382|gb|EER68760.1| ribosomal protein, L4/L1 family [Gemella haemolysans ATCC 10379]
          Length = 207

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 77/200 (38%), Positives = 112/200 (56%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +L +   DG   G +  +E +F ++P Q +L + +  Q    R G  K+KGRSEV+  
Sbjct: 1   MPQLDLFKQDGTKVGAVEANEAVFGIEPNQHVLFQAVTLQRASLRQGTHKTKGRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P      +P+K+R LALR ALS K  +
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGIVFGPTPRSYSFKMPRKMRRLALRSALSSKVAA 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N++  +++L     KTK        L L   ++    +L+ N  L+ RNIP +  +   G
Sbjct: 121 NEVFALESLSFDTIKTKNFKEMLSNLSLEKKVLFVVTELEENTVLSGRNIPGVEFVETTG 180

Query: 181 INVYDILRCSKLVLSKSAIE 200
           +NV DILR +K+V +K A+E
Sbjct: 181 LNVLDILRSNKVVFTKDAVE 200


>gi|169830029|ref|YP_001700187.1| 50S ribosomal protein L4 [Lysinibacillus sphaericus C3-41]
 gi|226730684|sp|B1HMX9|RL4_LYSSC RecName: Full=50S ribosomal protein L4
 gi|168994517|gb|ACA42057.1| 50S ribosomal protein L4 [Lysinibacillus sphaericus C3-41]
          Length = 207

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 84/204 (41%), Positives = 113/204 (55%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++SV +  G   G I +++ IF ++P + +L   +  Q    R G  K K RSEVA  
Sbjct: 1   MTKVSVLSQTGASVGEIELNDAIFGIEPNEAVLFDAVVAQRASLRQGNHKVKNRSEVAGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LPKKVR LAL+ ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGIVFGPTPRSYSYKLPKKVRRLALKSALSAKVVE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            + +V+D L     KTK      + L L    +     LD N  L+ARNIP + +L   G
Sbjct: 121 QNFLVLDALTLAAPKTKEFTKILKDLSLEKKSLFVTADLDENVALSARNIPGVTVLTANG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           INV D+L   K+V +KSA+E +E+
Sbjct: 181 INVLDLLGHEKVVFTKSAVEKVEE 204


>gi|256844430|ref|ZP_05549916.1| 50S ribosomal protein L4/L1 [Lactobacillus crispatus 125-2-CHN]
 gi|256613508|gb|EEU18711.1| 50S ribosomal protein L4/L1 [Lactobacillus crispatus 125-2-CHN]
          Length = 205

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 118/204 (57%), Gaps = 2/204 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  L V + +G+D G +++++ +F ++P + ++   +  Q   KR G SK K RS V   
Sbjct: 1   MANLKVMDQNGKDSGEVTLNDKVFGIEPNESVVFEAIIRQRAGKRQGTSKVKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + +P+K R LA++  LS K   
Sbjct: 61  GKKPWRQKGTGRARQGSIRAPQWRGGGTVFGPTPRSYAYTMPRKQRRLAIKSVLSRKLID 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           ND++V+D L     KTK LV+    L+    ++I     D N QL+ARN+  + ++PV G
Sbjct: 121 NDLIVLDKLTMSAPKTKELVSILNGLNADGKVLI--VSDDNNVQLSARNLTKVKVVPVNG 178

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV D +   KL+L + A++ +E+
Sbjct: 179 LNVEDAVNYGKLILDQDAVKKIEE 202


>gi|295702351|ref|YP_003595426.1| 50S ribosomal protein L4 [Bacillus megaterium DSM 319]
 gi|294800010|gb|ADF37076.1| 50S ribosomal protein L4 [Bacillus megaterium DSM 319]
          Length = 207

 Score =  145 bits (366), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 79/204 (38%), Positives = 120/204 (58%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N +GE+ G I + + +F ++P   +L   +  Q   +R G SK K RSEV   
Sbjct: 1   MPKVALFNQNGENVGEIELQDAVFGIEPNNKVLFDAIVMQRASQRQGTSKVKNRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGPVP    + LPKKVR LA++ ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPVPRSYSYKLPKKVRRLAIKSALSTKAQD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N I+V++ L     KTK +V   + L +    ++    L+ N  L+ARNIP + ++   G
Sbjct: 121 NSIVVLEALSFDAPKTKEMVAVLKNLTVERKALVVTADLNENVALSARNIPGVTVVAANG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           ++V D++   KLV++K A+E +E+
Sbjct: 181 LSVLDVMNHDKLVITKDAVEKVEE 204


>gi|299541933|ref|ZP_07052256.1| 50S ribosomal protein L4 [Lysinibacillus fusiformis ZC1]
 gi|298725671|gb|EFI66312.1| 50S ribosomal protein L4 [Lysinibacillus fusiformis ZC1]
          Length = 207

 Score =  145 bits (366), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 84/204 (41%), Positives = 113/204 (55%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++SV +  G   G I +++ IF ++P + +L   +  Q    R G  K K RSEVA  
Sbjct: 1   MTKVSVLSQTGASVGEIELNDAIFGIEPNEAVLFDAVVAQRASLRQGNHKVKNRSEVAGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LPKKVR LAL+ ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGIVFGPTPRSYSYKLPKKVRRLALKSALSAKVVE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            + +V+D L     KTK      + L L    +     LD N  L+ARNIP + +L   G
Sbjct: 121 QNFLVLDALTLAAPKTKEFTKILKDLSLEKKSLFVTADLDENVALSARNIPGVTVLTANG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           INV D+L   K+V +KSA+E +E+
Sbjct: 181 INVLDLLGHDKVVFTKSAVEKVEE 204


>gi|251799641|ref|YP_003014372.1| ribosomal protein L4/L1e [Paenibacillus sp. JDR-2]
 gi|247547267|gb|ACT04286.1| ribosomal protein L4/L1e [Paenibacillus sp. JDR-2]
          Length = 207

 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 115/206 (55%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +++V N+ G + G I +++ +F ++P   +L   +  Q   +R G  K+KGRSEV   
Sbjct: 1   MPKVTVFNVSGSEVGEIELADSVFGIEPNSHVLHSAVLLQQAAERAGTHKTKGRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+ GGG  FGP P      LPKKVR LA++ ALS K  +
Sbjct: 61  GRKPWKQKGTGRARQGSIRSPQWVGGGTVFGPTPRSYGFKLPKKVRRLAIKSALSSKVIA 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+I+V+D L     KTK        L      ++     D N  L+ARNIP +  +   G
Sbjct: 121 NEIVVLDQLTFAAPKTKEFAAILNNLKADRKALVVLPAYDDNVALSARNIPGVKFVAADG 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INV D+L   KL+++K A+E +++ F
Sbjct: 181 INVLDVLVHDKLIITKEAVEKVQEVF 206


>gi|242032629|ref|XP_002463709.1| hypothetical protein SORBIDRAFT_01g004650 [Sorghum bicolor]
 gi|241917563|gb|EER90707.1| hypothetical protein SORBIDRAFT_01g004650 [Sorghum bicolor]
          Length = 294

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 79/202 (39%), Positives = 118/202 (58%), Gaps = 1/202 (0%)

Query: 6   VRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMY 65
           V N   EDKG + +  D+F +  ++ I+ RV+RWQ  +++ G   +K  SEV+ TG K Y
Sbjct: 87  VTNFHNEDKGFMVLDGDVFDVPIRKDIVHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY 146

Query: 66  VQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMV 125
            QKGTGRARH +    QFRGG    GP P      L KKVR L L+ ALS +     ++V
Sbjct: 147 KQKGTGRARHGTLRGPQFRGGATMHGPKPRSHAIKLQKKVRRLGLKIALSARTAEGKLLV 206

Query: 126 IDNLVSKECKTKYLVTRFRAL-DLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVY 184
            ++L     KTK +V   R + D    L++DG  +D+  +LA +N+  +N+LP  G+NVY
Sbjct: 207 FEDLEVPSHKTKNIVQYIRQMDDTKKVLLVDGGDIDKKLKLATQNLHYVNVLPSIGLNVY 266

Query: 185 DILRCSKLVLSKSAIEALEDRF 206
            IL+   LV++++AI  + +R 
Sbjct: 267 SILQHDTLVMTRAAINRIVERM 288


>gi|242072798|ref|XP_002446335.1| hypothetical protein SORBIDRAFT_06g014470 [Sorghum bicolor]
 gi|241937518|gb|EES10663.1| hypothetical protein SORBIDRAFT_06g014470 [Sorghum bicolor]
          Length = 333

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 80/202 (39%), Positives = 118/202 (58%), Gaps = 1/202 (0%)

Query: 6   VRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMY 65
           V N   EDKG + +  D+F +  ++ I+ RV+RWQ  +++ G   +K  SEV+ TG K Y
Sbjct: 126 VTNFHNEDKGFMVLDGDVFDVPIRKDIVHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY 185

Query: 66  VQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMV 125
            QKGTGRARH +    QFRGG    GP P      L KKVR L L+ ALS +     ++V
Sbjct: 186 KQKGTGRARHGTLRGPQFRGGATMHGPKPRSHAIKLQKKVRRLGLKIALSARTAEGKLLV 245

Query: 126 IDNLVSKECKTKYLVTRFRAL-DLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVY 184
            ++L     KTK +V   R + D    L++DG  +D+  +LA +N+  +N+LP  G+NVY
Sbjct: 246 FEDLEVPSHKTKNIVQYIRQMDDTKKVLLVDGGDIDKKLKLATQNLHYVNVLPSIGLNVY 305

Query: 185 DILRCSKLVLSKSAIEALEDRF 206
            IL+   LV+S++AI  + +R 
Sbjct: 306 SILQHDTLVMSRAAINRIVERM 327


>gi|296131837|ref|YP_003639084.1| ribosomal protein L4/L1e [Thermincola sp. JR]
 gi|296030415|gb|ADG81183.1| ribosomal protein L4/L1e [Thermincola potens JR]
          Length = 206

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 121/204 (59%), Gaps = 1/204 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N+ GE  G I + +++F ++P +G++  V+  Q   +R+G + +K R+EV+  
Sbjct: 1   MPKVALYNIKGEQVGEIELKDEVFGIEPNEGLVHDVVVMQLANRRVGTASTKTRAEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRARH S     +RGGG  FGP P    + +PKK R LAL+  LS K   
Sbjct: 61  GRKPWRQKGTGRARHGSIRSPIWRGGGITFGPKPRSFNYTMPKKARRLALKSVLSSKVSD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            +I+V+D L   + KTK +      L    A+++    +D+N   +ARNIP +  L   G
Sbjct: 121 GNIIVLDTLEMAQPKTKEMAEILNRLKAKKAVVVT-ADVDQNVIKSARNIPGVTPLTASG 179

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NVYD++   KLV++K A+  +E+
Sbjct: 180 LNVYDLVNHEKLVITKDAVAKVEE 203


>gi|253577180|ref|ZP_04854500.1| 50S ribosomal protein L4/L1 [Paenibacillus sp. oral taxon 786 str.
           D14]
 gi|251843424|gb|EES71452.1| 50S ribosomal protein L4/L1 [Paenibacillus sp. oral taxon 786 str.
           D14]
          Length = 207

 Score =  144 bits (363), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 112/204 (54%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N+ G   G + +++ +F ++P   +L   +  Q    R G  K KGRSEV   
Sbjct: 1   MPKVALFNISGSQVGEVELNDAVFGIEPNTHVLHEAVVMQRASLRFGTHKVKGRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q++GGG  FGP P    + LPKKVR LA++ ALS K   
Sbjct: 61  GRKPWKQKGTGRARQGSIRAPQWKGGGTVFGPTPRSYSYKLPKKVRRLAIKSALSSKVID 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            DI+V+D L     KTK        L +    ++     D N  L+ARNIP +  +   G
Sbjct: 121 QDIIVLDALAMNAPKTKEFAAILNNLKVERKALVVAPDYDDNIALSARNIPGVKFVAADG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           INV D+L   KL+++K A++ +E+
Sbjct: 181 INVLDVLTHDKLIITKEAVQKVEE 204


>gi|158520726|ref|YP_001528596.1| ribosomal protein L4/L1e [Desulfococcus oleovorans Hxd3]
 gi|226730653|sp|A8ZV58|RL4_DESOH RecName: Full=50S ribosomal protein L4
 gi|158509552|gb|ABW66519.1| ribosomal protein L4/L1e [Desulfococcus oleovorans Hxd3]
          Length = 205

 Score =  144 bits (363), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 123/207 (59%), Gaps = 4/207 (1%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + ++N++GE      + + IF ++ +  +L  V++ Q  R+R G + +KGRS+VA +
Sbjct: 1   MAVVDIKNMNGETVSQAELPDSIFDVEVKSSVLHEVVKMQLARRRSGTASTKGRSDVAGS 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
            +K++ QKGTGRAR         +GGG  FGP P    +++PKKVR LAL+ AL+ K   
Sbjct: 61  RAKLFRQKGTGRARRGDVKSPLLKGGGVVFGPHPRSFDYSVPKKVRKLALKMALTSKLRD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALII-DGCQLDRNFQLAARNIPNINLLPVQ 179
           N + V+D       KTK  V    AL  +NAL+I DG +     + +ARN+P + +L  +
Sbjct: 121 NTLTVVDQFRFDRIKTKDFVGAINALGAANALVISDGSE---TLEKSARNVPKVKVLKCE 177

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRF 206
           G+NVYDIL+   LVL ++AI+ +E R 
Sbjct: 178 GLNVYDILKYKNLVLPEAAIKMIEGRL 204


>gi|239948318|ref|ZP_04700071.1| ribosomal protein L4/L1 family protein [Rickettsia endosymbiont of
           Ixodes scapularis]
 gi|241563414|ref|XP_002401694.1| ribosomal protein L4, putative [Ixodes scapularis]
 gi|215501886|gb|EEC11380.1| ribosomal protein L4, putative [Ixodes scapularis]
 gi|239922594|gb|EER22618.1| ribosomal protein L4/L1 family protein [Rickettsia endosymbiont of
           Ixodes scapularis]
          Length = 207

 Score =  144 bits (363), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 85/201 (42%), Positives = 118/201 (58%), Gaps = 1/201 (0%)

Query: 8   NLDGEDKGVISVSEDIFALK-PQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYV 66
           +L  E+ G IS++EDIFA++  +  I+ +V+ WQ  +   G  K+K  SEV+ T  K + 
Sbjct: 7   SLANEEVGEISLNEDIFAVEFIRDDIIKQVIDWQRAKAMSGNHKTKTVSEVSGTTKKPFK 66

Query: 67  QKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVI 126
           QKGTG AR  S    Q RGGG A GP        LPKKVR L L HALS+KF    ++VI
Sbjct: 67  QKGTGNARQGSLRSVQMRGGGVAHGPRVRSHATKLPKKVRKLGLIHALSEKFAEGKLLVI 126

Query: 127 DNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDI 186
           D+L   + KT  LV         +  +ID  ++D NF LAA+NI N  ++P  G NVYDI
Sbjct: 127 DSLKLDKPKTSALVNILNKFQGKSFFVIDRNEVDINFSLAAKNIYNTVIVPQIGANVYDI 186

Query: 187 LRCSKLVLSKSAIEALEDRFK 207
           +R   ++LS+ A+  LE+R +
Sbjct: 187 IRHEYVLLSQEAVSVLEERLR 207


>gi|329768274|ref|ZP_08259775.1| 50S ribosomal protein L4 [Gemella haemolysans M341]
 gi|328837473|gb|EGF87102.1| 50S ribosomal protein L4 [Gemella haemolysans M341]
          Length = 207

 Score =  144 bits (362), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 77/200 (38%), Positives = 111/200 (55%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +L +   DG   G +  SE +F ++P Q +L + +  Q    R G  K+KGRSEV+  
Sbjct: 1   MPQLDLFKQDGTKVGAVEASEAVFGIEPNQHVLFQAVTLQRASLRQGTHKTKGRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P      +P+K+R LALR ALS K  +
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGIVFGPTPRSYSFKMPRKMRRLALRSALSSKVAA 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N++  +++L     KTK        L L   ++    +L+ N  L+ RNIP +  +   G
Sbjct: 121 NEVFALESLSFDTIKTKNFKEMLSNLSLEKKVLFVVTELEENTVLSGRNIPGVEFVETTG 180

Query: 181 INVYDILRCSKLVLSKSAIE 200
           +NV DIL  +K+V +K A+E
Sbjct: 181 LNVLDILGSNKVVFTKDAVE 200


>gi|161506874|ref|YP_001576828.1| 50S ribosomal protein L4 [Lactobacillus helveticus DPC 4571]
 gi|172048368|sp|A8YXK6|RL4_LACH4 RecName: Full=50S ribosomal protein L4
 gi|160347863|gb|ABX26537.1| 50S ribosomal protein L4 [Lactobacillus helveticus DPC 4571]
          Length = 205

 Score =  144 bits (362), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 119/204 (58%), Gaps = 2/204 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  L V + +G+D G +++++ +F ++P + ++   +  Q   KR G SK K RS V   
Sbjct: 1   MANLKVMDQNGKDSGEVTLNDKVFGIEPNESVVFETIIRQRAGKRQGTSKVKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + +P+K R LA++  LS K   
Sbjct: 61  GKKPWRQKGTGRARQGSIRSPQWRGGGTVFGPTPRSYAYTMPRKQRRLAIKSVLSQKMID 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            D++V+D L     KTK LV+   +L++   ++I     D N QL+ARN+  +  +PV G
Sbjct: 121 KDLIVLDKLAMSAPKTKDLVSMLNSLNVDGKVLI--VSDDNNVQLSARNLAKVKAVPVNG 178

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV D +   KL+L++ A++ +E+
Sbjct: 179 LNVEDAVNYGKLILTQDAVKKIEE 202


>gi|226491762|ref|NP_001147335.1| LOC100280943 [Zea mays]
 gi|195610184|gb|ACG26922.1| 50S ribosomal protein L4 [Zea mays]
          Length = 293

 Score =  144 bits (362), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 78/202 (38%), Positives = 120/202 (59%), Gaps = 1/202 (0%)

Query: 6   VRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMY 65
           V N   EDKG + +  D+F +  ++ I+ RV+RWQ  +++ G   +K  SEV+ TG K Y
Sbjct: 86  VTNFHNEDKGFMVLDGDVFDVPIRKDIVHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY 145

Query: 66  VQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMV 125
            QKGTG+ARH +   +QFRGG    GP P      L KKVR L L+ ALS +     +++
Sbjct: 146 PQKGTGKARHGTLRGAQFRGGATMHGPKPRSHAIKLQKKVRRLGLKIALSARTAEGKLLI 205

Query: 126 IDNLVSKECKTKYLVTRFRALDLS-NALIIDGCQLDRNFQLAARNIPNINLLPVQGINVY 184
            ++L     KTK +V   R +D S   L++DG  +D+  +LA +N+  +N+LP  G+NVY
Sbjct: 206 FEDLEVPSHKTKNIVQYIRQMDDSKKVLLVDGGDIDKKLKLATQNLHYVNVLPSIGLNVY 265

Query: 185 DILRCSKLVLSKSAIEALEDRF 206
            IL+   LV++++AI  + +R 
Sbjct: 266 SILQHDTLVMTRAAINRIVERM 287


>gi|260102356|ref|ZP_05752593.1| 50S ribosomal protein L4 [Lactobacillus helveticus DSM 20075]
 gi|260083800|gb|EEW67920.1| 50S ribosomal protein L4 [Lactobacillus helveticus DSM 20075]
 gi|328463365|gb|EGF35038.1| 50S ribosomal protein L4 [Lactobacillus helveticus MTCC 5463]
          Length = 205

 Score =  144 bits (362), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 119/204 (58%), Gaps = 2/204 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  L V + +G+D G +++++ +F ++P + ++   +  Q   KR G SK K RS V   
Sbjct: 1   MANLKVMDQNGKDSGEVTLNDKVFGIEPNESVVFEAIIRQRAGKRQGTSKVKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + +P+K R LA++  LS K   
Sbjct: 61  GKKPWRQKGTGRARQGSIRSPQWRGGGTVFGPTPRSYAYTMPRKQRRLAIKSVLSQKMID 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            D++V+D L     KTK LV+   +L++   ++I     D N QL+ARN+  +  +PV G
Sbjct: 121 KDLIVLDKLAMSAPKTKDLVSMLNSLNVDGKVLI--VSDDNNVQLSARNLAKVKAVPVNG 178

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV D +   KL+L++ A++ +E+
Sbjct: 179 LNVEDAVNYGKLILTQDAVKKIEE 202


>gi|323465825|gb|ADX69512.1| 50S ribosomal protein L4 [Lactobacillus helveticus H10]
          Length = 205

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 119/204 (58%), Gaps = 2/204 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  L V + +G+D G +++++ +F ++P + ++   +  Q   KR G SK K RS V   
Sbjct: 1   MANLKVMDQNGKDSGEVTLNDKVFGIEPNESVVFETVIRQRAGKRQGTSKVKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + +P+K R LA++  LS K   
Sbjct: 61  GKKPWRQKGTGRARQGSIRSPQWRGGGTVFGPTPRSYAYTMPRKQRRLAIKSVLSQKMID 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            D++V+D L     KTK LV+   +L++   ++I     D N QL+ARN+  +  +PV G
Sbjct: 121 KDLIVLDKLAMSAPKTKDLVSMLNSLNVDGKVLI--VSDDNNVQLSARNLAKVKAVPVNG 178

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV D +   KL+L++ A++ +E+
Sbjct: 179 LNVEDAVNYGKLILTQDAVKKIEE 202


>gi|319938506|ref|ZP_08012900.1| 50S ribosomal protein L4 [Coprobacillus sp. 29_1]
 gi|319806422|gb|EFW03089.1| 50S ribosomal protein L4 [Coprobacillus sp. 29_1]
          Length = 207

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 124/206 (60%), Gaps = 4/206 (1%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQ-QGILARVL-RWQSWRKRIGCSKSKGRSEVA 58
           M++++V N +G+      ++E +F ++P  Q I   VL +  SWR+  G  K K R+EV 
Sbjct: 1   MLKVAVYNQEGKQVKDTELNELVFGIEPNNQAIFDMVLLQRASWRQ--GTHKVKNRTEVR 58

Query: 59  YTGSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKF 118
             G K + QKGTGRAR  S    Q+RGGG  FGP P      L +KVR LAL+ ALS K 
Sbjct: 59  GGGRKPWRQKGTGRARQGSIRAPQWRGGGVVFGPTPRSYTFKLNRKVRQLALKSALSQKV 118

Query: 119 CSNDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPV 178
             N++ V+D +     KTK ++     L+ +   +I   +++ N  L+ARNIP + ++  
Sbjct: 119 IDNEMTVLDTITLNAPKTKDMIKVLENLEANRKTLIVMDEVNENVTLSARNIPGVKVIDS 178

Query: 179 QGINVYDILRCSKLVLSKSAIEALED 204
           +G+NVYDIL C+KLV+++ AI+A+E+
Sbjct: 179 KGLNVYDILDCTKLVITEGAIKAVEE 204


>gi|304405615|ref|ZP_07387274.1| ribosomal protein L4/L1e [Paenibacillus curdlanolyticus YK9]
 gi|304345654|gb|EFM11489.1| ribosomal protein L4/L1e [Paenibacillus curdlanolyticus YK9]
          Length = 207

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 117/204 (57%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N+ G   G + +++ +F ++P   +L   +  Q   +R G  K+KGRSEV   
Sbjct: 1   MPKVALYNVSGSQVGEVELADSVFGIQPNTHVLHSAVLLQQAAERRGTHKTKGRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+ GGG  FGP P      LP+KVR LA++ ALS K  S
Sbjct: 61  GRKPWKQKGTGRARQGSIRSPQWVGGGTVFGPTPRSYGFKLPRKVRRLAIKSALSTKVIS 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+I+V+D L     KTK        L ++   ++     + N  L+ARNIP +  +  +G
Sbjct: 121 NEIVVLDQLALATPKTKEFAAILNNLKVARKALVVTANYEDNVALSARNIPGVKFVAAEG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           INV D+L+  +L+++K A+E +++
Sbjct: 181 INVLDVLQYDRLIITKEAVEKVQE 204


>gi|56961933|ref|YP_173655.1| 50S ribosomal protein L4 [Bacillus clausii KSM-K16]
 gi|81601105|sp|Q5WLR1|RL4_BACSK RecName: Full=50S ribosomal protein L4
 gi|56908167|dbj|BAD62694.1| 50S ribosomal protein L4 [Bacillus clausii KSM-K16]
          Length = 207

 Score =  143 bits (360), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 77/204 (37%), Positives = 120/204 (58%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++S+ N  G   G I +++++F ++P + +L   +  Q    R G  K+KGRSEV   
Sbjct: 1   MPKVSLFNQTGSQVGEIELADNVFGVEPNESVLHDAVVMQQASLRQGTHKTKGRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+ GGG  FGP P    + LPKKVR LA++ ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWVGGGVVFGPTPRSYSYKLPKKVRRLAIKSALSSKVKD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           ++++V+D+L  +  KTK +     +L + +  ++     + N  L+ARN+P I  L   G
Sbjct: 121 SELVVLDDLKLEAIKTKAMKDVLASLSVDSKALVVTADYNENVALSARNLPGITFLTADG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV D+L+  KLV++K A+E +E+
Sbjct: 181 VNVLDLLKHDKLVITKDAVEKVEE 204


>gi|218659827|ref|ZP_03515757.1| 50S ribosomal protein L4 [Rhizobium etli IE4771]
          Length = 117

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 87/106 (82%)

Query: 102 PKKVRSLALRHALSDKFCSNDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDR 161
           PKKVR+L +R ALS K  ++D++VIDNLV+ E KTK L + F  L L+NAL I G +LD 
Sbjct: 12  PKKVRALGIRDALSAKIKADDVIVIDNLVAAEAKTKALASAFETLGLTNALFIGGAELDG 71

Query: 162 NFQLAARNIPNINLLPVQGINVYDILRCSKLVLSKSAIEALEDRFK 207
           NF+LAA+NIPNI++LP+QGINVYDI+R  KLVLSK+A+EALE+RFK
Sbjct: 72  NFKLAAQNIPNIDVLPIQGINVYDIVRRGKLVLSKAAVEALEERFK 117


>gi|227894521|ref|ZP_04012326.1| 50S ribosomal protein L4 [Lactobacillus ultunensis DSM 16047]
 gi|227863680|gb|EEJ71101.1| 50S ribosomal protein L4 [Lactobacillus ultunensis DSM 16047]
          Length = 205

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 118/204 (57%), Gaps = 2/204 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  L V + +G+D G +++++ +F ++P   ++   +  Q   KR G SK K RS V   
Sbjct: 1   MANLKVMDQNGKDSGEVTLNDKVFGIEPNDSVVFEAIIRQRAGKRQGTSKVKNRSVVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + +P+K R LA++  LS K   
Sbjct: 61  GKKPWRQKGTGRARQGSIRAPQWRGGGTVFGPTPRSYAYTMPRKQRRLAIKSVLSQKLID 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            D++V+D L     KTK LV+   +L+    ++I     D N QL+ARN+  + ++PV G
Sbjct: 121 KDLIVLDKLTMSAPKTKELVSMLSSLNADGKVLI--VSDDNNVQLSARNLTKVKVVPVNG 178

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV D +   KL+L++ A++ +E+
Sbjct: 179 LNVEDAVNYGKLILTQDAVKKIEE 202


>gi|229542202|ref|ZP_04431262.1| ribosomal protein L4/L1e [Bacillus coagulans 36D1]
 gi|229326622|gb|EEN92297.1| ribosomal protein L4/L1e [Bacillus coagulans 36D1]
          Length = 207

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 77/200 (38%), Positives = 117/200 (58%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N +G   G + +++ +F ++P + +L   +  Q    R G  K KGRSEV   
Sbjct: 1   MPKVALYNQNGSQVGEVELNDAVFGIEPNEHVLFEAIIMQRASLRQGTHKVKGRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGPVP    + LPKKVR LA++ ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRAPQWRGGGTVFGPVPRSYSYKLPKKVRRLAIKSALSSKVRE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+I+V+D L     KTK  +   + L +    ++    L+ N  L+ARNIP I ++   G
Sbjct: 121 NNILVLDALNFDAPKTKDFIAVLKNLSVDKKALVVTDGLNENVVLSARNIPGITVVEATG 180

Query: 181 INVYDILRCSKLVLSKSAIE 200
           +NV D++   +L+++KSA+E
Sbjct: 181 VNVLDVVNHDQLIMTKSAVE 200


>gi|114764143|ref|ZP_01443381.1| 50S ribosomal protein L4 [Pelagibaca bermudensis HTCC2601]
 gi|114543295|gb|EAU46311.1| 50S ribosomal protein L4 [Roseovarius sp. HTCC2601]
          Length = 177

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 109/176 (61%), Gaps = 1/176 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L V  LDG   G + ++++IF L+P+  IL RV+RWQ  + + G  K K RSEV+Y+ 
Sbjct: 1   MKLDVIKLDGGAAGEVELTDEIFDLEPRADILHRVVRWQRNKAQAGTHKVKTRSEVSYST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG ARH S+    FR GG   GP P    H LPKKVR L L+ ALS K  + 
Sbjct: 61  KKIYRQKGTGGARHGSRKAPIFRKGGIYKGPTPRSHAHDLPKKVRQLGLKLALSAKAKAG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLP 177
            +++I+N    + KTK L ++ + L    AL+IDG +++ NF  AA NI  +++LP
Sbjct: 121 SLVIIEN-ADADGKTKTLASQVKNLGWKRALVIDGAEVNENFARAAANIDGLDVLP 175


>gi|238650971|ref|YP_002916827.1| 50S ribosomal protein L4 [Rickettsia peacockii str. Rustic]
 gi|259491568|sp|C4K2H8|RL4_RICPU RecName: Full=50S ribosomal protein L4
 gi|238625069|gb|ACR47775.1| 50S ribosomal protein L4 [Rickettsia peacockii str. Rustic]
          Length = 207

 Score =  142 bits (358), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 85/203 (41%), Positives = 118/203 (58%), Gaps = 1/203 (0%)

Query: 6   VRNLDGEDKGVISVSEDIFALK-PQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKM 64
           + +L  E+ G IS++EDIFA++  +  I+ +V+ WQ  +   G  K+K  SEV  T  K 
Sbjct: 5   ILSLANEEVGEISLNEDIFAVEFIRDDIIKQVIDWQRAKAMSGNHKTKTVSEVLGTTKKP 64

Query: 65  YVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIM 124
           + QKGTG AR  S    Q RGGG A GP        LPKKVR L L HALS+K     ++
Sbjct: 65  FKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHATKLPKKVRKLGLIHALSEKCAEGKLL 124

Query: 125 VIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVY 184
           VID+L   + KT  LV         +  +IDG ++D NF LAA+NI N  ++P  G NVY
Sbjct: 125 VIDSLKLDKPKTSVLVNILNKFQGKSFFVIDGNEVDINFSLAAKNIYNTVIVPQIGANVY 184

Query: 185 DILRCSKLVLSKSAIEALEDRFK 207
           DI+R   ++LS+ A+  LE+R +
Sbjct: 185 DIIRHEYVLLSQEAVSVLEERLR 207


>gi|15892928|ref|NP_360642.1| 50S ribosomal protein L4 [Rickettsia conorii str. Malish 7]
 gi|34581370|ref|ZP_00142850.1| 50S ribosomal protein L4 [Rickettsia sibirica 246]
 gi|46577283|sp|Q92GW7|RL4_RICCN RecName: Full=50S ribosomal protein L4
 gi|15620120|gb|AAL03543.1| 50S ribosomal protein L4 [Rickettsia conorii str. Malish 7]
 gi|28262755|gb|EAA26259.1| 50S ribosomal protein L4 [Rickettsia sibirica 246]
          Length = 207

 Score =  142 bits (358), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 85/203 (41%), Positives = 118/203 (58%), Gaps = 1/203 (0%)

Query: 6   VRNLDGEDKGVISVSEDIFALK-PQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKM 64
           + +L  E+ G IS++EDIFA++  +  I+ +V+ WQ  +   G  K+K  SEV  T  K 
Sbjct: 5   ILSLANEEVGEISLNEDIFAVEFIRDDIIKQVIDWQRAKAMSGNHKTKTVSEVLGTTKKP 64

Query: 65  YVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIM 124
           + QKGTG AR  S    Q RGGG A GP        LPKKVR L L HALS+K     ++
Sbjct: 65  FKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHATKLPKKVRKLGLIHALSEKCAEGKLL 124

Query: 125 VIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVY 184
           VID+L   + KT  LV         +  +IDG ++D NF LAA+NI N  ++P  G NVY
Sbjct: 125 VIDSLKLDKPKTSALVNILNKFQGKSFFVIDGNEVDINFSLAAKNIYNTVIVPQIGANVY 184

Query: 185 DILRCSKLVLSKSAIEALEDRFK 207
           DI+R   ++LS+ A+  LE+R +
Sbjct: 185 DIIRHEYVLLSQEAVSVLEERLR 207


>gi|229587008|ref|YP_002845509.1| 50S ribosomal protein L4 [Rickettsia africae ESF-5]
 gi|259491567|sp|C3PPA6|RL4_RICAE RecName: Full=50S ribosomal protein L4
 gi|228022058|gb|ACP53766.1| 50S ribosomal protein L4 [Rickettsia africae ESF-5]
          Length = 207

 Score =  142 bits (357), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 85/201 (42%), Positives = 117/201 (58%), Gaps = 1/201 (0%)

Query: 8   NLDGEDKGVISVSEDIFALK-PQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYV 66
           +L  E+ G IS++EDIFA++  +  I+ +V+ WQ  +   G  K+K  SEV  T  K + 
Sbjct: 7   SLANEEVGEISLNEDIFAVEFIRDDIIKQVIDWQRAKAMSGNHKTKTVSEVLGTTKKPFK 66

Query: 67  QKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVI 126
           QKGTG AR  S    Q RGGG A GP        LPKKVR L L HALS+K     ++VI
Sbjct: 67  QKGTGNARQGSLRSVQMRGGGVAHGPRVRSHATKLPKKVRKLGLIHALSEKCAEGKLLVI 126

Query: 127 DNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDI 186
           D+L   + KT  LV         +  +IDG ++D NF LAA+NI N  ++P  G NVYDI
Sbjct: 127 DSLKLDKPKTSALVNILNKFQGKSFFVIDGNEVDINFSLAAKNIYNTVIVPQIGANVYDI 186

Query: 187 LRCSKLVLSKSAIEALEDRFK 207
           +R   ++LS+ A+  LE+R +
Sbjct: 187 IRHEYVLLSQEAVSVLEERLR 207


>gi|157828859|ref|YP_001495101.1| 50S ribosomal protein L4 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165933586|ref|YP_001650375.1| 50S ribosomal protein L4 [Rickettsia rickettsii str. Iowa]
 gi|166199858|sp|A8GT68|RL4_RICRS RecName: Full=50S ribosomal protein L4
 gi|189042881|sp|B0BUQ9|RL4_RICRO RecName: Full=50S ribosomal protein L4
 gi|157801340|gb|ABV76593.1| 50S ribosomal protein L4 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165908673|gb|ABY72969.1| LSU ribosomal protein L1E (= L4P) [Rickettsia rickettsii str. Iowa]
          Length = 207

 Score =  142 bits (357), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 85/203 (41%), Positives = 118/203 (58%), Gaps = 1/203 (0%)

Query: 6   VRNLDGEDKGVISVSEDIFALK-PQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKM 64
           + +L  E+ G IS++EDIFA++  +  I+ +V+ WQ  +   G  K+K  SEV  T  K 
Sbjct: 5   ILSLANEEVGEISLNEDIFAVEFIRDDIIKQVIDWQRAKAMSGNHKTKTVSEVLGTTKKP 64

Query: 65  YVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIM 124
           + QKGTG AR  S    Q RGGG A GP        LPKKVR L L HALS+K     ++
Sbjct: 65  FKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHATKLPKKVRKLGLIHALSEKCAEGKLL 124

Query: 125 VIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVY 184
           VID+L   + KT  LV         +  +IDG ++D NF LAA+NI N  ++P  G NVY
Sbjct: 125 VIDSLKLDKPKTSALVNILNKFQGKSFFVIDGNEVDINFSLAAKNIYNTVVVPQIGANVY 184

Query: 185 DILRCSKLVLSKSAIEALEDRFK 207
           DI+R   ++LS+ A+  LE+R +
Sbjct: 185 DIIRHEYVLLSQEAVSVLEERLR 207


>gi|295425651|ref|ZP_06818338.1| ribosomal protein L4/L1 family protein [Lactobacillus amylolyticus
           DSM 11664]
 gi|295064667|gb|EFG55588.1| ribosomal protein L4/L1 family protein [Lactobacillus amylolyticus
           DSM 11664]
          Length = 205

 Score =  142 bits (357), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 122/204 (59%), Gaps = 2/204 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  L V + +G+D G +++++ +F ++P + ++   +  Q   +R G SK K RS V   
Sbjct: 1   MANLKVIDQNGKDSGEVTLNDKVFGIEPNESVVFEAIIRQRAGQRQGTSKVKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    +++P+K R LA++  LS K   
Sbjct: 61  GKKPWRQKGTGRARQGSIRAPQWRGGGTVFGPTPRSYAYSMPRKQRRLAIKSVLSQKLID 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            +++V+D L     KTK  V+   +L + + +++     D+N QL+A+N+P + ++PV G
Sbjct: 121 KNLIVLDKLTMSAPKTKEFVSILDSLKVESKVLV--VSDDKNVQLSAKNLPKVKVVPVNG 178

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV D +   KL+L++ A++ +E+
Sbjct: 179 LNVEDAVNYDKLILTQDAVKKIEE 202


>gi|317496189|ref|ZP_07954549.1| ribosomal protein L4/L1 family protein [Gemella moribillum M424]
 gi|316913764|gb|EFV35250.1| ribosomal protein L4/L1 family protein [Gemella moribillum M424]
          Length = 207

 Score =  141 bits (356), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 75/200 (37%), Positives = 110/200 (55%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +L +   DG   G +  ++ +F ++P Q +L + +  Q    R G  K+KGRSEV+  
Sbjct: 1   MPQLDLFKQDGTKVGAVEANDAVFGIEPNQHVLFQAVTLQRASLRQGTHKTKGRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P      +P+K+R LALR ALS K  +
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGIVFGPTPRSYSFKMPRKMRRLALRSALSSKVAA 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N++  ++ L     KTK        L L   ++    +L+ N  L+ RNIP +  +   G
Sbjct: 121 NEVFALETLTFDSIKTKNFKEMLSNLSLEKKVLFVVTELEENTVLSGRNIPGVEFVETTG 180

Query: 181 INVYDILRCSKLVLSKSAIE 200
           +NV DIL  +K+V +K A+E
Sbjct: 181 LNVLDILGSNKVVFTKDALE 200


>gi|293375390|ref|ZP_06621671.1| ribosomal protein L4/L1 family protein [Turicibacter sanguinis
           PC909]
 gi|325844472|ref|ZP_08168199.1| 50S ribosomal protein L4 [Turicibacter sp. HGF1]
 gi|292645943|gb|EFF63972.1| ribosomal protein L4/L1 family protein [Turicibacter sanguinis
           PC909]
 gi|325489146|gb|EGC91530.1| 50S ribosomal protein L4 [Turicibacter sp. HGF1]
          Length = 207

 Score =  141 bits (356), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 122/204 (59%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N  G   G I ++E IF ++P +  +   +  Q    R G  K+K R+EV   
Sbjct: 1   MPQVALYNQQGAQVGEIVLNEAIFGIEPHKQAMFDAVIMQRASMRQGTHKTKTRTEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGPVP    + L KKVR LAL+ AL+ K   
Sbjct: 61  GRKPWKQKGTGRARQGSIRAPQWRGGGIVFGPVPRSYAYKLNKKVRRLALKSALATKVVE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+I+V+D LV +  KTK ++    AL++++  ++   + +   +L+ RNIP + +L V  
Sbjct: 121 NEIVVLDQLVFEAPKTKQMINVLGALNVTSKALVVTAEENAAVELSTRNIPGVKVLTVSQ 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV D+L  +KLV+++ A++ +E+
Sbjct: 181 LNVLDLLDATKLVITQDAVKKIEE 204


>gi|56551414|ref|YP_162253.1| 50S ribosomal protein L4 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241761061|ref|ZP_04759150.1| ribosomal protein L4/L1e [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|260752973|ref|YP_003225866.1| 50S ribosomal protein L4 [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|81598314|sp|Q5NQ63|RL4_ZYMMO RecName: Full=50S ribosomal protein L4
 gi|56542988|gb|AAV89142.1| ribosomal protein L4/L1e [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241374680|gb|EER64141.1| ribosomal protein L4/L1e [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|258552336|gb|ACV75282.1| ribosomal protein L4/L1e [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
          Length = 207

 Score =  141 bits (356), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 80/206 (38%), Positives = 124/206 (60%), Gaps = 2/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +++ V++LD   KG I +++ +F ++P+  IL RV+ WQ  ++R     ++ RS+VA +G
Sbjct: 1   MKVEVQSLDASKKGSIELNDAVFGIEPRADILHRVVTWQLEKRRAPTRATRERSDVARSG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K   QKG G ARH  +    F GGGKA G    +   +L KKVR+L LR ALS K  + 
Sbjct: 61  KKFGRQKGGGTARHGDRRSPIFIGGGKAHGARARVFNPSLNKKVRALGLRMALSSKAKTG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLS-NALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            ++VI+ L   E KTK L  + ++L      L++DG  ++ NF  A+ N+  +++LP  G
Sbjct: 121 TLVVIEAL-DVEAKTKLLAAQIQSLGFGPKVLVVDGDTVNENFARASSNLVGLDVLPAVG 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
            NVYDIL+   LVL+++A+E LE R 
Sbjct: 180 ANVYDILKHDTLVLTRAAVEKLEARL 205


>gi|288554726|ref|YP_003426661.1| 50S ribosomal protein L4 [Bacillus pseudofirmus OF4]
 gi|288545886|gb|ADC49769.1| 50S ribosomal protein L4 [Bacillus pseudofirmus OF4]
          Length = 207

 Score =  141 bits (356), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 77/204 (37%), Positives = 115/204 (56%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +++V N  G   G I +S+ IF ++P Q +L   +  Q    R G  K+KGRSEV   
Sbjct: 1   MPKVAVFNQAGSQVGDIELSDSIFGIEPNQSVLHDAVVMQQASLRQGTHKTKGRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+ GGG  FGP P    + LPKKVR LA++ ALS K  +
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWVGGGVVFGPTPRSYSYKLPKKVRRLAIKSALSSKLKA 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            +I+V+DNL     KTK +      L + +  ++     +    L+ RN+P +  +  +G
Sbjct: 121 AEIVVLDNLQLDAPKTKDMANVLNGLSVDSKALVVTADYNETVALSTRNLPGVTFVTAEG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV D+L+  KLV++K A+  +E+
Sbjct: 181 VNVLDVLKHDKLVITKDAVAKVEE 204


>gi|329770039|ref|ZP_08261434.1| 50S ribosomal protein L4 [Gemella sanguinis M325]
 gi|328837350|gb|EGF86980.1| 50S ribosomal protein L4 [Gemella sanguinis M325]
          Length = 207

 Score =  141 bits (355), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 75/200 (37%), Positives = 110/200 (55%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +L +   DG   G +  ++ +F ++P Q +L + +  Q    R G  K+KGRSEV+  
Sbjct: 1   MPQLDLFKQDGTKVGAVEANDAVFGIEPNQHVLFQAVTLQRASLRQGTHKTKGRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P      +P+K+R LALR ALS K  +
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGIVFGPTPRSYSFKMPRKMRRLALRSALSSKVAA 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N++  ++ L     KTK        L L   ++    +L+ N  L+ RNIP +  +   G
Sbjct: 121 NEVFALETLAFDTIKTKNFKEMLSNLSLEKKVLFVVTELEENTVLSGRNIPGVEFVETTG 180

Query: 181 INVYDILRCSKLVLSKSAIE 200
           +NV DIL  +K+V +K A+E
Sbjct: 181 LNVLDILGSNKVVFTKDALE 200


>gi|94987403|ref|YP_595336.1| 50S ribosomal protein L4 [Lawsonia intracellularis PHE/MN1-00]
 gi|166234679|sp|Q1MPR2|RL4_LAWIP RecName: Full=50S ribosomal protein L4
 gi|94731652|emb|CAJ55015.1| ribosomal protein L4 [Lawsonia intracellularis PHE/MN1-00]
          Length = 206

 Score =  141 bits (355), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 86/207 (41%), Positives = 118/207 (57%), Gaps = 1/207 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  ++V N   E+ G I++S  IF ++ Q  IL  V+R Q   KR G    K R  V+  
Sbjct: 1   MAIVTVYNQQKEETGKINLSSKIFEVQVQPEILHLVVRAQLAAKRAGTHSVKTRGHVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G+K + QKGTGRAR  S     +RGGG  FGP P      + KK+RSLAL  ALS +F  
Sbjct: 61  GAKPWRQKGTGRARAGSNRSPLWRGGGIVFGPQPRDYSFKVNKKIRSLALCMALSSRFAE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            +++VIDN+V  E KTK+ V     L L  ALI+   +      L+ RN+PN+ LL    
Sbjct: 121 ENLIVIDNIVLPEIKTKHFVGVANILGLHKALIVAPVE-STQLLLSMRNVPNVKLLTYDR 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRFK 207
           +NVYDIL+  +LVL + A++ +E R K
Sbjct: 180 LNVYDILKYKQLVLLEGAVQHIEARLK 206


>gi|115486043|ref|NP_001068165.1| Os11g0585700 [Oryza sativa Japonica Group]
 gi|77551649|gb|ABA94446.1| ribosomal protein L4/L1 family protein, expressed [Oryza sativa
           Japonica Group]
 gi|113645387|dbj|BAF28528.1| Os11g0585700 [Oryza sativa Japonica Group]
          Length = 286

 Score =  141 bits (355), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 78/202 (38%), Positives = 117/202 (57%), Gaps = 1/202 (0%)

Query: 6   VRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMY 65
           V N   EDKG + +  D+F +  ++ I+ RV+RWQ  +++ G   +K  SEV+ TG K Y
Sbjct: 79  VTNFHNEDKGFMVLDGDVFDVPIRKDIVHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY 138

Query: 66  VQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMV 125
            QKGTGRARH +    QFRGG    GP P      L KKVR L L+ ALS +     ++V
Sbjct: 139 NQKGTGRARHGTLRGPQFRGGATMHGPKPRSHAIKLQKKVRRLGLKIALSARTAEGKLLV 198

Query: 126 IDNLVSKECKTKYLVTRFRALD-LSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVY 184
            D+L     KTK +V     ++     L++DG  +D+  +LA +N+  +N+LP  G+NVY
Sbjct: 199 FDDLEVPSHKTKNIVQYIGQMEGTKKVLLVDGGDIDKKLKLATQNLHYVNVLPSIGLNVY 258

Query: 185 DILRCSKLVLSKSAIEALEDRF 206
            IL+   LV++++AI  + +R 
Sbjct: 259 SILQHDTLVMTRNAINRIVERM 280


>gi|311070764|ref|YP_003975687.1| 50S ribosomal protein L4 [Bacillus atrophaeus 1942]
 gi|310871281|gb|ADP34756.1| 50S ribosomal protein L4 [Bacillus atrophaeus 1942]
          Length = 207

 Score =  140 bits (354), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 117/204 (57%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N +G   G I ++  +F ++P + ++   +  Q    R G  K K RSEV   
Sbjct: 1   MPKVALYNQNGSTAGDIELNASVFGIEPNESVVFDAILMQRASLRQGSHKVKNRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LPKKVR LA++ ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYSYKLPKKVRRLAIKSALSSKVVD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+I+V+++L     KTK +    + L +    +I    ++    L+ARNIP + ++   G
Sbjct: 121 NNIVVLEDLTLDAVKTKEMAAILKGLSVEKKALIVTADVNETVSLSARNIPGVTVVQADG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           INV D++   KL+++K+A+E +E+
Sbjct: 181 INVLDVVNHEKLLITKAAVEKVEE 204


>gi|332187850|ref|ZP_08389584.1| ribosomal L4/L1 family protein [Sphingomonas sp. S17]
 gi|332012200|gb|EGI54271.1| ribosomal L4/L1 family protein [Sphingomonas sp. S17]
          Length = 208

 Score =  140 bits (354), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 121/206 (58%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +++ V++  G D   I +++++F L P+  IL RV+ WQ  ++R     ++ R++VA +G
Sbjct: 1   MKVKVQSFAGTDAADIELNDEVFGLDPRADILHRVVTWQLEKRRATARGTRERADVARSG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+  QKG G ARH  +    F GGGKA G         L KKVR+L L+ ALS    + 
Sbjct: 61  KKLGRQKGGGVARHGDRRAPVFIGGGKAHGARVRDFNPGLNKKVRALGLKMALSSHAKAG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLS-NALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            ++V+++L  +  KTK L      L     AL+IDG  ++ +F LAA N+  IN+LP  G
Sbjct: 121 SLIVMNDLAVEGNKTKTLQGDLVKLGFGKTALVIDGDAVETSFALAAGNLKEINVLPAAG 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
            NVYDIL+   LVL++SA+E LE RF
Sbjct: 181 ANVYDILKHDTLVLTRSAVEKLEARF 206


>gi|258512669|ref|YP_003186103.1| 50S ribosomal protein L4/L1e [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|257479395|gb|ACV59714.1| ribosomal protein L4/L1e [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 206

 Score =  140 bits (354), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 123/207 (59%), Gaps = 3/207 (1%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILA-RVLRWQSWRKRIGCSKSKGRSEVAY 59
           M  ++V N  G+  G I ++E IF    +  ++   VL++ + R+R G  K+K R+EV+ 
Sbjct: 1   MPTVAVLNTAGQQVGEIELNEKIFGAPIRPDLMHIVVLQYLAARRR-GTHKTKTRAEVSG 59

Query: 60  TGSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFC 119
            G K + QKGTGRAR  S    Q+RGGG   GPVP      +PKKVR  AL  ALS K  
Sbjct: 60  GGRKPWRQKGTGRARQGSIRAPQWRGGGVVHGPVPRSYAFKVPKKVRRAALYSALSSKVQ 119

Query: 120 SNDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
              I+V++ L  +  KTK +V   R L++  ALIIDG +  +   L+ARNIPN+  +   
Sbjct: 120 EGKIVVVEGLEFERPKTKDMVGVLRNLNVEKALIIDG-EKKQPVYLSARNIPNVKYMEAA 178

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRF 206
           G+NVY++LR   LVL+K A++ +E+ F
Sbjct: 179 GLNVYELLRHDHLVLTKDAVQKVEEVF 205


>gi|222616220|gb|EEE52352.1| hypothetical protein OsJ_34399 [Oryza sativa Japonica Group]
          Length = 353

 Score =  140 bits (354), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 78/202 (38%), Positives = 117/202 (57%), Gaps = 1/202 (0%)

Query: 6   VRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMY 65
           V N   EDKG + +  D+F +  ++ I+ RV+RWQ  +++ G   +K  SEV+ TG K Y
Sbjct: 146 VTNFHNEDKGFMVLDGDVFDVPIRKDIVHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY 205

Query: 66  VQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMV 125
            QKGTGRARH +    QFRGG    GP P      L KKVR L L+ ALS +     ++V
Sbjct: 206 NQKGTGRARHGTLRGPQFRGGATMHGPKPRSHAIKLQKKVRRLGLKIALSARTAEGKLLV 265

Query: 126 IDNLVSKECKTKYLVTRFRALD-LSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVY 184
            D+L     KTK +V     ++     L++DG  +D+  +LA +N+  +N+LP  G+NVY
Sbjct: 266 FDDLEVPSHKTKNIVQYIGQMEGTKKVLLVDGGDIDKKLKLATQNLHYVNVLPSIGLNVY 325

Query: 185 DILRCSKLVLSKSAIEALEDRF 206
            IL+   LV++++AI  + +R 
Sbjct: 326 SILQHDTLVMTRNAINRIVERM 347


>gi|308070974|ref|YP_003872579.1| 50S ribosomal protein L4 [Paenibacillus polymyxa E681]
 gi|310644201|ref|YP_003948960.1| 50S ribosomal protein l4 [Paenibacillus polymyxa SC2]
 gi|305860253|gb|ADM72041.1| 50S ribosomal protein L4 [Paenibacillus polymyxa E681]
 gi|309249152|gb|ADO58719.1| 50S ribosomal protein L4 [Paenibacillus polymyxa SC2]
          Length = 207

 Score =  140 bits (354), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 78/204 (38%), Positives = 112/204 (54%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N+ G   G I +++ +F ++P + +L   +  Q    R G  K KGRSEV   
Sbjct: 1   MPKVALFNISGSQVGEIELNDAVFGIEPNKHVLHDAVVMQLASLRQGTHKVKGRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+ GGG  FGP P    + LPKKVR LA++ ALS K   
Sbjct: 61  GRKPWKQKGTGRARQGSIRAPQWVGGGTVFGPTPRSYAYKLPKKVRRLAIKSALSSKVIE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+I+V+D L     KTK        L      +I     D N  L+ARNIP +  +   G
Sbjct: 121 NEIIVLDALTLNGPKTKEFAAILNNLKADRKALIVAPSYDDNVALSARNIPGVKFVAADG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           INV D+L   KL+++K A++ +E+
Sbjct: 181 INVLDVLGHDKLIITKEAVQKVEE 204


>gi|315649698|ref|ZP_07902782.1| ribosomal protein L4/L1e [Paenibacillus vortex V453]
 gi|315274886|gb|EFU38262.1| ribosomal protein L4/L1e [Paenibacillus vortex V453]
          Length = 207

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 77/204 (37%), Positives = 111/204 (54%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N+ G   G + ++E +F ++P   +L   +  Q    R G  K KGRSEV   
Sbjct: 1   MPKVALYNVSGSQVGEVELNEAVFGIEPNTHVLHSAVLLQRASLRRGTHKVKGRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q++GGG  FGP P      LPKKVR LA++ ALS K   
Sbjct: 61  GRKPWKQKGTGRARQGSIRSPQWKGGGVVFGPTPRSYTFKLPKKVRRLAIKSALSSKVID 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N I+V+D L     KTK        L +    +I     D N  L+ARNIP +  +   G
Sbjct: 121 NAIIVLDQLTLNTPKTKEFANILSNLKVGRKALIVAPSYDDNVALSARNIPGVKFVAADG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           INV D+L   +L+++K A++ +E+
Sbjct: 181 INVLDVLSYDQLIITKEAVQKVEE 204


>gi|261409520|ref|YP_003245761.1| 50S ribosomal protein L4/L1e [Paenibacillus sp. Y412MC10]
 gi|329922057|ref|ZP_08277850.1| 50S ribosomal protein L4 [Paenibacillus sp. HGF5]
 gi|261285983|gb|ACX67954.1| ribosomal protein L4/L1e [Paenibacillus sp. Y412MC10]
 gi|328942440|gb|EGG38704.1| 50S ribosomal protein L4 [Paenibacillus sp. HGF5]
          Length = 207

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 77/204 (37%), Positives = 111/204 (54%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N+ G   G + ++E +F ++P   +L   +  Q    R G  K KGRSEV   
Sbjct: 1   MPKVALYNVSGSQVGEVELNEAVFGIEPNAHVLHSAVLLQRASLRRGTHKVKGRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q++GGG  FGP P      LPKKVR LA++ ALS K   
Sbjct: 61  GRKPWKQKGTGRARQGSIRSPQWKGGGVVFGPTPRSYTFKLPKKVRRLAIKSALSSKVID 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N I+V+D L     KTK        L +    +I     D N  L+ARNIP +  +   G
Sbjct: 121 NAIIVLDQLTLNTPKTKEFANILSNLKVGRKALIVAPSYDDNVALSARNIPGVKFVAADG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           INV D+L   +L+++K A++ +E+
Sbjct: 181 INVLDVLSYDQLIITKEAVQKVEE 204


>gi|218290004|ref|ZP_03494181.1| ribosomal protein L4/L1e [Alicyclobacillus acidocaldarius LAA1]
 gi|218239989|gb|EED07176.1| ribosomal protein L4/L1e [Alicyclobacillus acidocaldarius LAA1]
          Length = 206

 Score =  140 bits (352), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 84/207 (40%), Positives = 123/207 (59%), Gaps = 3/207 (1%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILA-RVLRWQSWRKRIGCSKSKGRSEVAY 59
           M  ++V N  G+  G I ++E IF    +  ++   VL++ + R+R G  K+K R+EV+ 
Sbjct: 1   MPTVAVLNTAGQQVGEIELNEKIFGAPIRPDLMHIVVLQYLAARRR-GTHKTKTRAEVSG 59

Query: 60  TGSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFC 119
            G K + QKGTGRAR  S    Q+RGGG   GPVP      +PKKVR  AL  ALS K  
Sbjct: 60  GGRKPWRQKGTGRARQGSIRAPQWRGGGVVHGPVPRSYAFKVPKKVRRAALYSALSSKVQ 119

Query: 120 SNDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
              I+V++ L  +  KTK +V   R L++  ALI+DG +  +   L+ARNIPN+  +   
Sbjct: 120 EGKIVVVEGLEFERPKTKDMVGVLRNLNVEKALIVDG-EKKQPVYLSARNIPNVKYMEAA 178

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRF 206
           G+NVY++LR   LVL+K A++ +E+ F
Sbjct: 179 GLNVYELLRHDHLVLTKDAVQKVEEVF 205


>gi|15604504|ref|NP_221022.1| 50S ribosomal protein L4 [Rickettsia prowazekii str. Madrid E]
 gi|6226007|sp|Q9ZCQ6|RL4_RICPR RecName: Full=50S ribosomal protein L4
 gi|3861198|emb|CAA15098.1| 50S RIBOSOMAL PROTEIN L4 (rplD) [Rickettsia prowazekii]
 gi|292572286|gb|ADE30201.1| 50S ribosomal protein L4 [Rickettsia prowazekii Rp22]
          Length = 207

 Score =  140 bits (352), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 82/205 (40%), Positives = 122/205 (59%), Gaps = 5/205 (2%)

Query: 6   VRNLDGEDKGVISVSEDIFALK-PQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKM 64
           + +L  E+ G I++++DIFA++  +  I+ +V+ WQ  +   G  K+K  SEV+ T  K 
Sbjct: 5   ILSLANEEVGEITLNKDIFAVEFIRDDIIKQVIDWQRAKAMFGNHKTKTVSEVSGTTKKP 64

Query: 65  YVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHA--LPKKVRSLALRHALSDKFCSND 122
           + QKGTG AR  S    Q RGGG + GP   +  HA  LPKKVR L L HALS+K+    
Sbjct: 65  FKQKGTGNARQGSLRSVQMRGGGISHGPK--VRSHAIKLPKKVRKLGLIHALSEKYAEEK 122

Query: 123 IMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGIN 182
           +++ID+L   + KT  LV         +  +IDG ++D NF LA +NI N  ++P  G N
Sbjct: 123 LLIIDSLKLDKPKTSILVNLLSKFQGQSFFVIDGNKVDINFSLATKNIYNTLIVPQIGAN 182

Query: 183 VYDILRCSKLVLSKSAIEALEDRFK 207
           VYDI+R   ++LS+ A+  LE+R +
Sbjct: 183 VYDIIRHEYVLLSQEAVSFLEERLR 207


>gi|52078610|ref|YP_077401.1| 50S ribosomal protein L4 [Bacillus licheniformis ATCC 14580]
 gi|52783972|ref|YP_089801.1| 50S ribosomal protein L4 [Bacillus licheniformis ATCC 14580]
 gi|319649115|ref|ZP_08003323.1| 50S ribosomal protein L4 [Bacillus sp. BT1B_CT2]
 gi|81667231|sp|Q65PA6|RL4_BACLD RecName: Full=50S ribosomal protein L4
 gi|52001821|gb|AAU21763.1| ribosomal protein L4 [Bacillus licheniformis ATCC 14580]
 gi|52346474|gb|AAU39108.1| RplD [Bacillus licheniformis ATCC 14580]
 gi|317388815|gb|EFV69634.1| 50S ribosomal protein L4 [Bacillus sp. BT1B_CT2]
          Length = 207

 Score =  140 bits (352), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 118/204 (57%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N +G   G I +++ +F ++P + ++   +  Q    R G  K K RSEV   
Sbjct: 1   MPKVALYNQNGSTAGDIELNDSVFGIEPNESVVFDAILMQRASLRQGTHKVKNRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LPKKVR LA++ ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGIVFGPTPRSYAYKLPKKVRRLAIKSALSSKVND 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+++V+++L     KTK +    + L +    +I     +   +L+ARN+P + ++   G
Sbjct: 121 NNLIVLEDLNLDAVKTKEMAAILKGLSIEKKALIVTADANETVELSARNLPGVTVVEANG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           INV D++   KLV++K+A+E +E+
Sbjct: 181 INVLDVVGHEKLVMTKAAVEKVEE 204


>gi|308272978|emb|CBX29582.1| 50S ribosomal protein L4 [uncultured Desulfobacterium sp.]
          Length = 207

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 75/203 (36%), Positives = 122/203 (60%), Gaps = 1/203 (0%)

Query: 4   LSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSK 63
           + V NL+GE    + +++ IF +  +  +L  V+  Q   +R G +  K RS+V  +  K
Sbjct: 4   IDVYNLNGEKVSQLELTDSIFNIPVKPSVLHEVVTMQLACRRAGSASVKHRSDVRGSTRK 63

Query: 64  MYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDI 123
           ++ QKGTGRAR         RGGG  FGP P    + +PKK++ LAL+ ALS K  +N++
Sbjct: 64  LFRQKGTGRARRGDIKSPLLRGGGSIFGPDPRSYSYKVPKKIKKLALKMALSSKTINNNL 123

Query: 124 MVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINV 183
           +VID    +E KTK  +     L +  ALII   +L+ + +L++RN+P+I ++  +G+NV
Sbjct: 124 IVIDKFELEEAKTKNFIAVINTLKIKKALIITE-KLNESLELSSRNVPDIKVMRFEGLNV 182

Query: 184 YDILRCSKLVLSKSAIEALEDRF 206
           YDIL+  KL+L +++I+ +E R 
Sbjct: 183 YDILKYDKLILLETSIKGIEGRL 205


>gi|328725484|ref|XP_003248496.1| PREDICTED: 50S ribosomal protein L4-like [Acyrthosiphon pisum]
          Length = 267

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 114/204 (55%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + V  +DG   G I +++ +F ++P Q +L   +  Q    R G    K RS V   
Sbjct: 61  MANIDVLKVDGSKSGSIELNDSVFGIEPNQHVLFEAVNLQRASLRQGTHAVKNRSAVRGG 120

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  +    Q+RGGG  FGP P    + +PKK+R LALR ALS K   
Sbjct: 121 GRKPWKQKGTGRARQGTIRAPQWRGGGIVFGPTPRSYSYKMPKKMRRLALRSALSSKVSG 180

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N++ V++       KTK        L+LS  ++     +D N +L+ARNIP + ++  Q 
Sbjct: 181 NELTVLEAFNFDAPKTKEFKNVMSNLELSKKVLFIVDTVDSNVELSARNIPGVKVIDAQS 240

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV DIL  SK+V++K+A++ +E+
Sbjct: 241 LNVLDILDSSKVVITKAAVDKVEE 264


>gi|225849547|ref|YP_002729712.1| ribosomal protein, L4/L1 family [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225643372|gb|ACN98422.1| ribosomal protein, L4/L1 family [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 208

 Score =  139 bits (350), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 122/207 (58%), Gaps = 3/207 (1%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +E +V N   E  G +++ EDIF  +  QG +  V++W    KR G +K K R+EVA + 
Sbjct: 1   MEFNVVNNKNEIVGKVNLKEDIFQTQVNQGTVWEVIKWHLATKRAGTAKVKTRAEVAGSN 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTGRARH     + F GGG A GP P    +ALPKKVR   L+  L+ K  +N
Sbjct: 61  RKIYPQKGTGRARHGDIKANIFVGGGVAHGPHPRDYYYALPKKVRKKVLKGVLTYKLNNN 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNA--LIIDGCQLDRNFQLAARNIPNINLLPVQ 179
           +++V+++    + KTK  V   +   L N+  L++   +L+ N   + RNIP + +L  +
Sbjct: 121 ELIVVEDFNFDQPKTKNAVEVLKNFGLENSKVLLVLPEKLE-NVIKSFRNIPKVKILVSE 179

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRF 206
           G+N YDIL   K+++ KSA+E +++R 
Sbjct: 180 GLNSYDILNSEKVIIFKSALEKIQERL 206


>gi|15612698|ref|NP_241001.1| 50S ribosomal protein L4 [Bacillus halodurans C-125]
 gi|7674304|sp|Q9Z9L3|RL4_BACHD RecName: Full=50S ribosomal protein L4
 gi|4512405|dbj|BAA75272.1| rplD homologue (identity of 79% to B. subtilis ) [Bacillus
           halodurans]
 gi|10172747|dbj|BAB03854.1| 50S ribosomal protein L4 [Bacillus halodurans C-125]
          Length = 207

 Score =  139 bits (350), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 118/204 (57%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N  G   G I +S+ +F ++P + +L   +  Q    R G  K+K RSEV   
Sbjct: 1   MPKVALYNQAGSQVGDIELSDAVFGIEPNENVLHDAVVMQQASLRQGTHKTKTRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+ GGG  FGP P    + LPKKVR LA++ ALS K  +
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWVGGGTVFGPTPRSYSYKLPKKVRRLAIKSALSSKVKA 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            +I+V+++L  +  KTK + +    L +    ++     + N  L+ARNIP +  +  +G
Sbjct: 121 EEIVVLESLALEAPKTKEMASILSGLSVDRKALVVTADYNDNVALSARNIPGVTFVTAEG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV D+++  KL+++K A+E +E+
Sbjct: 181 VNVLDVIKHDKLIITKDAVEKVEE 204


>gi|188996238|ref|YP_001930489.1| ribosomal protein L4/L1e [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188931305|gb|ACD65935.1| ribosomal protein L4/L1e [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 208

 Score =  139 bits (350), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 122/207 (58%), Gaps = 3/207 (1%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +E +V N   E  G I++ EDIF  +  QG +  V++W    KR G + +K R+EVA + 
Sbjct: 1   MEFNVVNNKNEVIGKINLKEDIFKTEVNQGTVWEVIKWHLASKRAGTASTKTRAEVAGSN 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTGRARH     + F GGG A GP P     ALPKKVR   L+  L+ K  +N
Sbjct: 61  RKIYPQKGTGRARHGDIKANIFVGGGVAHGPHPRDYYFALPKKVRRKVLKGVLTYKLNNN 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNA--LIIDGCQLDRNFQLAARNIPNINLLPVQ 179
           +++V+D+   +  KTK  +   ++  L N+  L++   +L+ N   + RNIP + +L  +
Sbjct: 121 ELIVVDDFNFEAPKTKNAIEVLKSFGLENSKVLLVLPEKLE-NVIKSFRNIPKVKILLAE 179

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRF 206
           GIN YD+L   K+++ KSA+E +++R 
Sbjct: 180 GINSYDVLNNDKVIIFKSALEKIQERL 206


>gi|326524247|dbj|BAK00507.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 289

 Score =  139 bits (350), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 76/202 (37%), Positives = 116/202 (57%), Gaps = 1/202 (0%)

Query: 6   VRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMY 65
           V N   EDKG + +  D+F +  ++ I+ RV+RWQ  +++ G   +K  SEV+ TG K Y
Sbjct: 82  VTNFHNEDKGFMVLDGDVFDVPIRKDIVHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPY 141

Query: 66  VQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMV 125
            QKGTGRARH +    QFRGG    GP P      L KKVR L L+ ALS +     + +
Sbjct: 142 KQKGTGRARHGTLRGCQFRGGATMHGPKPRSHAFKLQKKVRRLGLKIALSARTAEGKLCI 201

Query: 126 IDNLVSKECKTKYLVTRFRAL-DLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVY 184
            ++L     KTK +V   + + D    L++DG  +D+  +LA +N+  +N++P  G+NVY
Sbjct: 202 FEDLEVPSHKTKNIVQYIKQMDDTKKILLVDGGDIDKKLKLATQNLHYVNVIPSIGLNVY 261

Query: 185 DILRCSKLVLSKSAIEALEDRF 206
            IL+   LV+++ AI  + +R 
Sbjct: 262 SILQHDTLVMTRDAINRIVERM 283


>gi|147676656|ref|YP_001210871.1| 50S ribosomal protein L4 [Pelotomaculum thermopropionicum SI]
 gi|189029511|sp|A5D5J1|RL4_PELTS RecName: Full=50S ribosomal protein L4
 gi|146272753|dbj|BAF58502.1| ribosomal protein L4 [Pelotomaculum thermopropionicum SI]
          Length = 206

 Score =  139 bits (349), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 123/208 (59%), Gaps = 5/208 (2%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +++ N +GE  G +++ ++IF ++  + +L   +      +R+G   +K RSEV   
Sbjct: 1   MPTVALYNTNGEQVGELALKDEIFGVEVHEPVLHDAVVMHLANRRLGTHDTKTRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRARH S     +RGGG  FGP P    ++LP+KVR LAL+ ALS K  S
Sbjct: 61  GRKPWRQKGTGRARHGSIRSPLWRGGGIIFGPHPRDYSYSLPRKVRRLALKSALSAKVNS 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            DI+V+D L   + KTK +      L + +AL++   + D   + +ARNIPNI   PVQ 
Sbjct: 121 GDILVLDELKLDQPKTKEMARILNNLKVDDALLVT-AEKDEAVERSARNIPNIK--PVQA 177

Query: 181 --INVYDILRCSKLVLSKSAIEALEDRF 206
             +NVYDIL   KLV+++ A+  +E+ F
Sbjct: 178 ALLNVYDILAYDKLVMTRDAVARVEEVF 205


>gi|172056141|ref|YP_001812601.1| 50S ribosomal protein L4 [Exiguobacterium sibiricum 255-15]
 gi|226730665|sp|B1YGV1|RL4_EXIS2 RecName: Full=50S ribosomal protein L4
 gi|171988662|gb|ACB59584.1| ribosomal protein L4/L1e [Exiguobacterium sibiricum 255-15]
          Length = 207

 Score =  138 bits (348), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 116/204 (56%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N  G   G I +++ +F ++P + ++   +  Q   +R G   +KGRSEV   
Sbjct: 1   MPKVALLNQTGTQVGDIELADAVFGIEPNEAVVYDAIVMQQASRRQGTHDTKGRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+ GGG  FGP P    + LPKKVR LALR ALS K  +
Sbjct: 61  GRKPWKQKGTGRARQGSIRSPQWVGGGTVFGPTPRSYAYKLPKKVRRLALRSALSSKVAN 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+ +V++ L     KTK +++ F AL +   +++     +    L+ RNIP + ++   G
Sbjct: 121 NEFIVLEGLTIDAPKTKDMISVFAALSIERKVLVVTADYNETVVLSTRNIPGVTVVDAAG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV D++   K++ +K A+  +E+
Sbjct: 181 VNVLDLVAHDKVIFTKDAVARVEE 204


>gi|148260938|ref|YP_001235065.1| 50S ribosomal protein L4 [Acidiphilium cryptum JF-5]
 gi|326404336|ref|YP_004284418.1| 50S ribosomal protein L4 [Acidiphilium multivorum AIU301]
 gi|166234626|sp|A5FZW4|RL4_ACICJ RecName: Full=50S ribosomal protein L4
 gi|146402619|gb|ABQ31146.1| LSU ribosomal protein L4P [Acidiphilium cryptum JF-5]
 gi|325051198|dbj|BAJ81536.1| 50S ribosomal protein L4 [Acidiphilium multivorum AIU301]
          Length = 216

 Score =  138 bits (348), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 79/205 (38%), Positives = 112/205 (54%), Gaps = 2/205 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +++ +  LD    G   + E+ FA  P+  I+ARV+ WQ  ++R G  K KG  EV+ T 
Sbjct: 1   MQIDISTLDAGSAGKAELPEEYFAATPRADIMARVVHWQLAKRRAGTHKVKGMGEVSGTT 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K Y QKGTG AR  S    QFR GG   GPV     ++L KKVR L L  ALS K    
Sbjct: 61  KKPYRQKGTGNARQGSLRAPQFRTGGAVHGPVVRDHGYSLNKKVRRLGLISALSQKLAEG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++V+D  V+   KT  L  + + L     L++D   +D  F  A+RN+  I++LPV G 
Sbjct: 121 KLVVLDT-VAGVSKTSELNVKLKKLGWGRTLVVDAV-VDEGFARASRNLIGIDVLPVVGA 178

Query: 182 NVYDILRCSKLVLSKSAIEALEDRF 206
           NVYDIL+   L ++ + +E L+ R 
Sbjct: 179 NVYDILQHDTLAITAAGLEGLKRRL 203


>gi|16077185|ref|NP_387998.1| 50S ribosomal protein L4 [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221307929|ref|ZP_03589776.1| 50S ribosomal protein L4 [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221312250|ref|ZP_03594055.1| 50S ribosomal protein L4 [Bacillus subtilis subsp. subtilis str.
           NCIB 3610]
 gi|221317184|ref|ZP_03598478.1| 50S ribosomal protein L4 [Bacillus subtilis subsp. subtilis str.
           JH642]
 gi|221321447|ref|ZP_03602741.1| 50S ribosomal protein L4 [Bacillus subtilis subsp. subtilis str.
           SMY]
 gi|321313788|ref|YP_004206075.1| 50S ribosomal protein L4 [Bacillus subtilis BSn5]
 gi|1173050|sp|P42921|RL4_BACSU RecName: Full=50S ribosomal protein L4
 gi|786154|dbj|BAA08832.1| ribosomal protein L4 [Bacillus subtilis]
 gi|1165304|gb|AAC45957.1| L4 [Bacillus subtilis]
 gi|2632384|emb|CAB11893.1| ribosomal protein L4 [Bacillus subtilis subsp. subtilis str. 168]
 gi|291482490|dbj|BAI83565.1| 50S ribosomal protein L4 [Bacillus subtilis subsp. natto BEST195]
 gi|320020062|gb|ADV95048.1| 50S ribosomal protein L4 [Bacillus subtilis BSn5]
          Length = 207

 Score =  138 bits (347), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 115/204 (56%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N +G   G I ++  +F ++P + ++   +  Q    R G  K K RSEV   
Sbjct: 1   MPKVALYNQNGSTAGDIELNASVFGIEPNESVVFDAILMQRASLRQGTHKVKNRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LPKKVR LA++  LS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYSYKLPKKVRRLAIKSVLSSKVID 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+I+V+++L     KTK +    + L +    +I     +    L+ARNIP + ++   G
Sbjct: 121 NNIIVLEDLTLDTAKTKEMAAILKGLSVEKKALIVTADANEAVALSARNIPGVTVVEANG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           INV D++   KL+++K+A+E +E+
Sbjct: 181 INVLDVVNHEKLLITKAAVEKVEE 204


>gi|157964805|ref|YP_001499629.1| 50S ribosomal protein L4 [Rickettsia massiliae MTU5]
 gi|157844581|gb|ABV85082.1| 50S ribosomal protein L4 [Rickettsia massiliae MTU5]
          Length = 209

 Score =  137 bits (346), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 84/207 (40%), Positives = 120/207 (57%), Gaps = 1/207 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALK-PQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           ++  V +L  ++ G IS++E+IFA++  +  I+ +V+ WQ  +   G  K+K  SEV  T
Sbjct: 3   MKTKVLSLANKEVGEISLNENIFAVEFIRDDIIKQVIDWQRAKAMSGNHKTKTVSEVLGT 62

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
             K + QKGTG AR  S    Q RGGG A GP        LPKKVR L L HALS+K   
Sbjct: 63  TKKPFKQKGTGNARQGSLRSVQMRGGGVAHGPRVRSHATKLPKKVRKLGLIHALSEKCAE 122

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             ++VID+L   + KT  LV         +  +IDG ++D NF LAA+NI N  ++P  G
Sbjct: 123 GKLLVIDSLKLDKPKTSALVNILNKFQGKSFCVIDGNEVDINFSLAAKNIYNTVIVPQIG 182

Query: 181 INVYDILRCSKLVLSKSAIEALEDRFK 207
            NVYDI+R   ++LS+ A+  LE+R +
Sbjct: 183 ANVYDIIRHEYVLLSQEAVSVLEERLR 209


>gi|296333114|ref|ZP_06875568.1| 50S ribosomal protein L4 [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305672816|ref|YP_003864487.1| 50S ribosomal protein L4 [Bacillus subtilis subsp. spizizenii str.
           W23]
 gi|296149730|gb|EFG90625.1| 50S ribosomal protein L4 [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305411059|gb|ADM36177.1| 50S ribosomal protein L4 [Bacillus subtilis subsp. spizizenii str.
           W23]
          Length = 207

 Score =  137 bits (346), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 115/204 (56%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N +G   G I ++  +F ++P + ++   +  Q    R G  K K RSEV   
Sbjct: 1   MPKVALYNQNGSTAGDIELNASVFGIEPNESVVFDAILMQRASLRQGTHKVKNRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LPKKVR LA++  LS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYSYKLPKKVRRLAIKSVLSSKVND 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+I+V+++L     KTK +    + L +    +I     +    L+ARNIP + ++   G
Sbjct: 121 NNIIVLEDLTLDTAKTKEMAAILKGLSVEKKALIVTADANEAVALSARNIPGVTVVEANG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           INV D++   KL+++K+A+E +E+
Sbjct: 181 INVLDVVNHEKLLITKAAVEKVEE 204


>gi|154684635|ref|YP_001419796.1| 50S ribosomal protein L4 [Bacillus amyloliquefaciens FZB42]
 gi|308172008|ref|YP_003918713.1| 50S ribosomal protein L4 [Bacillus amyloliquefaciens DSM 7]
 gi|166234633|sp|A7Z0N9|RL4_BACA2 RecName: Full=50S ribosomal protein L4
 gi|154350486|gb|ABS72565.1| RplD [Bacillus amyloliquefaciens FZB42]
 gi|307604872|emb|CBI41243.1| ribosomal protein L4 [Bacillus amyloliquefaciens DSM 7]
 gi|328551818|gb|AEB22310.1| 50S ribosomal protein L4 [Bacillus amyloliquefaciens TA208]
          Length = 207

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 115/204 (56%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N +G   G I ++  +F ++P + ++   +  Q    R G  K K RSEV   
Sbjct: 1   MPKVALYNQNGSTAGDIELNASVFGIEPNESVVFDAILMQRASLRQGSHKVKNRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LPKKVR LA++  LS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYSYKLPKKVRRLAIKSVLSSKVND 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+I+V+++L     KTK +    + L +    +I     +    L+ARNIP + ++   G
Sbjct: 121 NNIIVLEDLTLDTVKTKEMAAILKGLSVEKKALIVTADANEAVSLSARNIPGVTVVQANG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           INV D++   KL+++K+A+E +E+
Sbjct: 181 INVLDVVNHEKLLITKAAVEKVEE 204


>gi|327438279|dbj|BAK14644.1| ribosomal protein L4 [Solibacillus silvestris StLB046]
          Length = 207

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 78/204 (38%), Positives = 118/204 (57%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++SV +  G   G I +++ IF ++P + +L   +  Q    R G  K K RS VA  
Sbjct: 1   MTKVSVLSQTGASVGEIELNDAIFGIEPNEAVLFDAVVAQRASLRQGNHKVKNRSAVAGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LPKKVR LA++ ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYSYKLPKKVRRLAIKSALSAKVLE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            +++V+D L+    KTK   +   AL++S   +    +++ N  L+ARNIP + +L  +G
Sbjct: 121 QNLVVLDALLFDAPKTKDFKSVLAALEISKKALFVTAEVNENAILSARNIPGVTVLTAEG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           INV D+L   K+V ++ A++ +E+
Sbjct: 181 INVLDLLGHDKVVFTQDAVKKVEE 204


>gi|297618383|ref|YP_003703542.1| ribosomal protein L4/L1e [Syntrophothermus lipocalidus DSM 12680]
 gi|297146220|gb|ADI02977.1| ribosomal protein L4/L1e [Syntrophothermus lipocalidus DSM 12680]
          Length = 208

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 77/204 (37%), Positives = 116/204 (56%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ + N++G   G I +S+++F ++P Q  + +V++ Q    R+G + +K R EV   
Sbjct: 1   MPKVPLYNMNGTQVGEIELSDEVFGIEPNQAAMHQVVKMQLANHRVGTAATKTRGEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K Y QKGTGRAR  S     +R GG  FGP P    + LPKK+R LAL+ ALS K   
Sbjct: 61  GRKPYRQKGTGRARAGSIRSPLWRKGGVVFGPQPRDYSYTLPKKIRRLALKSALSSKVKG 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            +++V+D L  +  KTK +V    AL +    +I     D N   +ARNIP I  +    
Sbjct: 121 RNMIVMDELTLEAPKTKRMVEILNALQVDRKALIVTADGDVNVYKSARNIPGIKPVRADF 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           ++VYDIL   KLV++K A+  +E+
Sbjct: 181 MSVYDILNHDKLVITKDAVAKVEE 204


>gi|147767815|emb|CAN77922.1| hypothetical protein VITISV_027648 [Vitis vinifera]
          Length = 278

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 116/204 (56%), Gaps = 1/204 (0%)

Query: 4   LSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSK 63
           + V N   EDKG + ++ D+F +  ++ I+ RV+RWQ  +++ G   +K  SEV+ TG K
Sbjct: 69  IPVTNFHNEDKGFMXLAGDVFDVPIRKDIVHRVVRWQLAKRQQGTHSTKTISEVSGTGKK 128

Query: 64  MYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDI 123
            + QKGTGRARH +    QFRGG    GP P      L KKVR L L+ ALS +     +
Sbjct: 129 PWRQKGTGRARHGTLRGPQFRGGAIMHGPKPRSHAIKLNKKVRRLGLKIALSARTAEGKL 188

Query: 124 MVIDNLVSKECKTKYLVTRFRALD-LSNALIIDGCQLDRNFQLAARNIPNINLLPVQGIN 182
           +V D+L     KTK +V   + ++     L++DG  +    +LA +N+  +N+LP  G+N
Sbjct: 189 LVFDDLEVPSHKTKNIVNYVKEMENXKKLLLVDGGPITEKLKLATQNLHYVNVLPSIGLN 248

Query: 183 VYDILRCSKLVLSKSAIEALEDRF 206
           VY IL    LV+S+ A+  + +R 
Sbjct: 249 VYSILLHDTLVMSRBAVNKIVERM 272


>gi|229917357|ref|YP_002886003.1| 50S ribosomal protein L4 [Exiguobacterium sp. AT1b]
 gi|259491559|sp|C4KZP5|RL4_EXISA RecName: Full=50S ribosomal protein L4
 gi|229468786|gb|ACQ70558.1| ribosomal protein L4/L1e [Exiguobacterium sp. AT1b]
          Length = 207

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 113/204 (55%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N  G   G I ++E IF ++P + +L   +  Q   +R G   +KGRSEV   
Sbjct: 1   MPKVALLNQTGSQVGEIELAEAIFGIEPNESVLYDAIVMQQASRRQGTHDTKGRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+ GGG  FGP P    + LPKKVR LAL  ALS K  +
Sbjct: 61  GRKPWKQKGTGRARQGSIRSPQWVGGGTVFGPTPRSYSYKLPKKVRRLALLSALSSKVQN 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+I+V++ L     KTK +     +L +    ++     +    LAARNIP + ++   G
Sbjct: 121 NEIIVLEGLAFDAPKTKDMAAVLNSLSVERKALVVTADYNETIALAARNIPGVTVIDAAG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV D++   K++ +K A+  +E+
Sbjct: 181 VNVLDLVANDKVIFTKDAVAKVEE 204


>gi|134298094|ref|YP_001111590.1| 50S ribosomal protein L4 [Desulfotomaculum reducens MI-1]
 gi|172044220|sp|A4J112|RL4_DESRM RecName: Full=50S ribosomal protein L4
 gi|134050794|gb|ABO48765.1| LSU ribosomal protein L4P [Desulfotomaculum reducens MI-1]
          Length = 206

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 119/204 (58%), Gaps = 1/204 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N++GE  G + + +++F ++P + ++   +  Q   +R G   +K R+EV   
Sbjct: 1   MPKVALYNINGEQVGEVELKDEVFGIEPHEHVMHEAVNMQLANQRQGTHDTKTRAEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     +R GG  FGP P     +LPKKVR LAL+ ALS K   
Sbjct: 61  GRKPWRQKGTGRARAGSSRSPIWRKGGIVFGPHPRDYAISLPKKVRRLALKSALSSKVLD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            +I+V+D+L     KTK +V     L    AL++   + D N + +ARNI  +  L   G
Sbjct: 121 QNIIVLDSLTMDAPKTKDMVRILGNLKADKALVVTATR-DLNVEKSARNIEGVKPLKADG 179

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NVYD+L+ +KLV++K A+  +E+
Sbjct: 180 VNVYDLLKYTKLVITKDAVAKIEE 203


>gi|222150446|ref|YP_002559599.1| 50S ribosomal protein L4 [Macrococcus caseolyticus JCSC5402]
 gi|254803742|sp|B9E9J2|RL4_MACCJ RecName: Full=50S ribosomal protein L4
 gi|222119568|dbj|BAH16903.1| 50S ribosomal protein L4 [Macrococcus caseolyticus JCSC5402]
          Length = 207

 Score =  136 bits (343), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 111/204 (54%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M    V  +DG   G I +++++F ++P Q +L   +  Q    R G    K RS V+  
Sbjct: 1   MANYDVLKVDGTKAGSIELNDNVFGIEPNQHVLFEAINLQRASMRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  +    Q+RGGG  FGP P    + +PKK+R LALR ALS K   
Sbjct: 61  GRKPWKQKGTGRARQGTIRAPQWRGGGIVFGPTPRSYSYKMPKKMRRLALRSALSAKVQE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N   V+++L     KTK        L+L   ++      D N  L+ARNIP + ++   G
Sbjct: 121 NAFTVLESLTFDAPKTKEFKNMTTTLELPKKVLFVVEAEDVNVALSARNIPGVTVITTTG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV DI+  +++V++K A+E +E+
Sbjct: 181 LNVLDIVHANQVVMTKGAVEKVEE 204


>gi|42518430|ref|NP_964360.1| 50S ribosomal protein L4 [Lactobacillus johnsonii NCC 533]
 gi|227888852|ref|ZP_04006657.1| 50S ribosomal protein L4 [Lactobacillus johnsonii ATCC 33200]
 gi|268318852|ref|YP_003292508.1| ribosomal protein L4 [Lactobacillus johnsonii FI9785]
 gi|46577154|sp|P61064|RL4_LACJO RecName: Full=50S ribosomal protein L4
 gi|41582715|gb|AAS08326.1| 50S ribosomal protein L4 [Lactobacillus johnsonii NCC 533]
 gi|227850689|gb|EEJ60775.1| 50S ribosomal protein L4 [Lactobacillus johnsonii ATCC 33200]
 gi|262397227|emb|CAX66241.1| ribosomal protein L4 [Lactobacillus johnsonii FI9785]
 gi|329666693|gb|AEB92641.1| 50S ribosomal protein L4 [Lactobacillus johnsonii DPC 6026]
          Length = 205

 Score =  136 bits (343), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 116/204 (56%), Gaps = 2/204 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  L + +  G+  G + ++E+IF ++P + ++   +  Q   KR G S  K RS V   
Sbjct: 1   MANLEIIDQKGKSAGNVDLNEEIFGIEPNESVVFDAIIRQRAGKRQGTSAVKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P      +P+K R LA++  LS K   
Sbjct: 61  GKKPWRQKGTGRARQGSIRAPQWRGGGTVFGPTPRSYKMDMPRKARRLAMKSVLSQKVAD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           ND++++D L  +  KTK L       ++S  +++     D+N QL+ +N+P + ++PV G
Sbjct: 121 NDLIILDQLTLEAPKTKELKAILDNANVSGKVLV--VSDDKNVQLSGKNLPKVKVVPVNG 178

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV D +   KLVL++ AI+ +E+
Sbjct: 179 LNVVDAVDYQKLVLTQDAIKRIEE 202


>gi|157690901|ref|YP_001485363.1| 50S ribosomal protein L4 [Bacillus pumilus SAFR-032]
 gi|194017590|ref|ZP_03056201.1| ribosomal protein L4/L1 family [Bacillus pumilus ATCC 7061]
 gi|166990946|sp|A8F986|RL4_BACP2 RecName: Full=50S ribosomal protein L4
 gi|157679659|gb|ABV60803.1| ribosomal protein L4 [Bacillus pumilus SAFR-032]
 gi|194010862|gb|EDW20433.1| ribosomal protein L4/L1 family [Bacillus pumilus ATCC 7061]
          Length = 207

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 114/204 (55%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N +G   G I ++  +F ++P + ++   +  Q    R G  K K RSEV   
Sbjct: 1   MPKVALFNQNGSTNGEIELNASVFGIEPNESVVFDAILMQRASLRQGTHKVKTRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LPKKVR LA++  LS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGIVFGPTPRSYSYKLPKKVRRLAIKSVLSSKVID 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+I+V+++L     KTK      + L +    +I     +    L+ARNIP + ++   G
Sbjct: 121 NNIIVLEDLTLDAVKTKEFAGILKGLSVEKKALIVTADANETVALSARNIPGVTVVEANG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           INV D++   KL+++K+A+E +E+
Sbjct: 181 INVLDVVNHEKLLITKAAVEKVEE 204


>gi|161485627|ref|YP_064861.2| 50S ribosomal protein L4 [Desulfotalea psychrophila LSv54]
          Length = 207

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 119/208 (57%), Gaps = 5/208 (2%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +SV N + E    I +++ IF  + ++ IL  V+R Q   KR G + +K R EV   
Sbjct: 1   MSTVSVVNTNNEKVDEIELNDAIFNREVKEYILHDVVRMQRAAKRAGTASTKTRVEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G+K + QKGTGRAR  S++   +RGGG  FGP P      L +KVR  A+  ALS +F  
Sbjct: 61  GAKPWRQKGTGRARAGSRTSPLWRGGGVTFGPKPRDYSFKLNRKVRQQAVSMALSARFQE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALII--DGCQLDRNFQLAARNIPNINLLPV 178
            +++V+DN +    KTK   +  + L+L+NALI+  D  +   N   + RN+    +LP 
Sbjct: 121 GNLIVLDNFIMDAIKTKEFASTMKTLELANALIVMDDASE---NLSKSCRNVHGYRILPA 177

Query: 179 QGINVYDILRCSKLVLSKSAIEALEDRF 206
           +G+NVYDIL   K+VL K  IE+LE R 
Sbjct: 178 EGLNVYDILLHKKVVLVKPVIESLEKRL 205


>gi|81642546|sp|Q6AP70|RL4_DESPS RecName: Full=50S ribosomal protein L4
 gi|50876014|emb|CAG35854.1| probable 50S ribosomal protein L4 [Desulfotalea psychrophila LSv54]
          Length = 211

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 119/208 (57%), Gaps = 5/208 (2%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +SV N + E    I +++ IF  + ++ IL  V+R Q   KR G + +K R EV   
Sbjct: 5   MSTVSVVNTNNEKVDEIELNDAIFNREVKEYILHDVVRMQRAAKRAGTASTKTRVEVRGG 64

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G+K + QKGTGRAR  S++   +RGGG  FGP P      L +KVR  A+  ALS +F  
Sbjct: 65  GAKPWRQKGTGRARAGSRTSPLWRGGGVTFGPKPRDYSFKLNRKVRQQAVSMALSARFQE 124

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALII--DGCQLDRNFQLAARNIPNINLLPV 178
            +++V+DN +    KTK   +  + L+L+NALI+  D  +   N   + RN+    +LP 
Sbjct: 125 GNLIVLDNFIMDAIKTKEFASTMKTLELANALIVMDDASE---NLSKSCRNVHGYRILPA 181

Query: 179 QGINVYDILRCSKLVLSKSAIEALEDRF 206
           +G+NVYDIL   K+VL K  IE+LE R 
Sbjct: 182 EGLNVYDILLHKKVVLVKPVIESLEKRL 209


>gi|313123112|ref|YP_004033371.1| 50S ribosomal protein l4 [Lactobacillus delbrueckii subsp.
           bulgaricus ND02]
 gi|312279675|gb|ADQ60394.1| 50S ribosomal protein L4 [Lactobacillus delbrueckii subsp.
           bulgaricus ND02]
 gi|325684721|gb|EGD26875.1| 50S ribosomal protein L4 [Lactobacillus delbrueckii subsp. lactis
           DSM 20072]
          Length = 205

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 118/204 (57%), Gaps = 2/204 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M    + + +G + G +++++++F+++P + ++   +  Q   KR G SK K RS V   
Sbjct: 1   MANFKLMDQNGNNAGEVTLNDNVFSVEPNEAVVFDAIIRQRAGKRQGTSKVKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    +++P+K R LA++  LS K   
Sbjct: 61  GKKPWRQKGTGRARQGSIRAPQWRGGGVVFGPTPRSYAYSMPRKQRRLAIKSVLSQKLLD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            +++V+D L     KTK  V     L L   +++     D+N QL+A+N+P + ++PV G
Sbjct: 121 QNLVVLDKLTLDAPKTKDFVAILNGLKLEGKVLV--VSDDKNVQLSAKNLPKVKVVPVNG 178

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV D +   KLVL++  ++ +E+
Sbjct: 179 LNVEDAVNYDKLVLTQDDVKKIEE 202


>gi|51473838|ref|YP_067595.1| 50S ribosomal protein L4 [Rickettsia typhi str. Wilmington]
 gi|81610771|sp|Q68W79|RL4_RICTY RecName: Full=50S ribosomal protein L4
 gi|51460150|gb|AAU04113.1| 50S ribosomal protein L4 [Rickettsia typhi str. Wilmington]
          Length = 207

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 82/205 (40%), Positives = 123/205 (60%), Gaps = 5/205 (2%)

Query: 6   VRNLDGEDKGVISVSEDIFALK-PQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKM 64
           + +L  E+ G I++++DIFA++  +  I+ +V+ WQ  +   G  K+K  SEV+ T  K 
Sbjct: 5   ILSLANEEVGEITLNKDIFAVEFIRDDIIKQVIDWQRAKAMSGNHKTKTVSEVSGTTKKP 64

Query: 65  YVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHA--LPKKVRSLALRHALSDKFCSND 122
           + QKGTG AR  S    Q RGGG + GP   +  HA  LPKKVR L L HALS+K  +  
Sbjct: 65  FKQKGTGNARQGSLRSIQMRGGGISHGPK--VRSHAIKLPKKVRKLGLIHALSEKCAAGK 122

Query: 123 IMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGIN 182
           +++I++L  ++ KT  LV         +  IIDG ++D NF LA +NI N  ++P  G N
Sbjct: 123 LLIINSLKLEKPKTSVLVNLLNKFQGQSFFIIDGNKVDTNFSLATKNIYNTLIVPQIGAN 182

Query: 183 VYDILRCSKLVLSKSAIEALEDRFK 207
           VYDI+R   ++LS+ A+  LE+R +
Sbjct: 183 VYDIIRHEYVLLSQEAVSFLEERLR 207


>gi|191639427|ref|YP_001988593.1| 50S ribosomal protein L4 [Lactobacillus casei BL23]
 gi|227533961|ref|ZP_03964010.1| 50S ribosomal protein L4 [Lactobacillus paracasei subsp. paracasei
           ATCC 25302]
 gi|239630350|ref|ZP_04673381.1| 50S ribosomal protein L4 [Lactobacillus paracasei subsp. paracasei
           8700:2]
 gi|301067502|ref|YP_003789525.1| 50S ribosomal protein L4 [Lactobacillus casei str. Zhang]
 gi|226730677|sp|B3WAL6|RL4_LACCB RecName: Full=50S ribosomal protein L4
 gi|190713729|emb|CAQ67735.1| 50S ribosomal protein L4 [Lactobacillus casei BL23]
 gi|227188338|gb|EEI68405.1| 50S ribosomal protein L4 [Lactobacillus paracasei subsp. paracasei
           ATCC 25302]
 gi|239527962|gb|EEQ66963.1| 50S ribosomal protein L4 [Lactobacillus paracasei subsp. paracasei
           8700:2]
 gi|300439909|gb|ADK19675.1| Ribosomal protein L4 [Lactobacillus casei str. Zhang]
 gi|327383516|gb|AEA54992.1| 50S ribosomal protein L4 [Lactobacillus casei LC2W]
 gi|327386709|gb|AEA58183.1| 50S ribosomal protein L4 [Lactobacillus casei BD-II]
          Length = 207

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 122/207 (58%), Gaps = 6/207 (2%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +++   DG + G + +++ I+A++P + ++   +  Q    R G    K RS V+  
Sbjct: 1   MANVTLYKQDGSENGKVELNDAIWAVEPNENVVFDAVVMQRASLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LPKKVR LA++  LS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGIVFGPTPRSYAYKLPKKVRRLAIKSVLSQKVLD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSN-ALII--DGCQLDRNFQLAARNIPNINLLP 177
           +D++V+D L     KTK   T    L +S+ AL++  DG ++      AARN+PN+ ++P
Sbjct: 121 SDLVVVDGLNFDAPKTKAFATVLDGLKVSDKALVVLEDGNEVAAK---AARNLPNVKVVP 177

Query: 178 VQGINVYDILRCSKLVLSKSAIEALED 204
            +GINV D++   KL+L++SA++ +E+
Sbjct: 178 AEGINVLDVVDYKKLILTQSALQKIEE 204


>gi|329121829|ref|ZP_08250444.1| 50S ribosomal protein L4 [Dialister micraerophilus DSM 19965]
 gi|327467767|gb|EGF13259.1| 50S ribosomal protein L4 [Dialister micraerophilus DSM 19965]
          Length = 207

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 121/204 (59%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N+ G+  G + +++ IF ++  + ++ + +  Q   +R+G   +K R  V   
Sbjct: 1   MPKVTLYNIAGQAAGEVELNDSIFGVEYNEAVIHQAVVRQQANERLGTHATKTRGLVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     + GGG  FGP P      + KK R LA++ ALS+K  +
Sbjct: 61  GKKPWRQKGTGRARVGSIRSPLWVGGGTVFGPTPRSHAKGMTKKARRLAVKSALSEKLRA 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+++VID +  +  KTK +V   +A + S ALIIDG +   N  L+ARNIP +  +   G
Sbjct: 121 NELIVIDQINFEAPKTKQVVEMMKAFEASKALIIDGGKAVENTVLSARNIPGVKAIGTCG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           IN+YD++  +KL +++ A++ +E+
Sbjct: 181 INIYDLVHYTKLFMTQEAVKQIEE 204


>gi|307244773|ref|ZP_07526874.1| ribosomal protein L4/L1 family protein [Peptostreptococcus stomatis
           DSM 17678]
 gi|306491871|gb|EFM63923.1| ribosomal protein L4/L1 family protein [Peptostreptococcus stomatis
           DSM 17678]
          Length = 207

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 75/206 (36%), Positives = 120/206 (58%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +++V N+ G++ G I +++ IF ++    +L   ++ Q   KR G   +K R+EV   
Sbjct: 1   MPKINVLNVSGQNVGEIELNDSIFNIEVNAHVLYEAVKCQLANKRQGTQSAKTRAEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+ GGG AF P P    ++LPKKVR LA++ ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSVQWVGGGVAFAPKPRDYSYSLPKKVRRLAMKSALSSKVQD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+I+V+D L  +  KTK +V  F+ L+ +  +++   + D N   + RNI   N+  V  
Sbjct: 121 NEIIVLDALSLEAPKTKEMVNTFKNLNAAKKVLVVTAENDANIVKSVRNIEGANVCHVST 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVYDIL C   +++  A++ +E+ +
Sbjct: 181 LNVYDILNCDSFIITTDAVKKVEEVY 206


>gi|224118096|ref|XP_002331557.1| predicted protein [Populus trichocarpa]
 gi|222873781|gb|EEF10912.1| predicted protein [Populus trichocarpa]
          Length = 285

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 78/211 (36%), Positives = 122/211 (57%), Gaps = 10/211 (4%)

Query: 4   LSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSK 63
           + V N   EDKG++ ++ D+F +  ++ I+ RV+RWQ  +++ G   +K  SEV+ TG K
Sbjct: 71  IPVTNFHNEDKGLMVLAGDVFDVPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK 130

Query: 64  MYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSD-----KF 118
            Y QKGTGRARH +    QFRGG    GP P      L KKVR L L+ AL+      +F
Sbjct: 131 PYRQKGTGRARHGTLRGPQFRGGAVMHGPKPRSHAFKLNKKVRRLGLKIALTAPIILIEF 190

Query: 119 CSNDIMVIDNLVSKECKTKYLVTRFRALDLSNA---LIIDGCQLDRNFQLAARNIPNINL 175
            +  ++V ++L     KTK +V     +++ N    L++DG  ++   +LA +N+  +NL
Sbjct: 191 LNAQLLVFEDLEVPTHKTKNIVN--YVIEMENTKKLLVVDGGPINEKLKLATQNLHYVNL 248

Query: 176 LPVQGINVYDILRCSKLVLSKSAIEALEDRF 206
           LP  G+NVY IL+   LV+S+ A+  + +R 
Sbjct: 249 LPSIGLNVYSILQHDTLVMSRDAVNKIVERM 279


>gi|313891529|ref|ZP_07825139.1| 50S ribosomal protein L4 [Dialister microaerophilus UPII 345-E]
 gi|313119988|gb|EFR43170.1| 50S ribosomal protein L4 [Dialister microaerophilus UPII 345-E]
          Length = 207

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 121/204 (59%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N+ G+  G + +++ IF ++  + ++ + +  Q   +R+G   +K R  V   
Sbjct: 1   MPKVTLYNIAGQAAGEVELNDSIFGVEYNEAVIHQAVVRQQANERLGTHATKTRGLVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     + GGG  FGP P      + KK R LA++ ALS+K  +
Sbjct: 61  GKKPWRQKGTGRARVGSIRSPLWVGGGTVFGPTPRSHAKGMTKKARRLAVKSALSEKLRA 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+++VID +  +  KTK +V   +A + S ALIIDG +   N  L+ARNIP +  +   G
Sbjct: 121 NELIVIDQINFEAPKTKQVVEMMKAFEASKALIIDGGKAVENTVLSARNIPGVKAIGTCG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           IN+YD++  +KL +++ A++ +E+
Sbjct: 181 INIYDLVHYTKLFITQEAVKQIEE 204


>gi|104773543|ref|YP_618523.1| 50S ribosomal protein L4 [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC 11842]
 gi|116513540|ref|YP_812446.1| 50S ribosomal protein L4 [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC BAA-365]
 gi|122275690|sp|Q04C14|RL4_LACDB RecName: Full=50S ribosomal protein L4
 gi|122397384|sp|Q1GBL7|RL4_LACDA RecName: Full=50S ribosomal protein L4
 gi|103422624|emb|CAI97232.1| 50S ribosomal protein L4 [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC 11842]
 gi|116092855|gb|ABJ58008.1| LSU ribosomal protein L4P [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC BAA-365]
 gi|325125176|gb|ADY84506.1| 50S ribosomal protein L4 [Lactobacillus delbrueckii subsp.
           bulgaricus 2038]
          Length = 205

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 118/204 (57%), Gaps = 2/204 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M    + + +G + G +++++++F+++P + ++   +  Q   KR G SK K RS V   
Sbjct: 1   MANFKLMDQNGNNAGEVTLNDNVFSVEPNEAVVFDAIIRQRAGKRQGTSKVKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    +++P+K R LA++  LS K   
Sbjct: 61  GKKPWRQKGTGRARQGSIRAPQWRGGGVVFGPTPRSYAYSMPRKQRRLAIKSVLSQKLLD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            +++V+D L     KT+  V     L L   +++     D+N QL+A+N+P + ++PV G
Sbjct: 121 QNLVVLDKLTMDAPKTRDFVAILNGLKLEGKVLV--VSDDKNVQLSAKNLPKVKVVPVNG 178

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV D +   KLVL++  ++ +E+
Sbjct: 179 LNVEDAVNYDKLVLTQDDVKKIEE 202


>gi|300812351|ref|ZP_07092786.1| 50S ribosomal protein L4 [Lactobacillus delbrueckii subsp.
           bulgaricus PB2003/044-T3-4]
 gi|300496656|gb|EFK31743.1| 50S ribosomal protein L4 [Lactobacillus delbrueckii subsp.
           bulgaricus PB2003/044-T3-4]
          Length = 205

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 118/204 (57%), Gaps = 2/204 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M    + + +G + G +++++++F+++P + ++   +  Q   KR G SK K RS V   
Sbjct: 1   MANFKLMDQNGNNAGEVTLNDNVFSVEPNEAVVFDAIIRQRAGKRQGTSKVKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    +++P+K R LA++  LS K   
Sbjct: 61  GKKPWRQKGTGRARQGSIRAPQWRGGGVVFGPTPRSYAYSMPRKQRRLAIKSVLSQKLLD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            +++V+D L     KTK  +     L L   +++     D+N QL+A+N+P + ++PV G
Sbjct: 121 QNLVVLDKLTLDAPKTKDFIAILNGLKLEGKVLV--VSDDKNVQLSAKNLPKVKVVPVNG 178

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV D +   KLVL++  ++ +E+
Sbjct: 179 LNVEDAVNYDKLVLTQDDVKKIEE 202


>gi|323342790|ref|ZP_08083022.1| 50S ribosomal protein L4 [Erysipelothrix rhusiopathiae ATCC 19414]
 gi|322463902|gb|EFY09096.1| 50S ribosomal protein L4 [Erysipelothrix rhusiopathiae ATCC 19414]
          Length = 209

 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 118/206 (57%), Gaps = 3/206 (1%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +L + NL+G+    + ++E +F ++P    +   +  Q    R G  K+K R+EV   
Sbjct: 1   MPKLDILNLEGKSLRELELNEAVFGIEPNNQTIFEAVVMQQASLRQGTHKTKNRTEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    ++L +KVR LALR ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYKYSLNRKVRRLALRSALSQKVMD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLS--NALIIDGCQLDRNFQLAARNIPNINLLPV 178
           +++ V++NL  +  KTK  +    AL L+     ++   +   N  L+ RN+ N  +L V
Sbjct: 121 SEMSVVENLTVENVKTKEFIAVMDALKLNKKTLFVVSAEENIDNAYLSMRNLSNTMMLDV 180

Query: 179 QGINVYDILRCSKLVLS-KSAIEALE 203
           QG+NVYDI+ C ++V + K+AIEA E
Sbjct: 181 QGLNVYDIVNCDQIVFTEKAAIEAGE 206


>gi|301059224|ref|ZP_07200161.1| 50S ribosomal protein L4 [delta proteobacterium NaphS2]
 gi|300446659|gb|EFK10487.1| 50S ribosomal protein L4 [delta proteobacterium NaphS2]
          Length = 207

 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 117/204 (57%), Gaps = 1/204 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  L V NL  E    + +++D+F++  ++ +L +V+  Q    R G + SK R+ V  +
Sbjct: 1   MTVLDVYNLQKEKVSEVELNKDVFSVPIKKHVLHQVVVAQLAGHRTGTAASKNRAAVKGS 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G+K++ QKGTGRAR    S    +GGG AFGP P      +PKKVR  ALR AL+DK   
Sbjct: 61  GAKLWRQKGTGRARVGKASSPTRKGGGVAFGPSPRSYDQKIPKKVRKSALRMALTDKVQC 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             + VID+    E KTK+ V      D+  ALI+   +   N + +++N+P I ++  +G
Sbjct: 121 EQLFVIDDFTLPEIKTKHFVEAMNQFDVQKALIVTN-EKSENLEKSSKNVPKIKVMRSEG 179

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NVYDIL+   L L + A++ +++
Sbjct: 180 LNVYDILKHDTLFLERMAVDKIQE 203


>gi|323703547|ref|ZP_08115193.1| ribosomal protein L4/L1e [Desulfotomaculum nigrificans DSM 574]
 gi|323531538|gb|EGB21431.1| ribosomal protein L4/L1e [Desulfotomaculum nigrificans DSM 574]
          Length = 206

 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 121/204 (59%), Gaps = 1/204 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N+ GE  G + + +++F ++P + ++  V+      +R G   +K R+EV   
Sbjct: 1   MPKVALYNISGEQIGEVELKDEVFGIEPNEAVMHDVVVMHLANQRQGTHDTKTRAEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     +R GG  FGP P    ++LPKKVR LAL+ ALS K   
Sbjct: 61  GRKPWRQKGTGRARAGSSRSPIWRKGGIVFGPHPRDYSYSLPKKVRRLALKSALSSKVLD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           ++I+V+D L  +  KTK +V+    L    AL++   + D N + +ARNIP +  +   G
Sbjct: 121 DNIIVLDKLTMEVPKTKEMVSILANLKADKALVVTADR-DINVEKSARNIPGVKPVKAGG 179

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           ++VYD+L+  KLV++K A+  +E+
Sbjct: 180 VSVYDLLKYDKLVITKDAVAKIEE 203


>gi|145351929|ref|XP_001420312.1| Putative mitochondrial ribosomal protein L4 [Ostreococcus
           lucimarinus CCE9901]
 gi|144580546|gb|ABO98605.1| Putative mitochondrial ribosomal protein L4 [Ostreococcus
           lucimarinus CCE9901]
          Length = 224

 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 79/203 (38%), Positives = 112/203 (55%), Gaps = 3/203 (1%)

Query: 4   LSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSK 63
           + V + DGE +G + +   IF    +  +  RV+RWQ  + R G  K+K R EVA +  K
Sbjct: 19  VPVYSFDGEARGSVELPGRIFDQPLRVDVAHRVVRWQRAKARKGLHKTKSRGEVAGSTRK 78

Query: 64  MYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDI 123
           +  QKG+GRAR  +    Q RGGG A GPV     HALPKKVR + L+ ALS K     +
Sbjct: 79  VRPQKGSGRARVGNLKAPQMRGGGTAHGPVVRSHAHALPKKVRRMGLKVALSAKAAEGKL 138

Query: 124 MVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINV 183
           +V+D+    E KT+ +      L     L   G +L R   ++ARN+P++ +LP  G NV
Sbjct: 139 IVVDSFAGMEPKTRAMKATLERLTGDLGLAAGGDELVR---MSARNLPHVEVLPQIGANV 195

Query: 184 YDILRCSKLVLSKSAIEALEDRF 206
           Y ILR   L+++KS +E L  R 
Sbjct: 196 YSILRRRTLIVTKSGLEQLIARL 218


>gi|116495946|ref|YP_807680.1| 50S ribosomal protein L4 [Lactobacillus casei ATCC 334]
 gi|122262654|sp|Q034Y4|RL4_LACC3 RecName: Full=50S ribosomal protein L4
 gi|116106096|gb|ABJ71238.1| LSU ribosomal protein L4P [Lactobacillus casei ATCC 334]
          Length = 207

 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 122/207 (58%), Gaps = 6/207 (2%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +++   DG + G + +++ I+A++P + ++   +  Q    R G    K RS V+  
Sbjct: 1   MANVTLYKQDGSENGKVELNDAIWAVEPNENVVFDAVVMQRDSLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LPKKVR LA++  LS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGIVFGPTPRSYAYKLPKKVRRLAIKSVLSQKVLD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSN-ALII--DGCQLDRNFQLAARNIPNINLLP 177
           +D++V+D L     KTK   T    L +S+ AL++  DG ++      AARN+PN+ ++P
Sbjct: 121 SDLVVVDGLNFDAPKTKAFATVLDGLKVSDKALVVLEDGNEVAAK---AARNLPNVKVVP 177

Query: 178 VQGINVYDILRCSKLVLSKSAIEALED 204
            +GINV D++   KL+L++SA++ +E+
Sbjct: 178 AEGINVLDVVDYKKLILTQSALQKIEE 204


>gi|125975385|ref|YP_001039295.1| 50S ribosomal protein L4P [Clostridium thermocellum ATCC 27405]
 gi|256005328|ref|ZP_05430294.1| ribosomal protein L4/L1e [Clostridium thermocellum DSM 2360]
 gi|281419347|ref|ZP_06250362.1| ribosomal protein L4/L1e [Clostridium thermocellum JW20]
 gi|166234659|sp|A3DJH3|RL4_CLOTH RecName: Full=50S ribosomal protein L4
 gi|125715610|gb|ABN54102.1| LSU ribosomal protein L4P [Clostridium thermocellum ATCC 27405]
 gi|255990764|gb|EEU00880.1| ribosomal protein L4/L1e [Clostridium thermocellum DSM 2360]
 gi|281406967|gb|EFB37230.1| ribosomal protein L4/L1e [Clostridium thermocellum JW20]
 gi|316939501|gb|ADU73535.1| ribosomal protein L4/L1e [Clostridium thermocellum DSM 1313]
          Length = 208

 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 126/209 (60%), Gaps = 5/209 (2%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ V +++G+  G I++ +DIF ++  +  + +V+  Q   +R G   +K +SEV   
Sbjct: 1   MPKVDVYDINGKVVGEINLRDDIFGIEVNKHAIHQVIVNQLANRRQGTQSTKTKSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRARH S   +Q+  GG A GP P    +A+PKK+R LAL+ ALS K   
Sbjct: 61  GRKPWRQKGTGRARHGSIRSAQWVKGGIALGPKPRSYKYAVPKKLRRLALKSALSSKVNE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRAL---DLSNALIIDGCQLDRNFQLAARNIPNINLLP 177
           N+++V+D+L   E KTK +    + L   D +  L++     +RN +L+ARNIP +  L 
Sbjct: 121 NELLVLDSLNFDEIKTKQMANVLKNLKVNDTTAVLVL--ADKNRNVELSARNIPGLKTLF 178

Query: 178 VQGINVYDILRCSKLVLSKSAIEALEDRF 206
           V  +NVYDI+R  K +++K A+  +E+ +
Sbjct: 179 VNTMNVYDIIRHDKFIITKDAVAKVEEVY 207


>gi|114567840|ref|YP_754994.1| 50S ribosomal protein L4/L1e [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
 gi|122317285|sp|Q0AUI1|RL4_SYNWW RecName: Full=50S ribosomal protein L4
 gi|114338775|gb|ABI69623.1| LSU ribosomal protein L4P [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
          Length = 207

 Score =  135 bits (340), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 118/206 (57%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ ++ G   G I +++ +F +KP Q ++   ++ Q   KR G + SK R+EV   
Sbjct: 1   MPKVALYDMSGAQVGEIELNDSVFGIKPNQAVMFDFVKMQLANKRAGTASSKTRAEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     +  GG AFGP P    + LP+KVR LA++ ALS K   
Sbjct: 61  GKKPWRQKGTGRARVGSSRNPVWTKGGVAFGPRPRDFSYRLPRKVRRLAMKSALSSKVLD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+I+V+D+L   E KT+ +V   ++L +    ++     D N   +ARNIP +  L    
Sbjct: 121 NNIVVLDSLTFDEPKTRLMVQTLKSLPVGKKTLVVTAYGDPNVIKSARNIPGVKPLRADF 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYD+L    L++++ A+  +E+ F
Sbjct: 181 INVYDLLNYDTLLITREAVARIEEVF 206


>gi|328953157|ref|YP_004370491.1| ribosomal protein L4/L1e [Desulfobacca acetoxidans DSM 11109]
 gi|328453481|gb|AEB09310.1| ribosomal protein L4/L1e [Desulfobacca acetoxidans DSM 11109]
          Length = 207

 Score =  135 bits (340), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 114/206 (55%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + V ++D    G +S+ +DIF +  Q  IL  V+  Q   +R G + +KGRSEV   
Sbjct: 1   MPVIDVYDIDRNKVGEVSLRDDIFNIPVQGHILHEVVTMQLACRRAGTASTKGRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     +RGGG  FGP P    +  PKKVR LAL+ ALS K   
Sbjct: 61  GHKPWRQKGTGRARVGSIRSPLWRGGGVVFGPKPRSYAYKPPKKVRRLALKMALSSKLAD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             ++++D       KTK  +       ++ AL I     ++   L++RN+P + ++  +G
Sbjct: 121 GQLLILDQYPYDSPKTKDFIRVLEKFQINKALFITADD-NQVLTLSSRNVPYVQIMRTEG 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYDILR   LV+ + AI  +E+RF
Sbjct: 180 INVYDILRYDHLVVFQPAISQIEERF 205


>gi|255635327|gb|ACU18017.1| unknown [Glycine max]
          Length = 312

 Score =  135 bits (339), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 77/204 (37%), Positives = 116/204 (56%), Gaps = 2/204 (0%)

Query: 4   LSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSK 63
           + V N   EDKG +    D+F L  ++ I+ RV+RWQ  +++ G   +K  SEV+ TG K
Sbjct: 104 IPVTNFHNEDKGYMVFPGDVFDLPIRKDIIHRVVRWQLAKRQQGTHSTKTISEVSGTGRK 163

Query: 64  MYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDI 123
            + QKGTGRARH S    QFRGG    GP P      + KKVR L L+ ALS +     +
Sbjct: 164 PWNQKGTGRARHGSLRGPQFRGGATMHGPKPRSHAFKVNKKVRCLGLKIALSARAAEGKL 223

Query: 124 MVIDNLVSKECKTKYLVTRFRAL-DLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGIN 182
           +V ++L     KTK +V  +  + D    L++DG  +D   +L+ +N+  +N+LP  G+N
Sbjct: 224 LVFEDLEVPTHKTKNIVNYYNQMEDTKKLLLVDGT-IDEKLKLSTQNLHYVNVLPSIGLN 282

Query: 183 VYDILRCSKLVLSKSAIEALEDRF 206
           VY IL    LV+S++A+  + +R 
Sbjct: 283 VYSILLHDTLVMSRAAVTKIVERM 306


>gi|237755897|ref|ZP_04584490.1| ribosomal protein, L4/L1 family [Sulfurihydrogenibium
           yellowstonense SS-5]
 gi|237691947|gb|EEP60962.1| ribosomal protein, L4/L1 family [Sulfurihydrogenibium
           yellowstonense SS-5]
          Length = 208

 Score =  135 bits (339), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 73/194 (37%), Positives = 117/194 (60%), Gaps = 3/194 (1%)

Query: 15  GVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGTGRAR 74
           G +++ EDIF  +  QG +  V++W    KR G + +K R+EVA +  K+Y QKGTGRAR
Sbjct: 14  GKVNLKEDIFKTEVNQGTVWEVIKWHLASKRAGTASTKTRAEVAGSNRKIYPQKGTGRAR 73

Query: 75  HSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNLVSKEC 134
           H  +  + F GGG A GP P     ALPKKVR   L+  L+ K  +N+++V+++   +  
Sbjct: 74  HGDRKANIFVGGGVAHGPHPRDYYFALPKKVRRKVLKGVLTYKLNNNELIVVEDFNFEAP 133

Query: 135 KTKYLVTRFRALDLSNA--LIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRCSKL 192
           KTK  +   ++  L N+  L++   +L+ N   + RNIP + +L  +GIN YD+L   K+
Sbjct: 134 KTKNAIEVLKSFGLENSKVLLVLPEKLE-NVIKSFRNIPKVKILLAEGINSYDVLNNDKV 192

Query: 193 VLSKSAIEALEDRF 206
           ++ KSA+E +++R 
Sbjct: 193 IIFKSALEKIQERL 206


>gi|297741766|emb|CBI32995.3| unnamed protein product [Vitis vinifera]
          Length = 315

 Score =  135 bits (339), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 117/204 (57%), Gaps = 1/204 (0%)

Query: 4   LSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSK 63
           + V N   EDKG + ++ D+F +  ++ I+ RV+RWQ  +++ G   +K  SEV+ TG K
Sbjct: 106 IPVTNFHNEDKGFMVLAGDVFDVPIRKDIVHRVVRWQLAKRQQGTHSTKTISEVSGTGRK 165

Query: 64  MYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDI 123
            + QKGTGRARH +    QFRGG    GP P      L KKVR L L+ ALS +     +
Sbjct: 166 PWRQKGTGRARHGTLRGPQFRGGAIMHGPKPRSHAIKLNKKVRRLGLKIALSARTAEGKL 225

Query: 124 MVIDNLVSKECKTKYLVTRFRALDLSNA-LIIDGCQLDRNFQLAARNIPNINLLPVQGIN 182
           +V D+L     KTK +V   + ++ +   L++DG  +    +LA +N+  +N+LP  G+N
Sbjct: 226 LVFDDLEVPSHKTKNIVNYVKEMENTKKLLLVDGGPITEKLKLATQNLHYVNVLPSIGLN 285

Query: 183 VYDILRCSKLVLSKSAIEALEDRF 206
           VY IL    LV+S+ A+  + +R 
Sbjct: 286 VYSILLHDTLVMSRDAVNKIVERM 309


>gi|255554769|ref|XP_002518422.1| 50S ribosomal protein L4, putative [Ricinus communis]
 gi|223542267|gb|EEF43809.1| 50S ribosomal protein L4, putative [Ricinus communis]
          Length = 294

 Score =  134 bits (338), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 118/204 (57%), Gaps = 1/204 (0%)

Query: 4   LSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSK 63
           + V N   EDKG + ++ D+F +  ++ I+ RV+RWQ  +++ G   +K  SEV+ TG K
Sbjct: 85  IPVTNFLNEDKGFMVLAGDVFDVPIKKHIIHRVVRWQLAKRQQGTHSTKTISEVSGTGKK 144

Query: 64  MYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDI 123
            Y QKGTGRARH +    QFRGG    GP P        KKVR L L+ AL+ +     +
Sbjct: 145 PYRQKGTGRARHGTLRGPQFRGGATMHGPKPRSHAIKCNKKVRRLGLKIALTARAAEGKL 204

Query: 124 MVIDNLVSKECKTKYLVTRFRALDLSNA-LIIDGCQLDRNFQLAARNIPNINLLPVQGIN 182
           +V ++L     KTK +V   + ++ +   L++DG  ++   +LAA+N+  +N+LP  G+N
Sbjct: 205 LVFEDLEIPTHKTKNIVNYVKQMEETKKLLLVDGGPINEKLKLAAQNLHYVNVLPSIGLN 264

Query: 183 VYDILRCSKLVLSKSAIEALEDRF 206
           VY IL    LV+S+ A+  + +R 
Sbjct: 265 VYSILLHDTLVMSRDAVNRIVERM 288


>gi|163783268|ref|ZP_02178261.1| 50S ribosomal protein L4 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159881376|gb|EDP74887.1| 50S ribosomal protein L4 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 199

 Score =  134 bits (338), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 75/196 (38%), Positives = 117/196 (59%), Gaps = 4/196 (2%)

Query: 15  GVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGTGRAR 74
           G I V +++F +K ++ +L  V++WQ   +R G   +K R EV Y+G K+  QKGTG AR
Sbjct: 4   GRIEVKDEVFNVKVKKHVLWEVVKWQLASRRQGTHSTKTRGEVNYSGRKILPQKGTGNAR 63

Query: 75  HSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNL-VSKE 133
           H  +  +   GGG A GP P    ++LPKKVR LAL+ ALSDK  + +++++D + +   
Sbjct: 64  HGDRGANILVGGGVAHGPRPRDYSYSLPKKVRKLALKMALSDKAQNKNVVIVDKIEIGDT 123

Query: 134 CKTKYLVT--RFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRCSK 191
            KTK  +   + + +D    L++   + D     + RN+PN  +LPV+G+NVYDIL   K
Sbjct: 124 PKTKKALEFLKKKKIDSEKVLVVT-PEKDELIMKSFRNLPNAKVLPVEGLNVYDILWSDK 182

Query: 192 LVLSKSAIEALEDRFK 207
           LV+ K A+E +  R +
Sbjct: 183 LVILKGALEGIYKRVE 198


>gi|37912990|gb|AAR05319.1| ribosomal protein L4 [uncultured marine alpha proteobacterium
           HOT2C01]
          Length = 229

 Score =  134 bits (338), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 69/205 (33%), Positives = 119/205 (58%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +++ +  +DG+  G +++ + +F  K    ++  ++RW    ++   +++K RSEV  T 
Sbjct: 24  MQIDMHKIDGKKSGSVNLKDQLFNSKSGLSVVGSLVRWSESNQKPLRARTKNRSEVKGTT 83

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+  QKG+G ARH SK  + FR GG A     +  +  +PK+ R  AL+H  +DK  +N
Sbjct: 84  QKLGRQKGSGGARHGSKKANIFRSGGMAHNLRGVRSLKKMPKRTRQEALKHIFADKLKNN 143

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           ++++++ L  +E KTK L      L+  +ALI++G + D NF LA+RN+ NI    +   
Sbjct: 144 NLIIVEELKIEEPKTKILAKSLSDLNAHSALILEGDKPDNNFVLASRNLKNIKYSSINNF 203

Query: 182 NVYDILRCSKLVLSKSAIEALEDRF 206
           N  D+L   KL++SK+A+E LE R 
Sbjct: 204 NALDLLGFEKLIMSKNALEILESRI 228


>gi|223944103|gb|ACN26135.1| unknown [Zea mays]
          Length = 197

 Score =  134 bits (337), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 72/186 (38%), Positives = 112/186 (60%), Gaps = 1/186 (0%)

Query: 22  DIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGTGRARHSSKSVS 81
           D+F +  ++ I+ RV+RWQ  +++ G   +K  SEV+ TG K Y QKGTG+ARH +   +
Sbjct: 6   DVFDVPIRKDIVHRVVRWQLAKRQQGTHSTKTISEVSGTGRKPYPQKGTGKARHGTLRGA 65

Query: 82  QFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNLVSKECKTKYLVT 141
           QFRGG    GP P      L KKVR L L+ ALS +     +++ ++L     KTK +V 
Sbjct: 66  QFRGGATMHGPKPRSHAIKLQKKVRRLGLKIALSARTAEGKLLIFEDLEVPSHKTKNIVQ 125

Query: 142 RFRALDLS-NALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRCSKLVLSKSAIE 200
             R +D S   L++DG  +D+  +LA +N+  +N+LP  G+NVY IL+   LV++++AI 
Sbjct: 126 YIRQMDDSKKVLLVDGGDIDKKLKLATQNLHYVNVLPSIGLNVYSILQHDTLVMTRAAIN 185

Query: 201 ALEDRF 206
            + +R 
Sbjct: 186 RIVERM 191


>gi|167629468|ref|YP_001679967.1| 50S ribosomal protein l4 [Heliobacterium modesticaldum Ice1]
 gi|226730671|sp|B0TC57|RL4_HELMI RecName: Full=50S ribosomal protein L4
 gi|167592208|gb|ABZ83956.1| 50S ribosomal protein l4 [Heliobacterium modesticaldum Ice1]
          Length = 207

 Score =  134 bits (337), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 78/208 (37%), Positives = 119/208 (57%), Gaps = 4/208 (1%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGIL--ARVLRWQSWRKRIGCSKSKGRSEVA 58
           M ++++ N +G   G I +++ IF ++P + ++  A V +  +WR+  G  K K R EV+
Sbjct: 1   MPKVALYNTEGAQVGEIELNDAIFGIEPNEAVMHQAVVTQLAAWRR--GTHKVKSRGEVS 58

Query: 59  YTGSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKF 118
             G K + QKGTGRAR  +     +RGG   FGP P     A+PKKVR LAL+ ALSDK 
Sbjct: 59  GGGKKPWRQKGTGRARAGTSRSPLWRGGAIIFGPQPRSYKIAMPKKVRRLALKSALSDKV 118

Query: 119 CSNDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPV 178
            S +++V+D L     KTK +      L +    ++    +D     +ARNIP ++ +  
Sbjct: 119 RSGNLIVVDALEMDAPKTKVIAGILNKLKVERKALLVTADIDETVFKSARNIPGVSPVEA 178

Query: 179 QGINVYDILRCSKLVLSKSAIEALEDRF 206
            GINVYDIL   KLV++K+A+  +E+ F
Sbjct: 179 VGINVYDILNHDKLVITKNAVAKVEEVF 206


>gi|295099236|emb|CBK88325.1| LSU ribosomal protein L4P [Eubacterium cylindroides T2-87]
          Length = 209

 Score =  134 bits (337), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 115/206 (55%), Gaps = 2/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + V N  G   G + +++ +F ++P Q  L   L  Q   +R G + +KGRSEV+  
Sbjct: 1   MATIDVINQTGAVVGSMELNDAVFGIEPNQQSLFDALVMQQASRRQGTADTKGRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K Y QKGTGRAR  S   +QFRGGG  FG  P    + + KKVR LA++ ALS+K  +
Sbjct: 61  GRKPYRQKGTGRARQGSIRATQFRGGGTVFGATPRSYKYTINKKVRRLAVKSALSEKLAA 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDL--SNALIIDGCQLDRNFQLAARNIPNINLLPV 178
             + V+D     E KTK  V+   A+        ++   +   N  L+ARNIP + +L  
Sbjct: 121 QALSVLDKFEISEPKTKTFVSIMEAIKAPKKTLFVVAENEEATNAYLSARNIPGVMMLTS 180

Query: 179 QGINVYDILRCSKLVLSKSAIEALED 204
            GINV+D++  + +V++ +A++ +E+
Sbjct: 181 TGINVFDLVNANAIVMTSAAVKEVEE 206


>gi|116628964|ref|YP_814136.1| 50S ribosomal protein L4 [Lactobacillus gasseri ATCC 33323]
 gi|238853482|ref|ZP_04643860.1| ribosomal protein, L4/L1 family [Lactobacillus gasseri 202-4]
 gi|282852650|ref|ZP_06261992.1| ribosomal protein L4/L1 family protein [Lactobacillus gasseri
           224-1]
 gi|300362388|ref|ZP_07058564.1| ribosomal protein L4/L1 family protein [Lactobacillus gasseri
           JV-V03]
 gi|311111236|ref|ZP_07712633.1| ribosomal protein L4/L1 family protein [Lactobacillus gasseri
           MV-22]
 gi|122274038|sp|Q046C4|RL4_LACGA RecName: Full=50S ribosomal protein L4
 gi|116094546|gb|ABJ59698.1| LSU ribosomal protein L4P [Lactobacillus gasseri ATCC 33323]
 gi|238833922|gb|EEQ26181.1| ribosomal protein, L4/L1 family [Lactobacillus gasseri 202-4]
 gi|282556392|gb|EFB62012.1| ribosomal protein L4/L1 family protein [Lactobacillus gasseri
           224-1]
 gi|300353379|gb|EFJ69251.1| ribosomal protein L4/L1 family protein [Lactobacillus gasseri
           JV-V03]
 gi|311066390|gb|EFQ46730.1| ribosomal protein L4/L1 family protein [Lactobacillus gasseri
           MV-22]
          Length = 205

 Score =  134 bits (336), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 115/204 (56%), Gaps = 2/204 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  L + +  G+  G + ++E+IF ++P + ++   +  Q   KR G S  K RS V   
Sbjct: 1   MANLEIIDQKGKSAGNVDLNEEIFGIEPNESVVFDAIIRQRAGKRQGTSAVKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P      +P+K R LA++  LS K   
Sbjct: 61  GKKPWRQKGTGRARQGSIRAPQWRGGGTVFGPTPRSYKMDMPRKARRLAMKSVLSQKVAD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            D++++D L  +  KTK L       ++S  +++     D+N QL+ +N+P + ++PV G
Sbjct: 121 KDLIILDQLTLEAPKTKELKAILDNANVSGKVLV--VSDDKNVQLSGKNLPKVKVVPVNG 178

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV D +   KLVL++ AI+ +E+
Sbjct: 179 LNVVDAVDYQKLVLTQDAIKRIEE 202


>gi|15605617|ref|NP_212990.1| 50S ribosomal protein L4 [Aquifex aeolicus VF5]
 gi|6647723|sp|O66432|RL4_AQUAE RecName: Full=50S ribosomal protein L4
 gi|2982768|gb|AAC06394.1| ribosomal protein L04 [Aquifex aeolicus VF5]
          Length = 199

 Score =  134 bits (336), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 74/191 (38%), Positives = 119/191 (62%), Gaps = 4/191 (2%)

Query: 15  GVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGTGRAR 74
           G + V +D+F +K ++ +L  V++WQ  ++R G   +K R EVAY+G K+  QKGTG AR
Sbjct: 4   GDVEVRDDVFNVKVKKHVLWEVVKWQLAKRRQGTHSTKTRGEVAYSGRKILPQKGTGNAR 63

Query: 75  HSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNL-VSKE 133
           H  + V+ F GGG A GP P    + LPK+VR L L+ ALSDK  +N I+ +DN+ + K+
Sbjct: 64  HGERGVNIFVGGGVAHGPKPRDYEYPLPKRVRKLGLKMALSDKARNNAIIFVDNIDLGKK 123

Query: 134 CKTKYLVTRFRALDL--SNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRCSK 191
            KTK  +   + L +     L++   + D  ++ + RN+PN+ +L  +G+NVYD+L  +K
Sbjct: 124 PKTKKAIEFLKNLGVEKEKVLVVIPEKADVLYK-SFRNLPNVRVLLPEGLNVYDVLWANK 182

Query: 192 LVLSKSAIEAL 202
           LV+ K  ++ +
Sbjct: 183 LVIQKDCLDRI 193


>gi|187251821|ref|YP_001876303.1| 50S ribosomal protein L4/L1e [Elusimicrobium minutum Pei191]
 gi|186971981|gb|ACC98966.1| Ribosomal protein L4/L1e [Elusimicrobium minutum Pei191]
          Length = 211

 Score =  134 bits (336), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 75/206 (36%), Positives = 116/206 (56%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +E  V N+ G+++G  ++ E +F+ KP    L  V+      +R G +  K R+EV+ TG
Sbjct: 1   METKVFNIQGKEEGTTALPEVLFSAKPNPTFLHEVVTAFLANQRRGTADVKTRAEVSGTG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K + QKGTGRARH S     +R GG AFGP P      LP + R  AL  ALS K+   
Sbjct: 61  KKPWKQKGTGRARHGSMRSPIWRHGGVAFGPTPRSFRQYLPAQKRRAALIQALSAKYAEG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLS-NALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           +++V ++   KE KTK L T  +A++     L++   + D    L+ARNI  ++L+P   
Sbjct: 121 NVIVFNDGGIKESKTKVLATALKAMEAGRKPLVLTTEKTDNKVFLSARNIAGLSLIPASD 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +N Y +L  SK++++K A+E L+  F
Sbjct: 181 VNAYVVLNSSKIIITKDALETLKSTF 206


>gi|258513641|ref|YP_003189863.1| 50S ribosomal protein L4 [Desulfotomaculum acetoxidans DSM 771]
 gi|257777346|gb|ACV61240.1| ribosomal protein L4/L1e [Desulfotomaculum acetoxidans DSM 771]
          Length = 206

 Score =  134 bits (336), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 119/204 (58%), Gaps = 1/204 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +++ N+ GE  G +++ +++F ++  + +L   +  Q   +R G   +K R EV   
Sbjct: 1   MPTVALFNIKGEQVGEVALKDEVFGIEVNESVLHDAVVMQLAGRRQGTHDTKTRGEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRARH +     +RGGG  FGP P    + LPKKVR LAL+ ALS K  +
Sbjct: 61  GKKPWRQKGTGRARHGTIRSPIWRGGGIVFGPHPRTYKYKLPKKVRRLALKSALSSKVLA 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            +I V+D L  +  KTK +V   + L +  AL++   + D N   +ARNIP I  +   G
Sbjct: 121 GNIKVLDALSMEMPKTKEMVGILKNLQVDKALLVIADK-DMNVIKSARNIPGIKPVGAAG 179

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NVYD+L+ + LV++K A+  +E+
Sbjct: 180 VNVYDLLKHTTLVITKDAVSKVEE 203


>gi|260664854|ref|ZP_05865705.1| ribosomal protein L4/L1 [Lactobacillus jensenii SJ-7A-US]
 gi|297205088|ref|ZP_06922484.1| ribosomal protein L4/L1 family protein [Lactobacillus jensenii
           JV-V16]
 gi|260561337|gb|EEX27310.1| ribosomal protein L4/L1 [Lactobacillus jensenii SJ-7A-US]
 gi|297149666|gb|EFH29963.1| ribosomal protein L4/L1 family protein [Lactobacillus jensenii
           JV-V16]
          Length = 205

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 119/204 (58%), Gaps = 2/204 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  L + +  G+D G +++++++F ++P + ++   +  Q    R G   +K RS V   
Sbjct: 1   MANLKLIDQTGKDAGEVTLNDNVFGIEPNENVVFDAVIRQRAGMRQGTHATKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    ++LP+KVR LA++  LS K   
Sbjct: 61  GKKPWRQKGTGRARQGSIRAPQWRGGGTVFGPTPRSYAYSLPRKVRRLAIKSVLSQKLQD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+++V+D L     KTK        L++ + +++     + N QL+ARN+ N+ ++PV G
Sbjct: 121 NNLIVLDQLSLDAPKTKEFKAVLGNLNVDSKVLV--VSDNENVQLSARNLENVKVVPVNG 178

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV D +   KL+L++ A++ +E+
Sbjct: 179 LNVVDAVNYDKLILTQDAVKRIEE 202


>gi|169350796|ref|ZP_02867734.1| hypothetical protein CLOSPI_01570 [Clostridium spiroforme DSM 1552]
 gi|169292382|gb|EDS74515.1| hypothetical protein CLOSPI_01570 [Clostridium spiroforme DSM 1552]
          Length = 207

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 116/204 (56%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M+++ V N +G +   + ++E +F ++P +  L  ++  Q    R G  K K R+EV+  
Sbjct: 1   MLKVKVYNQEGAEVKDLELNEAVFGIEPNKQALFDMVLLQRASLRQGTHKVKNRTEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P      L +KVR LAL+ ALS K   
Sbjct: 61  GKKPWRQKGTGRARQGSIRAPQWRGGGVVFGPTPRSYKFKLNRKVRRLALKSALSTKIID 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+ M ++ +     KTK +V     LD     +I   ++D N   +A NIP + LL  + 
Sbjct: 121 NEFMALEAIKFDAPKTKEMVKVLANLDAPTKTLIVVDEIDENVARSANNIPGVKLLDARR 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NVYDIL   KL+++++AI+++E+
Sbjct: 181 VNVYDILNSDKLIMTEAAIKSVEE 204


>gi|311029050|ref|ZP_07707140.1| 50S ribosomal protein L4 [Bacillus sp. m3-13]
          Length = 207

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 121/204 (59%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N  G + G + +++ +F ++P   +L   +  Q    R G +K KGRSEVA  
Sbjct: 1   MPKVALYNQAGANVGEVELADAVFGIEPNNSVLFDAIVMQRASLRQGTAKVKGRSEVAGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LPKKVR LA++ ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGIVFGPTPRSYSYKLPKKVRRLAIKSALSSKVLE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+++V++ L     KTK + +  + L+++   +I     D N  L+ARNIP + ++ V G
Sbjct: 121 NELLVLEGLAFDAPKTKEMTSVLKGLEINRKALIVTADADENVALSARNIPGVTVVTVTG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV D++   K++ +K A++ LE+
Sbjct: 181 VNVLDVVNHDKVIFTKDAVQKLEE 204


>gi|323490624|ref|ZP_08095829.1| 50S ribosomal protein L4 [Planococcus donghaensis MPA1U2]
 gi|323395716|gb|EGA88557.1| 50S ribosomal protein L4 [Planococcus donghaensis MPA1U2]
          Length = 207

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 111/204 (54%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N  G   G I +++ +F ++P + +L   +  Q    R G  K K RSEVA  
Sbjct: 1   MTKVALLNQTGSQVGEIELNDHVFGIQPNESVLFDAVVSQRASLRQGNHKVKNRSEVAGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LPKKVR LALR ALS     
Sbjct: 61  GKKPWRQKGTGRARQGSIRSPQWRGGGIVFGPTPRSYSYKLPKKVRRLALRSALSSAVVG 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            ++MV++ L     KTK        L +    +     LD N   +ARN+  + ++   G
Sbjct: 121 ENLMVLEGLTFDAPKTKSFNQLIADLSIGKKALFVTADLDENVAKSARNLKGMTVVAADG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           INV D+L   K+V++K+A+E +E+
Sbjct: 181 INVLDLLGHDKIVMTKAAVEKIEE 204


>gi|326803034|ref|YP_004320852.1| 50S ribosomal protein L4 [Aerococcus urinae ACS-120-V-Col10a]
 gi|326650179|gb|AEA00362.1| 50S ribosomal protein L4 [Aerococcus urinae ACS-120-V-Col10a]
          Length = 207

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 119/204 (58%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++   DG   G I V +DIFA++P +  +  V+  Q   +R G    K RS V+  
Sbjct: 1   MAKINLYKQDGSQNGEIEVKDDIFAIEPNETAIFDVILMQRASRRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+ GGG+AFGP P    + LP+KVR LALR ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRAPQWVGGGRAFGPTPRSYSYKLPRKVRRLALRSALSRKVSQ 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           ++++V+D L     KTK        L+++  +++   + + N  L+ARN+ N+ ++    
Sbjct: 121 DNLVVVDALSLDAPKTKEFKNILENLNVNEKVLVVVDKDNTNAHLSARNLSNVTVVDEDN 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NVYD+   +K+++++SA+  +E+
Sbjct: 181 VNVYDLENHAKVLITQSALSNVEE 204


>gi|299820956|ref|ZP_07052845.1| ribosomal protein L4/L1 family protein [Listeria grayi DSM 20601]
 gi|299817977|gb|EFI85212.1| ribosomal protein L4/L1 family protein [Listeria grayi DSM 20601]
          Length = 207

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 121/205 (59%), Gaps = 2/205 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +LS+   DG   G I++++ +F ++P + ++  V+  Q    R G  K K RSEV   
Sbjct: 1   MPKLSLLKQDGTSAGEITLNDAVFGIEPNEKVVVDVILSQRASLRQGTHKVKNRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LP+KVR LA++ ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYAYKLPRKVRRLAIKSALSSKVKE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDL-SNALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
            +++V++NL     KTK      + + + + AL++   + D N +L+ARN+  I ++P +
Sbjct: 121 ENLLVLENLAFDAPKTKDFAAFLKNISVDTKALVVVAGESD-NVELSARNLQGITVIPAE 179

Query: 180 GINVYDILRCSKLVLSKSAIEALED 204
            I+V ++    KL+++K+A+E +E+
Sbjct: 180 SISVLEVASHDKLIITKAAVEKVEE 204


>gi|229552709|ref|ZP_04441434.1| ribosomal protein L4 [Lactobacillus rhamnosus LMS2-1]
 gi|229313915|gb|EEN79888.1| ribosomal protein L4 [Lactobacillus rhamnosus LMS2-1]
          Length = 207

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 75/207 (36%), Positives = 120/207 (57%), Gaps = 6/207 (2%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +++   DG + G + +++ I+A++P + ++   +  Q    R G    K RS V+  
Sbjct: 1   MANVTLYKQDGSENGTVELNDAIWAVEPNENVVFDAVVMQRASLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LPKKVR LA++  LS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGIVFGPTPRSYAYKLPKKVRRLAIKSVLSQKVLD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSN-ALII--DGCQLDRNFQLAARNIPNINLLP 177
            D++V+D L   + KTK  +     L +++ AL++  DG  +      AARN+PN+ ++P
Sbjct: 121 GDLVVVDGLSFDDPKTKAFLNVLDGLKVNDKALVVLEDGNDVAAK---AARNLPNVKVVP 177

Query: 178 VQGINVYDILRCSKLVLSKSAIEALED 204
            +GINV D +   KL+L++SA++ +E+
Sbjct: 178 AEGINVLDAVNYKKLILTQSALQKIEE 204


>gi|116873997|ref|YP_850778.1| 50S ribosomal protein L4 [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|123461454|sp|A0ALW7|RL4_LISW6 RecName: Full=50S ribosomal protein L4
 gi|116742875|emb|CAK21999.1| ribosomal protein L4 [Listeria welshimeri serovar 6b str. SLCC5334]
          Length = 207

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 116/204 (56%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +LS+   DG + G I++++ +F ++P + ++  V+  Q    R G  K K RSEV   
Sbjct: 1   MPKLSLLKQDGTNAGEITLNDTVFGIEPNEKVVVDVILSQRASLRQGTHKVKNRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LPKKVR LA++  LS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYAYKLPKKVRRLAIKSILSSKVNE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             ++V++ L     KTK   T  + + +    +I       N +L+ARN+  I ++P + 
Sbjct: 121 EKLVVLEGLTFDAPKTKEFATFLKNISVDTKALIVVAGESENVELSARNLQGITVIPAES 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           I+V ++ +  KL+++K+A+E +E+
Sbjct: 181 ISVLEVAKHDKLIITKAAVEKVEE 204


>gi|301118172|ref|XP_002906814.1| 50S ribosomal protein L4 [Phytophthora infestans T30-4]
 gi|262108163|gb|EEY66215.1| 50S ribosomal protein L4 [Phytophthora infestans T30-4]
          Length = 277

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 122/207 (58%), Gaps = 2/207 (0%)

Query: 2   IELSVRNL--DGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAY 59
           +EL + +L  D +D G IS+  ++F    +  IL RV+RWQ   +R G +K+K RSEV+ 
Sbjct: 68  LELKMLSLAEDTQDLGSISMDGEVFGAPDRVDILQRVVRWQLACRRAGTNKTKTRSEVSG 127

Query: 60  TGSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFC 119
           +  K + QKG+GRAR       Q+RGG +  GPV     ++LPKKVR++ LR ALS K  
Sbjct: 128 STRKPWKQKGSGRARVGDIRAPQWRGGYRVHGPVLRDFSYSLPKKVRAMGLRVALSTKLR 187

Query: 120 SNDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
              + ++D+L     KTK +          +AL + G +++ +F LA RNIP+++ L   
Sbjct: 188 EGKLAIVDSLDVDITKTKDMKKLLGGRGWDHALFVGGEEVESSFVLATRNIPHVDTLAQN 247

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRF 206
            INVY IL+   L+++K A++ LE+R 
Sbjct: 248 KINVYSILQKDLLIITKDAVKYLEERL 274


>gi|224542239|ref|ZP_03682778.1| hypothetical protein CATMIT_01414 [Catenibacterium mitsuokai DSM
           15897]
 gi|224524781|gb|EEF93886.1| hypothetical protein CATMIT_01414 [Catenibacterium mitsuokai DSM
           15897]
          Length = 215

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 118/207 (57%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M+ +++ N +GE    + ++E++F ++P    +  V+  Q    R G  K K R EV+  
Sbjct: 9   MLNIALFNQNGEKLNDLELNENVFGIEPNNQAIFDVVLLQRASLRQGTHKVKNRHEVSGG 68

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P      + KKV++LALR  LS K   
Sbjct: 69  GKKPWRQKGTGRARQGSIRAPQWRGGGIVFGPTPRSYDFKINKKVKNLALRSVLSQKVID 128

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            +++ +D +  +  KTK +V      +     +I   +L+ N  L+ARN+P + ++    
Sbjct: 129 QELVALDAIAFETIKTKNVVNFLGNFENPRKTLIVVDKLEENLVLSARNVPGVKVIEASN 188

Query: 181 INVYDILRCSKLVLSKSAIEALEDRFK 207
           +NVYD++ C+KL++++ AI+A+E+  K
Sbjct: 189 VNVYDVMDCTKLMMTEKAIKAVEEVLK 215


>gi|256852037|ref|ZP_05557424.1| ribosomal protein L4/L1 [Lactobacillus jensenii 27-2-CHN]
 gi|260661394|ref|ZP_05862307.1| ribosomal protein L4/L1 [Lactobacillus jensenii 115-3-CHN]
 gi|256615449|gb|EEU20639.1| ribosomal protein L4/L1 [Lactobacillus jensenii 27-2-CHN]
 gi|260547849|gb|EEX23826.1| ribosomal protein L4/L1 [Lactobacillus jensenii 115-3-CHN]
          Length = 205

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 119/204 (58%), Gaps = 2/204 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  L + +  G+D G +++++++F ++P + ++   +  Q    R G   +K RS V   
Sbjct: 1   MANLKLIDQTGKDAGEVTLNDNVFGIEPNENVVFDAVIRQRAGMRQGTHATKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    ++LP+KVR LA++  LS K   
Sbjct: 61  GKKPWRQKGTGRARQGSIRAPQWRGGGTVFGPTPRSYAYSLPRKVRRLAIKSVLSQKLQD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+++++D L     KTK        L++ + +++     + N QL+ARN+ N+ ++PV G
Sbjct: 121 NNLIILDQLSLDAPKTKEFKAVLGNLNVDSKVLV--VSDNENVQLSARNLENVKVVPVNG 178

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV D +   KL+L++ A++ +E+
Sbjct: 179 LNVVDAVNYDKLILTQDAVKRIEE 202


>gi|320352918|ref|YP_004194257.1| 50S ribosomal protein L4P [Desulfobulbus propionicus DSM 2032]
 gi|320121420|gb|ADW16966.1| LSU ribosomal protein L4P [Desulfobulbus propionicus DSM 2032]
          Length = 207

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 76/206 (36%), Positives = 116/206 (56%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M    + N   E  G I ++E +F L+   GIL  V+  Q   +R G + +K R EV+  
Sbjct: 1   MATCDIYNTRAEKVGEIDLNESLFNLEVNTGILHEVVCMQRANRRSGNACTKTRGEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G+K + QKGTGRAR  S++   +RGGG  FGP P    +++PKKV+ LAL+ A+S +   
Sbjct: 61  GAKPWRQKGTGRARSGSRTSPVWRGGGTVFGPKPRDYSYSMPKKVKRLALKMAMSARCQE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            +I+++D       KTK  +         N L++     D N  L+ARN     +LPV G
Sbjct: 121 GNIVIVDQFDLPAVKTKEFLKVMTNFQFENCLVVTAESED-NLGLSARNAVGFKVLPVAG 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVYDIL+ SKL++ +S++  +E+R 
Sbjct: 180 LNVYDILKHSKLMILQSSLAKIEERL 205


>gi|117924156|ref|YP_864773.1| 50S ribosomal protein L4P [Magnetococcus sp. MC-1]
 gi|166234681|sp|A0L5X4|RL4_MAGSM RecName: Full=50S ribosomal protein L4
 gi|117607912|gb|ABK43367.1| LSU ribosomal protein L4P [Magnetococcus sp. MC-1]
          Length = 207

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 117/206 (56%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           MI++ V++ + ++     ++E +F  + +  +L   + +Q  ++R+G +   GRS+V   
Sbjct: 1   MIQVPVKDANNQEVRSTELNESVFGREIRADLLGMAVNYQLAKRRLGTATVLGRSDVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K Y QKGTG AR  +    QFR GG  FGP      H L KKVR LAL+ ALS K  S
Sbjct: 61  GKKPYRQKGTGNARQGTIRAPQFRTGGIVFGPQQRDYSHKLNKKVRKLALQTALSVKASS 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            +++V+D L     KTK +      L  + +  +   +L     L+ARNIPN+ +  V G
Sbjct: 121 EEMVVVDKLELASIKTKEMKALLSTLGAARSTFLVVKELSNEIVLSARNIPNVMVADVDG 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVYD+LR  KLV+++ A+ +LE++ 
Sbjct: 181 VNVYDLLRYEKLVITEEAVRSLEEKL 206


>gi|70725804|ref|YP_252718.1| 50S ribosomal protein L4 [Staphylococcus haemolyticus JCSC1435]
 gi|82581594|sp|Q4L8B3|RL4_STAHJ RecName: Full=50S ribosomal protein L4
 gi|68446528|dbj|BAE04112.1| 50S ribosomal protein L4 [Staphylococcus haemolyticus JCSC1435]
          Length = 207

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 108/204 (52%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M    V  +DG   G + +S+ +FA++P   +L   +  Q    R G    K RS V   
Sbjct: 1   MANYDVLKVDGSKSGSVELSDSVFAIEPNNSVLFEAINLQRASLRQGTHAVKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  +    Q+RGGG  FGP P    + +PKK+R LALR ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGTIRAPQWRGGGIVFGPTPRSYAYKMPKKMRRLALRSALSFKVKE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+  ++DN   +  KTK        L+    +++     D N +L+ARNIP + +   QG
Sbjct: 121 NNFTIVDNFGFEAPKTKEFKNVLTTLEQPKKVLVVTDSEDVNVELSARNIPGVQVSTAQG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV DI     +++++SA + +E+
Sbjct: 181 LNVLDITSADSVIITESAAKKVEE 204


>gi|49484465|ref|YP_041689.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|257423734|ref|ZP_05600163.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257426412|ref|ZP_05602814.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257429051|ref|ZP_05605438.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257434658|ref|ZP_05610709.1| LSU ribosomal protein L4/L1 [Staphylococcus aureus subsp. aureus
           M876]
 gi|282902152|ref|ZP_06310045.1| ribosomal protein L4/L1 family protein [Staphylococcus aureus
           subsp. aureus C160]
 gi|282906592|ref|ZP_06314440.1| 50S ribosomal protein L4/L1 [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282909562|ref|ZP_06317373.1| ribosomal protein L4/L1 [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282911809|ref|ZP_06319605.1| ribosomal protein L4/L1 [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282915098|ref|ZP_06322875.1| ribosomal protein L4 [Staphylococcus aureus subsp. aureus M899]
 gi|282920824|ref|ZP_06328542.1| 50S ribosomal protein L4/L1 [Staphylococcus aureus subsp. aureus
           C427]
 gi|282925729|ref|ZP_06333377.1| 50S ribosomal protein L4/L1 [Staphylococcus aureus subsp. aureus
           C101]
 gi|283959027|ref|ZP_06376468.1| ribosomal protein L4/L1 family protein [Staphylococcus aureus
           subsp. aureus A017934/97]
 gi|293497502|ref|ZP_06665356.1| 50S ribosomal protein L4/L1 [Staphylococcus aureus subsp. aureus
           58-424]
 gi|293511077|ref|ZP_06669774.1| 50S ribosomal protein L4/L1 [Staphylococcus aureus subsp. aureus
           M809]
 gi|293549683|ref|ZP_06672355.1| ribosomal protein L4 [Staphylococcus aureus subsp. aureus M1015]
 gi|295428832|ref|ZP_06821456.1| 50S ribosomal protein L4/L1 [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|297589682|ref|ZP_06948323.1| ribosomal protein L4/L1 family protein [Staphylococcus aureus
           subsp. aureus MN8]
 gi|56749402|sp|Q6GEI4|RL4_STAAR RecName: Full=50S ribosomal protein L4
 gi|49242594|emb|CAG41315.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|257272752|gb|EEV04854.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257276043|gb|EEV07494.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257279532|gb|EEV10119.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257285254|gb|EEV15370.1| LSU ribosomal protein L4/L1 [Staphylococcus aureus subsp. aureus
           M876]
 gi|282312558|gb|EFB42962.1| 50S ribosomal protein L4/L1 [Staphylococcus aureus subsp. aureus
           C101]
 gi|282315239|gb|EFB45623.1| 50S ribosomal protein L4/L1 [Staphylococcus aureus subsp. aureus
           C427]
 gi|282320819|gb|EFB51153.1| ribosomal protein L4 [Staphylococcus aureus subsp. aureus M899]
 gi|282323505|gb|EFB53821.1| ribosomal protein L4/L1 [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282326541|gb|EFB56843.1| ribosomal protein L4/L1 [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282329491|gb|EFB59012.1| 50S ribosomal protein L4/L1 [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282596611|gb|EFC01570.1| ribosomal protein L4/L1 family protein [Staphylococcus aureus
           subsp. aureus C160]
 gi|283788619|gb|EFC27446.1| ribosomal protein L4/L1 family protein [Staphylococcus aureus
           subsp. aureus A017934/97]
 gi|290918730|gb|EFD95806.1| ribosomal protein L4 [Staphylococcus aureus subsp. aureus M1015]
 gi|291096433|gb|EFE26691.1| 50S ribosomal protein L4/L1 [Staphylococcus aureus subsp. aureus
           58-424]
 gi|291466064|gb|EFF08593.1| 50S ribosomal protein L4/L1 [Staphylococcus aureus subsp. aureus
           M809]
 gi|295127181|gb|EFG56823.1| 50S ribosomal protein L4/L1 [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|297578193|gb|EFH96906.1| ribosomal protein L4/L1 family protein [Staphylococcus aureus
           subsp. aureus MN8]
 gi|312437340|gb|ADQ76411.1| ribosomal protein L4/L1 family protein [Staphylococcus aureus
           subsp. aureus TCH60]
 gi|315193501|gb|EFU23897.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus
           CGS00]
          Length = 207

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 107/204 (52%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M    V  LDG   G I +S+ +F ++P   +L   +  Q    R G    K RS V+  
Sbjct: 1   MANYDVLKLDGTKSGSIELSDAVFGIEPNNSVLFEAINLQRASLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  +    Q+RGGG  FGP P    + +PKK+R LALR ALS K   
Sbjct: 61  GRKPWKQKGTGRARQGTIRAPQWRGGGIVFGPTPRSYAYKMPKKMRRLALRSALSFKVQE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N + V+D    +  KTK        L+    +++     D N +L+ARNIP + +   QG
Sbjct: 121 NGLTVVDAFNFEAPKTKEFKNVLSTLEQPKKVLVVTENEDVNVELSARNIPGVQVTTAQG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV DI     LV++++A + +E+
Sbjct: 181 LNVLDITNADSLVITEAAAKKVEE 204


>gi|307110022|gb|EFN58259.1| hypothetical protein CHLNCDRAFT_142203 [Chlorella variabilis]
          Length = 322

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 81/209 (38%), Positives = 123/209 (58%), Gaps = 10/209 (4%)

Query: 8   NLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQ 67
           +L  +  G +++  DIF +  ++ IL RV+RWQ  +++ G  K+K RSEV   G K   Q
Sbjct: 105 DLSRQPVGTVTLGGDIFDVPIRRDILHRVVRWQLAKRQQGTHKTKTRSEVRGGGRKPRPQ 164

Query: 68  KGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVID 127
           KG+GR+R  +    Q+RGGG A GPVP    H LPK+VR L L+ ALS K     ++V+D
Sbjct: 165 KGSGRSRQGTIRAPQWRGGGVAHGPVPRSHEHDLPKRVRRLGLQCALSAKAWERRLLVVD 224

Query: 128 NLVSKECKTKYLVTRFRALDLSNA-----LIIDGCQLDRN----FQLAARNIPNINLLPV 178
           +L   E KTK ++    AL L++A     L+ D  +L  +     +  A N+P ++ +P 
Sbjct: 225 SLQPAEPKTKVMLDNVDAL-LADAPRRSVLLCDSSKLGEDGGEVLRRTAANLPWVDCIPQ 283

Query: 179 QGINVYDILRCSKLVLSKSAIEALEDRFK 207
           QG+NVY IL+   LVL+K A++ L +R +
Sbjct: 284 QGLNVYSILQRDYLVLTKRAVDLLMERLR 312


>gi|164686528|ref|ZP_02210556.1| hypothetical protein CLOBAR_00095 [Clostridium bartlettii DSM
           16795]
 gi|164604397|gb|EDQ97862.1| hypothetical protein CLOBAR_00095 [Clostridium bartlettii DSM
           16795]
          Length = 207

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 118/206 (57%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +L+V N+ G++ G I +S+ +F ++  + +L  V++ Q   KR G   +K R+EV   
Sbjct: 1   MPKLNVLNIQGQNVGEIELSDAVFGVEVNEHVLYEVVKNQLANKRQGTQSAKTRAEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+ GGG AF P P    + LPKKVR LA++ AL+ K  +
Sbjct: 61  GRKPWRQKGTGRARQGSIRAVQWIGGGVAFAPKPRSYRYTLPKKVRRLAMKSALTSKVQA 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+++V+D L     KTK   T    ++ +   ++   + + N   +A NIPN+    V  
Sbjct: 121 NEMIVLDALTMDAPKTKEFATILNNVNAAKKALVVMAEKNENVIKSAANIPNVETALVNT 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYDIL+    +++  A++ +E+ +
Sbjct: 181 INVYDILKYDSFIITTDAVKKVEEVY 206


>gi|299143193|ref|ZP_07036273.1| ribosomal protein L4/L1 family protein [Peptoniphilus sp. oral
           taxon 386 str. F0131]
 gi|298517678|gb|EFI41417.1| ribosomal protein L4/L1 family protein [Peptoniphilus sp. oral
           taxon 386 str. F0131]
          Length = 207

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 116/206 (56%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ V N++G     I ++E+IF +   +  +  V++     +R G   +K R+EV   
Sbjct: 1   MPKIQVVNMEGAAVSEIELNENIFDIDINEHAVYLVVKNILANRRQGTKSAKTRAEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  F P P    +  PKKVR LALR AL+ K   
Sbjct: 61  GRKPWKQKGTGRARQGSIRSPQWRGGGIVFAPKPRDFSYTTPKKVRRLALRSALTSKVRE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+++V+D++   + KTK  V   +A+      ++     D   ++AARNIPN+     + 
Sbjct: 121 NEMIVVDDIKMNDAKTKNFVQMLKAIKADPKALVVVAGYDEKVKIAARNIPNVKTTMAEN 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYDIL+ + LV+++ A+  +E+ F
Sbjct: 181 INVYDILKYNSLVITEDALRVIEEVF 206


>gi|15925239|ref|NP_372773.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus Mu50]
 gi|15927829|ref|NP_375362.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus N315]
 gi|21283897|ref|NP_646985.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus MW2]
 gi|49487031|ref|YP_044252.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57650833|ref|YP_187048.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus COL]
 gi|82751838|ref|YP_417579.1| 50S ribosomal protein L4 [Staphylococcus aureus RF122]
 gi|87160155|ref|YP_494838.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|88196161|ref|YP_500978.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus NCTC
           8325]
 gi|148268689|ref|YP_001247632.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus JH9]
 gi|150394754|ref|YP_001317429.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus JH1]
 gi|151222363|ref|YP_001333185.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus str.
           Newman]
 gi|156980564|ref|YP_001442823.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus Mu3]
 gi|221140149|ref|ZP_03564642.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus str.
           JKD6009]
 gi|253317009|ref|ZP_04840222.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus str.
           CF-Marseille]
 gi|253729915|ref|ZP_04864080.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253734342|ref|ZP_04868507.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|255007029|ref|ZP_05145630.2| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus
           Mu50-omega]
 gi|257794595|ref|ZP_05643574.1| 50S ribosomal protein L4/L1 [Staphylococcus aureus A9781]
 gi|258408803|ref|ZP_05681087.1| 50S ribosomal protein L4 [Staphylococcus aureus A9763]
 gi|258422402|ref|ZP_05685314.1| LSU ribosomal protein L4/L1 [Staphylococcus aureus A9719]
 gi|258422696|ref|ZP_05685601.1| LSU ribosomal protein L4/L1 [Staphylococcus aureus A9635]
 gi|258439791|ref|ZP_05690537.1| ribosomal protein L4 [Staphylococcus aureus A9299]
 gi|258442653|ref|ZP_05691213.1| ribosomal protein L4/L1e [Staphylococcus aureus A8115]
 gi|258446648|ref|ZP_05694803.1| 50S ribosomal protein L4 [Staphylococcus aureus A6300]
 gi|258450234|ref|ZP_05698326.1| 50S ribosomal protein L4 [Staphylococcus aureus A6224]
 gi|258450756|ref|ZP_05698815.1| ribosomal protein L4/L1e [Staphylococcus aureus A5948]
 gi|258455394|ref|ZP_05703354.1| ribosomal protein L4/L1e [Staphylococcus aureus A5937]
 gi|262048513|ref|ZP_06021397.1| 50S ribosomal protein L4 [Staphylococcus aureus D30]
 gi|262052038|ref|ZP_06024249.1| 50S ribosomal protein L4 [Staphylococcus aureus 930918-3]
 gi|269203882|ref|YP_003283151.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus ED98]
 gi|282893687|ref|ZP_06301919.1| 50S ribosomal protein L4/L1 [Staphylococcus aureus A8117]
 gi|282917594|ref|ZP_06325346.1| 50S ribosomal protein L4/L1 [Staphylococcus aureus subsp. aureus
           D139]
 gi|282922118|ref|ZP_06329814.1| 50S ribosomal protein L4/L1 [Staphylococcus aureus A9765]
 gi|283767341|ref|ZP_06340256.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus H19]
 gi|284025275|ref|ZP_06379673.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus 132]
 gi|294848782|ref|ZP_06789527.1| 50S ribosomal protein L4/L1 [Staphylococcus aureus A9754]
 gi|295404925|ref|ZP_06814738.1| 50S ribosomal protein L4/L1 [Staphylococcus aureus A8819]
 gi|296275960|ref|ZP_06858467.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus MR1]
 gi|297209938|ref|ZP_06926334.1| ribosomal protein L4/L1 family protein [Staphylococcus aureus
           subsp. aureus ATCC 51811]
 gi|297243983|ref|ZP_06927873.1| 50S ribosomal protein L4/L1 [Staphylococcus aureus A8796]
 gi|300910950|ref|ZP_07128400.1| ribosomal protein L4/L1 family protein [Staphylococcus aureus
           subsp. aureus TCH70]
 gi|304379433|ref|ZP_07362168.1| ribosomal protein L4/L1 family protein [Staphylococcus aureus
           subsp. aureus ATCC BAA-39]
 gi|46577149|sp|P61058|RL4_STAAM RecName: Full=50S ribosomal protein L4
 gi|46577150|sp|P61059|RL4_STAAN RecName: Full=50S ribosomal protein L4
 gi|46577151|sp|P61060|RL4_STAAW RecName: Full=50S ribosomal protein L4
 gi|56749373|sp|Q6G772|RL4_STAAS RecName: Full=50S ribosomal protein L4
 gi|81693960|sp|Q5HDV9|RL4_STAAC RecName: Full=50S ribosomal protein L4
 gi|109893640|sp|Q2FEP0|RL4_STAA3 RecName: Full=50S ribosomal protein L4
 gi|109893641|sp|Q2YYP7|RL4_STAAB RecName: Full=50S ribosomal protein L4
 gi|122538859|sp|Q2FW07|RL4_STAA8 RecName: Full=50S ribosomal protein L4
 gi|166199911|sp|A7X5G2|RL4_STAA1 RecName: Full=50S ribosomal protein L4
 gi|172049047|sp|A6QJ91|RL4_STAAE RecName: Full=50S ribosomal protein L4
 gi|189042887|sp|A6U3X4|RL4_STAA2 RecName: Full=50S ribosomal protein L4
 gi|189042888|sp|A5IV33|RL4_STAA9 RecName: Full=50S ribosomal protein L4
 gi|13702049|dbj|BAB43341.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus N315]
 gi|14248022|dbj|BAB58411.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus Mu50]
 gi|21205339|dbj|BAB96033.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus MW2]
 gi|49245474|emb|CAG43951.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57285019|gb|AAW37113.1| ribosomal protein L4 [Staphylococcus aureus subsp. aureus COL]
 gi|82657369|emb|CAI81810.1| 50S ribosomal protein L4 [Staphylococcus aureus RF122]
 gi|87126129|gb|ABD20643.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|87203719|gb|ABD31529.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           NCTC 8325]
 gi|147741758|gb|ABQ50056.1| LSU ribosomal protein L4P [Staphylococcus aureus subsp. aureus JH9]
 gi|149947206|gb|ABR53142.1| ribosomal protein L4/L1e [Staphylococcus aureus subsp. aureus JH1]
 gi|150375163|dbj|BAF68423.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus str.
           Newman]
 gi|156722699|dbj|BAF79116.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus Mu3]
 gi|253726362|gb|EES95091.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253727659|gb|EES96388.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|257788567|gb|EEV26907.1| 50S ribosomal protein L4/L1 [Staphylococcus aureus A9781]
 gi|257840486|gb|EEV64946.1| 50S ribosomal protein L4 [Staphylococcus aureus A9763]
 gi|257841833|gb|EEV66270.1| LSU ribosomal protein L4/L1 [Staphylococcus aureus A9719]
 gi|257847107|gb|EEV71116.1| LSU ribosomal protein L4/L1 [Staphylococcus aureus A9635]
 gi|257847567|gb|EEV71569.1| ribosomal protein L4 [Staphylococcus aureus A9299]
 gi|257851774|gb|EEV75708.1| ribosomal protein L4/L1e [Staphylococcus aureus A8115]
 gi|257854716|gb|EEV77664.1| 50S ribosomal protein L4 [Staphylococcus aureus A6300]
 gi|257856326|gb|EEV79235.1| 50S ribosomal protein L4 [Staphylococcus aureus A6224]
 gi|257861539|gb|EEV84341.1| ribosomal protein L4/L1e [Staphylococcus aureus A5948]
 gi|257862605|gb|EEV85373.1| ribosomal protein L4/L1e [Staphylococcus aureus A5937]
 gi|259160093|gb|EEW45126.1| 50S ribosomal protein L4 [Staphylococcus aureus 930918-3]
 gi|259163371|gb|EEW47929.1| 50S ribosomal protein L4 [Staphylococcus aureus D30]
 gi|262076172|gb|ACY12145.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus ED98]
 gi|269941838|emb|CBI50248.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus TW20]
 gi|282318556|gb|EFB48914.1| 50S ribosomal protein L4/L1 [Staphylococcus aureus subsp. aureus
           D139]
 gi|282593586|gb|EFB98579.1| 50S ribosomal protein L4/L1 [Staphylococcus aureus A9765]
 gi|282763745|gb|EFC03873.1| 50S ribosomal protein L4/L1 [Staphylococcus aureus A8117]
 gi|283461220|gb|EFC08304.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus H19]
 gi|283471471|emb|CAQ50682.1| ribosomal protein L4/L1 family [Staphylococcus aureus subsp. aureus
           ST398]
 gi|285817911|gb|ADC38398.1| 50S ribosomal protein L4 [Staphylococcus aureus 04-02981]
 gi|294824161|gb|EFG40585.1| 50S ribosomal protein L4/L1 [Staphylococcus aureus A9754]
 gi|294969870|gb|EFG45888.1| 50S ribosomal protein L4/L1 [Staphylococcus aureus A8819]
 gi|296885611|gb|EFH24548.1| ribosomal protein L4/L1 family protein [Staphylococcus aureus
           subsp. aureus ATCC 51811]
 gi|297178761|gb|EFH38006.1| 50S ribosomal protein L4/L1 [Staphylococcus aureus A8796]
 gi|298695505|gb|ADI98727.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus
           ED133]
 gi|300887930|gb|EFK83125.1| ribosomal protein L4/L1 family protein [Staphylococcus aureus
           subsp. aureus TCH70]
 gi|302333885|gb|ADL24078.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus
           JKD6159]
 gi|302752122|gb|ADL66299.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus str.
           JKD6008]
 gi|304341965|gb|EFM07869.1| ribosomal protein L4/L1 family protein [Staphylococcus aureus
           subsp. aureus ATCC BAA-39]
 gi|312830598|emb|CBX35440.1| 50S ribosomal protein L4 (BL4) [Staphylococcus aureus subsp. aureus
           ECT-R 2]
 gi|315129671|gb|EFT85662.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus
           CGS03]
 gi|315198221|gb|EFU28552.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus
           CGS01]
 gi|320140213|gb|EFW32072.1| ribosomal protein L4/L1 family protein [Staphylococcus aureus
           subsp. aureus MRSA131]
 gi|320143483|gb|EFW35264.1| ribosomal protein L4/L1 family protein [Staphylococcus aureus
           subsp. aureus MRSA177]
 gi|323440071|gb|EGA97786.1| 50S ribosomal protein L4 [Staphylococcus aureus O11]
 gi|323442745|gb|EGB00371.1| 50S ribosomal protein L4 [Staphylococcus aureus O46]
 gi|329314932|gb|AEB89345.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus
           T0131]
 gi|329723693|gb|EGG60222.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus
           21172]
 gi|329730071|gb|EGG66461.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus
           21193]
 gi|329732021|gb|EGG68376.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus
           21189]
          Length = 207

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 107/204 (52%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M    V  LDG   G I +S+ +F ++P   +L   +  Q    R G    K RS V+  
Sbjct: 1   MANYDVLKLDGTKSGSIELSDAVFGIEPNNSVLFEAINLQRASLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  +    Q+RGGG  FGP P    + +PKK+R LALR ALS K   
Sbjct: 61  GRKPWKQKGTGRARQGTIRAPQWRGGGIVFGPTPRSYAYKMPKKMRRLALRSALSFKAQE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N + V+D    +  KTK        L+    +++     D N +L+ARNIP + +   QG
Sbjct: 121 NGLTVVDAFNFEAPKTKEFKNVLSTLEQPKKVLVVTENEDVNVELSARNIPGVQVTTAQG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV DI     LV++++A + +E+
Sbjct: 181 LNVLDITNADSLVITEAAAKKVEE 204


>gi|7674307|sp|Q9ZI49|RL4_AQUPY RecName: Full=50S ribosomal protein L4
 gi|4165866|gb|AAD08786.1| ribosomal protein L4 [Aquifex pyrophilus]
          Length = 199

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 74/190 (38%), Positives = 116/190 (61%), Gaps = 2/190 (1%)

Query: 15  GVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGTGRAR 74
           G + V +D+F +K ++ +L  V++WQ  ++R G   +K R EVAY+G K+  QKGTG AR
Sbjct: 4   GDVEVRDDVFNVKVKKHVLWEVVKWQLAKRRQGTHSTKTRGEVAYSGRKILPQKGTGNAR 63

Query: 75  HSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNL-VSKE 133
           H  + V+ F GGG A GP P    + LPKKVR L L+ ALSDK  ++ IM +DN+ + ++
Sbjct: 64  HGERGVNIFVGGGVAHGPKPRDYEYPLPKKVRKLGLKMALSDKAQNDAIMFVDNIDLGEQ 123

Query: 134 CKTKYLVTRFRALDLS-NALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRCSKL 192
            KTK  V   + L +    L+I   + +     + RN+ N+ +L  +G+NVYD+L  +KL
Sbjct: 124 PKTKKAVEFLKNLGVDKETLLIVIPEKNEVLYKSFRNLQNVRVLLPEGLNVYDVLWANKL 183

Query: 193 VLSKSAIEAL 202
           V+ K  ++ +
Sbjct: 184 VIHKECLDRI 193


>gi|199598833|ref|ZP_03212244.1| 50S ribosomal protein L4 [Lactobacillus rhamnosus HN001]
 gi|258540678|ref|YP_003175177.1| 50S ribosomal protein L4 [Lactobacillus rhamnosus Lc 705]
 gi|199590245|gb|EDY98340.1| 50S ribosomal protein L4 [Lactobacillus rhamnosus HN001]
 gi|257152354|emb|CAR91326.1| LSU/50S ribosomal protein L4P [Lactobacillus rhamnosus Lc 705]
          Length = 207

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 75/207 (36%), Positives = 119/207 (57%), Gaps = 6/207 (2%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +++   DG + G + +++ I+A++P + ++   +  Q    R G    K RS V+  
Sbjct: 1   MANVTLYKQDGSENGTVELNDAIWAVEPNENVVFDAVVMQRASLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LPKKVR LA++  LS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGIVFGPTPRSYAYKLPKKVRRLAIKSVLSQKVLD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSN-ALII--DGCQLDRNFQLAARNIPNINLLP 177
            D++V+D L     KTK  +     L +++ AL++  DG  +      AARN+PN+ ++P
Sbjct: 121 GDLVVVDGLSFDAPKTKAFLNVLDGLKVNDKALVVLEDGNDVAAK---AARNLPNVKVVP 177

Query: 178 VQGINVYDILRCSKLVLSKSAIEALED 204
            +GINV D +   KL+L++SA++ +E+
Sbjct: 178 AEGINVLDAVNYKKLILTQSALQKIEE 204


>gi|238855069|ref|ZP_04645397.1| ribosomal protein L4/L1 family protein [Lactobacillus jensenii
           269-3]
 gi|238832313|gb|EEQ24622.1| ribosomal protein L4/L1 family protein [Lactobacillus jensenii
           269-3]
          Length = 205

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 118/204 (57%), Gaps = 2/204 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  L + +  G+D G +++++++F ++P + ++   +  Q    R G   +K RS V   
Sbjct: 1   MANLKLIDQTGKDAGEVTLNDNVFGIEPNENVVFDAVIRQRAGMRQGTHATKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    ++LP+K R LA++  LS K   
Sbjct: 61  GKKPWRQKGTGRARQGSIRAPQWRGGGTVFGPTPRSYAYSLPRKARRLAIKSVLSQKLQD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+++V+D L     KTK        L++ + +++     + N QL+ARN+ N+ ++PV G
Sbjct: 121 NNLIVLDQLSLDAPKTKEFKAVLGNLNVDSKVLV--VSDNENVQLSARNLENVKVVPVNG 178

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV D +   KL+L++ A++ +E+
Sbjct: 179 LNVVDAVNYDKLILTQDAVKRIEE 202


>gi|289435897|ref|YP_003465769.1| hypothetical protein lse_2536 [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289172141|emb|CBH28687.1| rplD [Listeria seeligeri serovar 1/2b str. SLCC3954]
 gi|313636112|gb|EFS01986.1| ribosomal protein L4/L1 family [Listeria seeligeri FSL S4-171]
          Length = 207

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 115/204 (56%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +LS+   DG + G I++++ +F ++P + ++  V+  Q    R G  K K RSEV   
Sbjct: 1   MPKLSLLKQDGTNAGEITLNDTVFGIEPNEKVVVDVILSQRASLRQGTHKVKNRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LPKKVR LA++  LS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYAYKLPKKVRRLAIKSILSSKVNE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             ++V++ L     KTK      + + +    +I       N +L+ARN+  I ++P + 
Sbjct: 121 EKLVVLEGLTFDAPKTKEFAAFLKNISVDTKALIVVASESENVELSARNLQGITVIPAES 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           I+V ++ +  KL+++K+A+E +E+
Sbjct: 181 ISVLEVAKHDKLIITKAAVEKVEE 204


>gi|290984683|ref|XP_002675056.1| ribosomal protein L4/L1e [Naegleria gruberi]
 gi|284088650|gb|EFC42312.1| ribosomal protein L4/L1e [Naegleria gruberi]
          Length = 332

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 77/217 (35%), Positives = 117/217 (53%), Gaps = 13/217 (5%)

Query: 3   ELSVRNL-DGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           E  V+NL  GE   +I++    F   P++ IL  +++WQ  ++R G  K+K R E AY  
Sbjct: 107 EAMVKNLKTGEFTEMINLHPYFFNCTPRKDILYLMVKWQLAKRRQGTHKTKYRLETAYCK 166

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K   QKG G ARHS +   Q+RGGG A    P    + L KK+R LALR AL+ K+   
Sbjct: 167 QKQTPQKGRGAARHSDRGAPQYRGGGHAMALRPRSYEYNLNKKIRRLALRMALTTKYQQG 226

Query: 122 DIMVIDNLVSKECKTKYLV------------TRFRALDLSNALIIDGCQLDRNFQLAARN 169
            ++++D+      KTKY+             T  + +     L+IDG Q++ NF+    N
Sbjct: 227 KLIIVDDFSIDTFKTKYVAGLISNTVFPDSETHEKEIKDRGVLLIDGEQVNANFERGVFN 286

Query: 170 IPNINLLPVQGINVYDILRCSKLVLSKSAIEALEDRF 206
           +   + L + G+NVYD+LR  K+V+SKS +E L  ++
Sbjct: 287 LHYADYLSIDGLNVYDMLRREKVVISKSGLETLTKKY 323


>gi|319789239|ref|YP_004150872.1| ribosomal protein L4/L1e [Thermovibrio ammonificans HB-1]
 gi|317113741|gb|ADU96231.1| ribosomal protein L4/L1e [Thermovibrio ammonificans HB-1]
          Length = 208

 Score =  132 bits (331), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 72/207 (34%), Positives = 119/207 (57%), Gaps = 2/207 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +E+ V +L+ ++ G + + ++I     +Q  +   ++WQ  ++R G   +K R EV   G
Sbjct: 1   MEIKVVDLNNKETGTVQIKDEIANAPIKQHAVWETVKWQLAKRRRGTHSTKTRGEVRGGG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K + QK TGRAR  S    Q+ GGG   GP P    + LPKKVR +AL+  ++ +    
Sbjct: 61  RKPWPQKHTGRARQGSIRAPQWVGGGVVHGPKPRDYSYNLPKKVRKVALKSVVAGRIQEG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNA--LIIDGCQLDRNFQLAARNIPNINLLPVQ 179
           + +V+++   ++ KTK  V   + L L N+  L++   +LD N  L+ RN+PN+ +LPV+
Sbjct: 121 NFIVVEDFSFEKPKTKQAVEFLKNLGLENSKVLLVVPAELDENTYLSFRNLPNVKVLPVE 180

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRF 206
           G+NVYDIL   K V+ KS +  +E+R 
Sbjct: 181 GLNVYDILCYDKCVVFKSILPKIEERL 207


>gi|257431697|ref|ZP_05608060.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257282576|gb|EEV12708.1| 50S ribosomal protein L4 [Staphylococcus aureus subsp. aureus
           E1410]
          Length = 207

 Score =  131 bits (330), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 107/204 (52%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M    V  LDG   G I +S+ +F ++P   +L   +  Q    R G    K RS V+  
Sbjct: 1   MANYDVLKLDGTKSGSIELSDAVFGIEPNNSVLFEAINLQRASLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  +    Q+RGGG  FGP P    + +PKK+R LALR ALS K   
Sbjct: 61  GRKPWKQKGTGRARQGTIRAPQWRGGGIVFGPTPRSYAYKMPKKMRRLALRSALSFKVQE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N + ++D    +  KTK        L+    +++     D N +L+ARNIP + +   QG
Sbjct: 121 NGLTLVDAFNFEAPKTKEFKNVLSTLEQPKKVLVVTENEDVNVELSARNIPGVQVTTAQG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV DI     LV++++A + +E+
Sbjct: 181 LNVLDITNADSLVITEAAAKKVEE 204


>gi|78357299|ref|YP_388748.1| 50S ribosomal protein L4 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|109893592|sp|Q30Z43|RL4_DESDG RecName: Full=50S ribosomal protein L4
 gi|78219704|gb|ABB39053.1| LSU ribosomal protein L4P [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 206

 Score =  131 bits (330), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 75/207 (36%), Positives = 122/207 (58%), Gaps = 1/207 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + V + D ++ G ++++ ++F ++ +  IL  V+R Q   KR G    K RS ++  
Sbjct: 1   MAVVKVYDQDKKETGELTLAPEVFEVEVRPEILNLVVRAQRAAKRAGTHSVKTRSTISGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G+K + QKGTGRAR  S     +RGG   FGP P      + KKVR LAL+ ALS +   
Sbjct: 61  GAKPWRQKGTGRARSGSNRSPVWRGGAVVFGPQPRDYSFKVNKKVRKLALKMALSSRLAE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            ++MV+  +   E KTK++V    AL L  AL++   ++D    L+ARNIP I L+  + 
Sbjct: 121 ENLMVVKGIELPEVKTKHMVKVAGALGLGKALVVT-PEMDDKLVLSARNIPGITLMTPEQ 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRFK 207
           ++V++IL+ ++LVL + A+E +++R K
Sbjct: 180 LSVFEILKHAQLVLLEGAVEPVQERLK 206


>gi|258509481|ref|YP_003172232.1| 50S ribosomal protein L4 [Lactobacillus rhamnosus GG]
 gi|257149408|emb|CAR88381.1| LSU/50S ribosomal protein L4P [Lactobacillus rhamnosus GG]
 gi|259650760|dbj|BAI42922.1| 50S ribosomal protein L4 [Lactobacillus rhamnosus GG]
          Length = 207

 Score =  131 bits (330), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 74/207 (35%), Positives = 119/207 (57%), Gaps = 6/207 (2%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +++   DG + G + +++ I+A++P + ++   +  Q    R G    K RS V+  
Sbjct: 1   MANVTLYKQDGSENGTVELNDAIWAVEPNENVVFDAVVMQRASLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LPKKVR LA++  LS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGIVFGPTPRSYAYKLPKKVRRLAIKSVLSQKVLD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSN-ALII--DGCQLDRNFQLAARNIPNINLLP 177
            D++V+D L     KTK  +     + +++ AL++  DG  +      AARN+PN+ ++P
Sbjct: 121 GDLVVVDGLSFDAPKTKAFLNVLDGIKVNDKALVVLEDGNDVAAK---AARNLPNVKVVP 177

Query: 178 VQGINVYDILRCSKLVLSKSAIEALED 204
            +GINV D +   KL+L++SA++ +E+
Sbjct: 178 AEGINVLDAVNYKKLILTQSALQKIEE 204


>gi|77918316|ref|YP_356131.1| 50S ribosomal protein L4 [Pelobacter carbinolicus DSM 2380]
 gi|109893615|sp|Q3A6P6|RL4_PELCD RecName: Full=50S ribosomal protein L4
 gi|77544399|gb|ABA87961.1| LSU ribosomal protein L4P [Pelobacter carbinolicus DSM 2380]
          Length = 206

 Score =  131 bits (330), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 71/203 (34%), Positives = 121/203 (59%), Gaps = 1/203 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +++V +++        +S+++F  + ++ ++  ++R+Q   +R G S +K RS VA  
Sbjct: 1   MAKIAVYDINRNQVSERELSDEVFNAEVKEYLIHDMVRYQLAARRQGTSAAKNRSAVAGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K Y QKGTG AR  +     F GGG AFGP P      L +KV+  ALR ALS +F  
Sbjct: 61  GKKPYRQKGTGNARQGTIRAPHFVGGGAAFGPSPRDFSFKLNRKVKKAALRSALSARFKE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             + V+++   ++  TK +V      +LSN L++ G + +RN +L+ARN+P++ +L  +G
Sbjct: 121 ERVAVLNDFQLEKIGTKAVVEVLNRFELSNVLVVVG-EDNRNLELSARNLPHVKVLKAEG 179

Query: 181 INVYDILRCSKLVLSKSAIEALE 203
           +NVYD++    LV+++ A+E LE
Sbjct: 180 VNVYDLMNHRNLVVTEGAVEQLE 202


>gi|289423702|ref|ZP_06425501.1| ribosomal protein, L4/L1 family [Peptostreptococcus anaerobius
           653-L]
 gi|289155952|gb|EFD04618.1| ribosomal protein, L4/L1 family [Peptostreptococcus anaerobius
           653-L]
          Length = 207

 Score =  131 bits (329), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 119/206 (57%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +++V N+ G++ G I +++ IF ++  + +L   ++ Q   KR G   +K R+EV   
Sbjct: 1   MPKINVLNVSGQNVGEIELNDSIFDIEVNEHVLYEAVKCQLANKRQGTQSAKTRAEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+ GGG AF P P    ++LPKKVR LA++ ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSVQWVGGGVAFAPKPRDYSYSLPKKVRRLAMKSALSSKVQD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            +I+V+D L  +  KTK +V  F+ ++ +   ++   + D N   + RNI   N+  V  
Sbjct: 121 KEIIVLDALSLEAPKTKEIVNLFKNVNAAKKTLVVTAENDVNVVKSVRNIEGANVAHVST 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVYDIL C   +++  A++ +E+ +
Sbjct: 181 LNVYDILNCDSFIITTDAVKKVEEVY 206


>gi|81429376|ref|YP_396377.1| 50S ribosomal protein L4 [Lactobacillus sakei subsp. sakei 23K]
 gi|109893600|sp|Q38UR3|RL4_LACSS RecName: Full=50S ribosomal protein L4
 gi|78611019|emb|CAI56071.1| 50S ribosomal protein L4 [Lactobacillus sakei subsp. sakei 23K]
          Length = 207

 Score =  131 bits (329), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 72/207 (34%), Positives = 115/207 (55%), Gaps = 6/207 (2%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +++   DG   G + +++ I+A++P + ++   +  Q    R G    K RS V   
Sbjct: 1   MANVTLFKQDGSQNGNVELNDSIWAIEPNENVVFDAIIMQRASLRQGTHAVKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LP+KVR LA++  LS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYSYKLPRKVRRLAIKSVLSQKVID 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALII---DGCQLDRNFQLAARNIPNINLLP 177
           ND++V+D+      KTK        LD++  +++   DG        L+ARN+PN+ ++P
Sbjct: 121 NDLIVVDSFSFDAPKTKEFAEVLNKLDVNTKVLVVLEDGNDFT---ALSARNLPNVTVVP 177

Query: 178 VQGINVYDILRCSKLVLSKSAIEALED 204
             GINV D++   KL+L+++A+  +E+
Sbjct: 178 ADGINVLDVVGNQKLILTQAALSKIEE 204


>gi|16801841|ref|NP_472109.1| 50S ribosomal protein L4 [Listeria innocua Clip11262]
 gi|16804669|ref|NP_466154.1| 50S ribosomal protein L4 [Listeria monocytogenes EGD-e]
 gi|46908803|ref|YP_015192.1| 50S ribosomal protein L4 [Listeria monocytogenes str. 4b F2365]
 gi|217966170|ref|YP_002351848.1| ribosomal protein L4/L1 family [Listeria monocytogenes HCC23]
 gi|224499304|ref|ZP_03667653.1| 50S ribosomal protein L4 [Listeria monocytogenes Finland 1988]
 gi|224503575|ref|ZP_03671882.1| 50S ribosomal protein L4 [Listeria monocytogenes FSL R2-561]
 gi|226225176|ref|YP_002759283.1| ribosomal protein L4 [Listeria monocytogenes Clip81459]
 gi|254825008|ref|ZP_05230009.1| ribosomal protein L4 [Listeria monocytogenes FSL J1-194]
 gi|254829080|ref|ZP_05233767.1| ribosomal protein L4 [Listeria monocytogenes FSL N3-165]
 gi|254830937|ref|ZP_05235592.1| 50S ribosomal protein L4 [Listeria monocytogenes 10403S]
 gi|254854163|ref|ZP_05243511.1| ribosomal protein L4 [Listeria monocytogenes FSL R2-503]
 gi|254899918|ref|ZP_05259842.1| 50S ribosomal protein L4 [Listeria monocytogenes J0161]
 gi|254912876|ref|ZP_05262888.1| 50S ribosomal protein L4 [Listeria monocytogenes J2818]
 gi|254931099|ref|ZP_05264458.1| ribosomal protein L4 [Listeria monocytogenes HPB2262]
 gi|254937256|ref|ZP_05268953.1| ribosomal protein L4 [Listeria monocytogenes F6900]
 gi|254991853|ref|ZP_05274043.1| 50S ribosomal protein L4 [Listeria monocytogenes FSL J2-064]
 gi|255017640|ref|ZP_05289766.1| 50S ribosomal protein L4 [Listeria monocytogenes FSL F2-515]
 gi|255022701|ref|ZP_05294687.1| 50S ribosomal protein L4 [Listeria monocytogenes FSL J1-208]
 gi|255027145|ref|ZP_05299131.1| 50S ribosomal protein L4 [Listeria monocytogenes FSL J2-003]
 gi|255029694|ref|ZP_05301645.1| 50S ribosomal protein L4 [Listeria monocytogenes LO28]
 gi|255519641|ref|ZP_05386878.1| 50S ribosomal protein L4 [Listeria monocytogenes FSL J1-175]
 gi|284800483|ref|YP_003412348.1| 50S ribosomal protein L4 [Listeria monocytogenes 08-5578]
 gi|284993669|ref|YP_003415437.1| 50S ribosomal protein L4 [Listeria monocytogenes 08-5923]
 gi|290891816|ref|ZP_06554813.1| ribosomal protein L4 [Listeria monocytogenes FSL J2-071]
 gi|300763618|ref|ZP_07073616.1| hypothetical protein LMHG_10847 [Listeria monocytogenes FSL N1-017]
 gi|46577145|sp|P61054|RL4_LISIN RecName: Full=50S ribosomal protein L4
 gi|46577146|sp|P61055|RL4_LISMO RecName: Full=50S ribosomal protein L4
 gi|67461151|sp|Q71WE7|RL4_LISMF RecName: Full=50S ribosomal protein L4
 gi|254803741|sp|B8DB09|RL4_LISMH RecName: Full=50S ribosomal protein L4
 gi|259491564|sp|C1KZH9|RL4_LISMC RecName: Full=50S ribosomal protein L4
 gi|16412119|emb|CAD00709.1| ribosomal protein L4 [Listeria monocytogenes EGD-e]
 gi|16415316|emb|CAC98006.1| ribosomal protein L4 [Listeria innocua Clip11262]
 gi|46882076|gb|AAT05369.1| ribosomal protein L4 [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|217335440|gb|ACK41234.1| ribosomal protein L4/L1 family [Listeria monocytogenes HCC23]
 gi|225877638|emb|CAS06352.1| ribosomal protein L4 [Listeria monocytogenes serotype 4b str. CLIP
           80459]
 gi|258601490|gb|EEW14815.1| ribosomal protein L4 [Listeria monocytogenes FSL N3-165]
 gi|258607555|gb|EEW20163.1| ribosomal protein L4 [Listeria monocytogenes FSL R2-503]
 gi|258609862|gb|EEW22470.1| ribosomal protein L4 [Listeria monocytogenes F6900]
 gi|284056045|gb|ADB66986.1| 50S ribosomal protein L4 [Listeria monocytogenes 08-5578]
 gi|284059136|gb|ADB70075.1| 50S ribosomal protein L4 [Listeria monocytogenes 08-5923]
 gi|290558410|gb|EFD91927.1| ribosomal protein L4 [Listeria monocytogenes FSL J2-071]
 gi|293582646|gb|EFF94678.1| ribosomal protein L4 [Listeria monocytogenes HPB2262]
 gi|293590875|gb|EFF99209.1| 50S ribosomal protein L4 [Listeria monocytogenes J2818]
 gi|293594249|gb|EFG02010.1| ribosomal protein L4 [Listeria monocytogenes FSL J1-194]
 gi|300515895|gb|EFK42944.1| hypothetical protein LMHG_10847 [Listeria monocytogenes FSL N1-017]
 gi|307572220|emb|CAR85399.1| rplD [Listeria monocytogenes L99]
 gi|328469804|gb|EGF40721.1| 50S ribosomal protein L4 [Listeria monocytogenes 220]
          Length = 207

 Score =  131 bits (329), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 115/204 (56%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +LS+   DG + G I++++ +F ++P + ++  V+  Q    R G  K K RSEV   
Sbjct: 1   MPKLSLLKQDGTNAGEITLNDTVFGIEPNEKVVVDVILSQRASLRQGTHKVKNRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LPKKVR LA++  LS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYAYKLPKKVRRLAIKSILSSKVNE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             ++V++ L     KTK      + + +    +I       N +L+ARN+  I ++P + 
Sbjct: 121 EKLVVLEGLTFDAPKTKEFAAFLKNISVDTKALIVVAGESENVELSARNLQGITVIPAES 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           I+V ++ +  KL+++K+A+E +E+
Sbjct: 181 ISVLEVAKHDKLIITKAAVEKVEE 204


>gi|300088196|ref|YP_003758718.1| 50S ribosomal protein L4/L1e [Dehalogenimonas lykanthroporepellens
           BL-DC-9]
 gi|299527929|gb|ADJ26397.1| ribosomal protein L4/L1e [Dehalogenimonas lykanthroporepellens
           BL-DC-9]
          Length = 210

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 73/202 (36%), Positives = 115/202 (56%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +E+ V N  G+    ++VS+++FA+     ++ + +  Q+   R G S ++ RSEV+ T 
Sbjct: 1   MEIPVYNTSGQVVRNVTVSDELFAVPMNDAVVHQAMVAQAANARQGTSSTRTRSEVSGTT 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            KM+ QKGTG AR  S+      GGG  FGP P     +LPKK+R LA+R  LSDK  S 
Sbjct: 61  QKMFRQKGTGEARAGSRKSGLRPGGGVIFGPKPRDYSKSLPKKMRRLAIRCLLSDKVASG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            + V+D L     KT+ +     AL++ ++ II    +D N  L+ARN+P +   P   I
Sbjct: 121 SLKVVDALALDAPKTREMTQVLTALEIGSSAIIATAGVDENVVLSARNLPRVKTTPANLI 180

Query: 182 NVYDILRCSKLVLSKSAIEALE 203
           NV D+L+   L+L++ A+E ++
Sbjct: 181 NVGDLLKYDTLLLTEQALEVVQ 202


>gi|218186871|gb|EEC69298.1| hypothetical protein OsI_38360 [Oryza sativa Indica Group]
          Length = 197

 Score =  130 bits (328), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 109/186 (58%), Gaps = 1/186 (0%)

Query: 22  DIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGTGRARHSSKSVS 81
           D+F +  ++ I+ RV+RWQ  +++ G   +K  SEV+ TG K Y QKGTGRARH +    
Sbjct: 6   DVFDVPIRKDIVHRVVRWQLAKRQQGTHSTKIISEVSGTGRKPYKQKGTGRARHGTLRGP 65

Query: 82  QFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNLVSKECKTKYLVT 141
           QFRGG    GP P      L KKVR L L+ ALS +     ++V ++L     KTK +V+
Sbjct: 66  QFRGGATMHGPKPRSHTIKLQKKVRRLGLKIALSARTAEGKLLVFEDLEVPSHKTKNVVS 125

Query: 142 RFRAL-DLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRCSKLVLSKSAIE 200
               + D    L++DG  +D+  +LA +N+  +N+LP  G+NVY IL+   LV+++ A+ 
Sbjct: 126 YISQMEDTKKVLLVDGGDIDKKLKLATQNLHYVNVLPSIGLNVYSILQHDTLVMTRDAVN 185

Query: 201 ALEDRF 206
            + +R 
Sbjct: 186 RIVERM 191


>gi|51894209|ref|YP_076900.1| 50S ribosomal protein L4 [Symbiobacterium thermophilum IAM 14863]
 gi|81610342|sp|Q67JU4|RL4_SYMTH RecName: Full=50S ribosomal protein L4
 gi|51857898|dbj|BAD42056.1| 50S ribosomal protein L4 [Symbiobacterium thermophilum IAM 14863]
          Length = 207

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 115/204 (56%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +++V N +G   G I++S+ +F  +   G+L  V++     KR G + +K R+EV+  
Sbjct: 1   MPKVAVYNKEGATVGEITLSDAVFGAEVNPGLLHEVVQMYLANKRQGTADTKTRAEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRARH S     +R GG  FGP P     ++PKK R  ALR ALS K  S
Sbjct: 61  GRKPWRQKGTGRARHGSIRSPLWRKGGIVFGPHPREYGWSMPKKARRAALRQALSAKVKS 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            +++V+D    +  KT+ + T  + L +  +  I   Q D N   +ARNIP + +   + 
Sbjct: 121 GELIVVDKFELEAPKTREVATLLKNLKVDGSAFIVTAQEDVNIYKSARNIPGVRVNAARN 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +N YD+L  SKLV ++ A+  +E+
Sbjct: 181 LNAYDVLAASKLVFTQDAVAKVEE 204


>gi|116748991|ref|YP_845678.1| 50S ribosomal protein L4/L1e [Syntrophobacter fumaroxidans MPOB]
 gi|166199918|sp|A0LIJ1|RL4_SYNFM RecName: Full=50S ribosomal protein L4
 gi|116698055|gb|ABK17243.1| LSU ribosomal protein L4P [Syntrophobacter fumaroxidans MPOB]
          Length = 207

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 117/204 (57%), Gaps = 1/204 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + + N + +  G + +S+ +FA+  +  +L  V+ +Q  ++R G  K+KGRS+VA  
Sbjct: 1   MPTVDIFNTNRDVVGQLELSDAVFAVPLRPHVLHEVVLYQLAKRRAGTVKTKGRSDVAGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  +     +RGGG   GP P      +PKKVR LA++ ALS K   
Sbjct: 61  GKKPWRQKGTGRARAGTSRSPIWRGGGTIHGPQPRDYEMRIPKKVRRLAVKMALSQKLID 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            ++ V+D L  ++ KT+         +LS  L++   Q D   Q +ARNIPN+ +L  +G
Sbjct: 121 RELTVLDQLQLEQIKTRDFAAILDRFELSKTLVVI-AQPDEKLQKSARNIPNVKVLRTEG 179

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NVYD+L    ++L++  I  +E+
Sbjct: 180 LNVYDLLNHRSVLLTRETIGKIEE 203


>gi|297836242|ref|XP_002886003.1| 50S ribosomal protein L4 [Arabidopsis lyrata subsp. lyrata]
 gi|297331843|gb|EFH62262.1| 50S ribosomal protein L4 [Arabidopsis lyrata subsp. lyrata]
          Length = 297

 Score =  130 bits (326), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 116/204 (56%), Gaps = 1/204 (0%)

Query: 4   LSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSK 63
           + V N   E+KG + ++ D+F +  ++ I+  V+RWQ  +++ G   +K  SEV+ TG K
Sbjct: 88  IPVTNFQSEEKGFMVLAGDVFDVPIRKDIIHNVVRWQLAKRQQGTHSTKTLSEVSGTGRK 147

Query: 64  MYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDI 123
            + QKGTGRARH +    QFRGG    GP P      + K+VR L L+ AL+ +     +
Sbjct: 148 PWNQKGTGRARHGTLRGPQFRGGCVMHGPKPRSHAIKMNKQVRRLGLKIALTARAAEGKL 207

Query: 124 MVIDNLVSKECKTKYLVTRFRALD-LSNALIIDGCQLDRNFQLAARNIPNINLLPVQGIN 182
           +V D+L     KTK +V  +  ++     L+++G  +D   +LA +N+  +N++P  G+N
Sbjct: 208 LVFDDLALPTHKTKNIVNYYNQMENTKKVLVVEGGPIDEKLKLATQNLHYVNIIPSIGLN 267

Query: 183 VYDILRCSKLVLSKSAIEALEDRF 206
           VY IL    LV+S+ A+  + +R 
Sbjct: 268 VYSILLHDTLVMSRDAVNKIVERM 291


>gi|223983922|ref|ZP_03634082.1| hypothetical protein HOLDEFILI_01363 [Holdemania filiformis DSM
           12042]
 gi|223964114|gb|EEF68466.1| hypothetical protein HOLDEFILI_01363 [Holdemania filiformis DSM
           12042]
          Length = 209

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 76/200 (38%), Positives = 110/200 (55%), Gaps = 2/200 (1%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +L+V NL+ ++   I ++E +F ++P Q ++   L  Q    R G   +K R EV+  
Sbjct: 1   MPKLNVYNLEAKEIREIELAEAVFGIEPNQQVMFDALIMQRANMRQGTHDTKSRHEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG AFGP P    + L +KVR LALR  LS+K   
Sbjct: 61  GKKPWRQKGTGRARQGSIRAPQWRGGGIAFGPTPRSYAYRLNRKVRRLALRSLLSEKVIE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNA--LIIDGCQLDRNFQLAARNIPNINLLPV 178
           N+++V+D L     KTK  V    A         + D  +   N  ++ RNIPN  LL V
Sbjct: 121 NNLVVVDALKFDAIKTKEFVKVMDAFKFEGKTLFVADIAEDFDNAFMSLRNIPNAALLTV 180

Query: 179 QGINVYDILRCSKLVLSKSA 198
           + +N +DI    KLV++++A
Sbjct: 181 EELNAFDIANAQKLVMTEAA 200


>gi|283796558|ref|ZP_06345711.1| ribosomal protein L4/L1 family protein [Clostridium sp. M62/1]
 gi|291075972|gb|EFE13336.1| ribosomal protein L4/L1 family protein [Clostridium sp. M62/1]
 gi|295092548|emb|CBK78655.1| LSU ribosomal protein L4P [Clostridium cf. saccharolyticum K10]
          Length = 204

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 114/206 (55%), Gaps = 3/206 (1%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +SV N++G + G + +++ +F ++  + ++   +  Q   KR G  K+K RSEV+  
Sbjct: 1   MANVSVYNIEGNEVGTLELNDAVFGVEVNEHLVHLAVVAQLANKRQGTQKAKTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+ GGG  F P P      L KK + LAL+ AL+ +   
Sbjct: 61  GRKPWRQKGTGHARQGSTRAPQWTGGGVVFAPTPRDYTIRLNKKEKRLALKSALTSRVNE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N  +V+D L   E KTK      + L +  AL++     D N  L+ARNIP +    V  
Sbjct: 121 NKFIVVDELSFAEIKTKKFAEVLKNLKVEKALVVGA---DANAALSARNIPAVKTASVNT 177

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYDIL+ + +V +K+A+ ++E+ +
Sbjct: 178 INVYDILKYNTVVATKAAVASIEEVY 203


>gi|228474532|ref|ZP_04059263.1| ribosomal protein L4/L1 family protein [Staphylococcus hominis
           SK119]
 gi|314935833|ref|ZP_07843185.1| ribosomal protein L4/L1 family protein [Staphylococcus hominis
           subsp. hominis C80]
 gi|228271195|gb|EEK12563.1| ribosomal protein L4/L1 family protein [Staphylococcus hominis
           SK119]
 gi|313656398|gb|EFS20138.1| ribosomal protein L4/L1 family protein [Staphylococcus hominis
           subsp. hominis C80]
          Length = 207

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 106/204 (51%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M    V  +DG   G + +S+ +FA++P   +L   +  Q    R G    K RS V   
Sbjct: 1   MANYDVLKVDGSKSGSVELSDSVFAIEPNNSVLFEAINLQRASLRQGTHAVKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  +    Q+RGGG  FGP P    + +PKK+R LALR ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGTIRAPQWRGGGIVFGPTPRSYSYKMPKKMRRLALRSALSFKVQE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+  ++D       KTK        L+    +++     D N +L+ARNIP + +   QG
Sbjct: 121 NNFTIVDTFGFDAPKTKEFKNVLTTLEQPKKVLVVTENEDVNVELSARNIPGVQVSTAQG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV DI     +++++SA + +E+
Sbjct: 181 LNVLDITSADSVIITESAAKKVEE 204


>gi|317126862|ref|YP_004093144.1| ribosomal protein L4/L1e [Bacillus cellulosilyticus DSM 2522]
 gi|315471810|gb|ADU28413.1| ribosomal protein L4/L1e [Bacillus cellulosilyticus DSM 2522]
          Length = 207

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 114/204 (55%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N  G   G I +SE IF ++P + +L   +  Q   +R G   +KGRS+V   
Sbjct: 1   MPKVTLYNQTGSQVGDIELSEAIFGIEPNESVLFDAVVMQQASQRQGTHATKGRSDVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+ GGG  FGP P    + +PKK R LAL+ ALS K  +
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWVGGGVVFGPQPRSYAYKIPKKQRRLALKSALSSKVNA 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           ++I+V++ L     KTK +      L +    ++     +    L+ARNIP +  +  +G
Sbjct: 121 DEILVLEGLNFDSPKTKEMKAVLSGLSVGRKALVVTADYNDAVALSARNIPGVKFITAEG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV D+L   +L++++ A++ +E+
Sbjct: 181 VNVLDLLNYDQLIITQDAVKKVEE 204


>gi|225850736|ref|YP_002730970.1| ribosomal protein, L4/L1 family [Persephonella marina EX-H1]
 gi|225645048|gb|ACO03234.1| ribosomal protein, L4/L1 family [Persephonella marina EX-H1]
          Length = 207

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 71/206 (34%), Positives = 117/206 (56%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +E +V N+  E+ G + +S+ +F  + ++  +  V++WQ   +R G + +K R+EV  + 
Sbjct: 1   MEANVVNIKKENVGTVQLSDAVFNTEVKEHTVWEVIKWQLASRRAGTASTKTRAEVRGSR 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+  QKGTG ARH  +  + F GGG   GP P    +ALPKKVR  AL+  LS K    
Sbjct: 61  RKILPQKGTGNARHGDRKANIFVGGGVVHGPHPRDYYYALPKKVRKKALKGVLSMKLRDG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNA-LIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           ++ VI++    E KTK  +   +  DL  A +++   + D N   + RN+P   +L V+G
Sbjct: 121 ELTVIEDFTFDEPKTKKAIEVLKNFDLDKAKVLLVLAEKDMNVIKSFRNLPKAKVLLVEG 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +N YDIL    ++++KSA+E + +R 
Sbjct: 181 LNTYDILNADHVLVTKSAVEKINERL 206


>gi|34811556|pdb|1PNU|C Chain C, Crystal Structure Of A Streptomycin Dependent Ribosome
           From Escherichia Coli, 50s Subunit Of 70s Ribosome. This
           File, 1pnu, Contains Only Molecules Of The 50s Ribosomal
           Subunit. The 30s Subunit, Mrna, P-Site Trna, And A-Site
           Trna Are In The Pdb File 1pns.
 gi|34811609|pdb|1PNY|C Chain C, Crystal Structure Of The Wild Type Ribosome From E. Coli,
           50s Subunit Of 70s Ribosome. This File, 1pny, Contains
           Only Molecules Of The 50s Ribosomal Subunit. The 30s
           Subunit Is In The Pdb File 1pnx
          Length = 197

 Score =  129 bits (324), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 68/176 (38%), Positives = 107/176 (60%), Gaps = 4/176 (2%)

Query: 31  GILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGTGRARHSSKSVSQFRGGGKAF 90
           G+L  V+ WQ   +R G + ++ R++V+ TG KMY QKGTG ARH  +SV  F GGG AF
Sbjct: 24  GVLHEVVTWQLASRRRGTASTRTRAQVSKTGRKMYGQKGTGNARHGDRSVPTFVGGGVAF 83

Query: 91  GPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNLVSKECKTKYLVT--RFRALDL 148
           GP P    + LP++VR L L  A++ +     ++ +D     + KTK  ++  +   LD 
Sbjct: 84  GPKPRSYDYTLPRQVRQLGLAMAIASRQEGGKLVAVDGFDIADAKTKNFISWAKQNGLDG 143

Query: 149 SNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRCSKLVLSKSAIEALED 204
           +  +++     D N + AARN+  +++LPV G+NVYDILR  +LV+  +A+E +E+
Sbjct: 144 TEKVLL--VTDDENTRRAARNVSWVSVLPVAGVNVYDILRHDRLVIDAAALEIVEE 197


>gi|56966348|pdb|1VOR|F Chain F, Crystal Structure Of Five 70s Ribosomes From Escherichia
           Coli In Complex With Protein Y. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Five 70s Ribosomes And Is Described
           In Remark 400.
 gi|56966401|pdb|1VOU|F Chain F, Crystal Structure Of Five 70s Ribosomes From Escherichia
           Coli In Complex With Protein Y. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Five 70s Ribosomes And Is Described
           In Remark 400.
 gi|56966454|pdb|1VOW|F Chain F, Crystal Structure Of Five 70s Ribosomes From Escherichia
           Coli In Complex With Protein Y. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Five 70s Ribosomes And Is Described
           In Remark 400.
 gi|56966507|pdb|1VOY|F Chain F, Crystal Structure Of Five 70s Ribosomes From Escherichia
           Coli In Complex With Protein Y. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Five 70s Ribosomes And Is Described
           In Remark 400.
 gi|56966560|pdb|1VP0|F Chain F, Crystal Structure Of Five 70s Ribosomes From Escherichia
           Coli In Complex With Protein Y. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Five 70s Ribosomes And Is Described
           In Remark 400
          Length = 198

 Score =  129 bits (324), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 68/176 (38%), Positives = 107/176 (60%), Gaps = 4/176 (2%)

Query: 31  GILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGTGRARHSSKSVSQFRGGGKAF 90
           G+L  V+ WQ   +R G + ++ R++V+ TG KMY QKGTG ARH  +SV  F GGG AF
Sbjct: 25  GVLHEVVTWQLASRRRGTASTRTRAQVSKTGRKMYGQKGTGNARHGDRSVPTFVGGGVAF 84

Query: 91  GPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNLVSKECKTKYLVT--RFRALDL 148
           GP P    + LP++VR L L  A++ +     ++ +D     + KTK  ++  +   LD 
Sbjct: 85  GPKPRSYDYTLPRQVRQLGLAMAIASRQEGGKLVAVDGFDIADAKTKNFISWAKQNGLDG 144

Query: 149 SNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRCSKLVLSKSAIEALED 204
           +  +++     D N + AARN+  +++LPV G+NVYDILR  +LV+  +A+E +E+
Sbjct: 145 TEKVLL--VTDDENTRRAARNVSWVSVLPVAGVNVYDILRHDRLVIDAAALEIVEE 198


>gi|297569421|ref|YP_003690765.1| ribosomal protein L4/L1e [Desulfurivibrio alkaliphilus AHT2]
 gi|296925336|gb|ADH86146.1| ribosomal protein L4/L1e [Desulfurivibrio alkaliphilus AHT2]
          Length = 207

 Score =  129 bits (324), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 71/206 (34%), Positives = 113/206 (54%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M    V N+  E  G + + + +F ++    +L  ++R Q   +R G + +K R +V+ +
Sbjct: 1   MAVTEVYNIKKEKVGDVELDDALFGVEVNPHLLHDIVRMQRANRRAGTACTKTRKDVSGS 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S+    +RGGG  FGP P     ++P+K R L LR ALS +   
Sbjct: 61  GKKPWRQKGTGRARAGSRKSPVWRGGGTVFGPRPRSYAFSMPRKARKLGLRMALSSRCAD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N ++V+D+    E KTK  V       + NALI+    ++   + ++RN+P   ++P +G
Sbjct: 121 NLLVVLDDFQLDEIKTKKFVEVMDGFSIDNALIVVPESIE-TLERSSRNVPGFKVMPTEG 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVYDIL    +VL +  IE L +R 
Sbjct: 180 LNVYDILLHKHIVLLQPCIEQLRERL 205


>gi|309789666|ref|ZP_07684247.1| ribosomal protein L4/L1e [Oscillochloris trichoides DG6]
 gi|308228402|gb|EFO82049.1| ribosomal protein L4/L1e [Oscillochloris trichoides DG6]
          Length = 220

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 116/205 (56%), Gaps = 3/205 (1%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +E ++ N  GE  G I+++E IF ++P   ++ + +  Q    R+G   ++GR EV+ + 
Sbjct: 1   MEATLYNQAGEQIGSIALNESIFGIEPNVPVMHQYVVMQRANARLGTHNTRGRGEVSGST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTGRAR  S       GGG A GP P      +PKK+R LA+R ALS K  +N
Sbjct: 61  KKLYRQKGTGRARQGSIRAPHRMGGGIAHGPHPRSYRLNMPKKMRRLAVRSALSAKLAAN 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDR---NFQLAARNIPNINLLPV 178
            I  +D L  ++ +TK +V   +A  LS   +I   Q +    N +L+A N+P++ +L  
Sbjct: 121 QIRFVDALTLEKPRTKDMVAFLKAHTLSGKTLIVIDQKNAQTGNVRLSANNLPDVQILLA 180

Query: 179 QGINVYDILRCSKLVLSKSAIEALE 203
             +NV D+L C  +VL K+A+  +E
Sbjct: 181 HYLNVRDLLTCDTVVLPKAAVAVIE 205


>gi|21553676|gb|AAM62769.1| 50S ribosomal protein L4 [Arabidopsis thaliana]
          Length = 300

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 116/204 (56%), Gaps = 1/204 (0%)

Query: 4   LSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSK 63
           + V N   E+KG + ++ D+F +  ++ I+  V+RWQ  +++ G   +K  SEV+ TG K
Sbjct: 91  IPVTNFQNEEKGFMVLAGDVFDVPIRKDIIHNVVRWQLAKRQQGTHSTKTLSEVSGTGRK 150

Query: 64  MYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDI 123
            + QKGTGRARH +    QFRGG    GP P      + K+VR L L+ AL+ +     +
Sbjct: 151 PWNQKGTGRARHGTLRGPQFRGGCVMHGPKPRSHAIKMNKQVRRLGLKIALTARAAEGKL 210

Query: 124 MVIDNLVSKECKTKYLVTRFRALD-LSNALIIDGCQLDRNFQLAARNIPNINLLPVQGIN 182
           +V D+L     KTK +V  +  ++     L+++G  +D   +LA +N+  +N++P  G+N
Sbjct: 211 LVFDDLGLPTHKTKNIVNYYNQMENTKKVLVVEGGPIDEKLKLATQNLHYVNIIPSIGLN 270

Query: 183 VYDILRCSKLVLSKSAIEALEDRF 206
           VY IL    LV+S+ A+  + +R 
Sbjct: 271 VYSILLHDTLVMSRDAVNKIVERM 294


>gi|218282170|ref|ZP_03488469.1| hypothetical protein EUBIFOR_01051 [Eubacterium biforme DSM 3989]
 gi|218216849|gb|EEC90387.1| hypothetical protein EUBIFOR_01051 [Eubacterium biforme DSM 3989]
          Length = 209

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 72/206 (34%), Positives = 110/206 (53%), Gaps = 2/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + V N  G   G I +++ +F ++P Q  +   L  Q   +R G + +KGRSEV+  
Sbjct: 1   MATIDVINQTGAVVGSIELNDAVFGIEPHQQAMYDALVMQMASRRQGTADTKGRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K Y QKGTGRAR  S   +QFRGGG  FG  P    + + KKVR LA++ ALS+K   
Sbjct: 61  GRKPYRQKGTGRARQGSIRATQFRGGGTVFGATPRNYAYRINKKVRRLAVKSALSEKVQE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDL--SNALIIDGCQLDRNFQLAARNIPNINLLPV 178
               V+D     E KTK  V+   A+        ++   +   N  L+ARNI    ++  
Sbjct: 121 TAFSVLDKFEIAEPKTKTFVSIIEAIQAPKKTLFVVADSEEATNVYLSARNIAGATVMAA 180

Query: 179 QGINVYDILRCSKLVLSKSAIEALED 204
             IN YD++  +K+V++ +A++ +E+
Sbjct: 181 SAINTYDLVNANKVVMTSAAVKQVEE 206


>gi|28212174|ref|NP_783118.1| 50S ribosomal protein L4 [Clostridium tetani E88]
 gi|46577246|sp|Q890P0|RL4_CLOTE RecName: Full=50S ribosomal protein L4
 gi|28204618|gb|AAO37055.1| LSU ribosomal protein L1E(= L4P) [Clostridium tetani E88]
          Length = 206

 Score =  128 bits (322), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 72/206 (34%), Positives = 118/206 (57%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + + N +G+  G   +S+ +F ++  + +L +V+  Q   KR G   SK R+EV+  
Sbjct: 1   MPTVGLFNKEGQKVGDFQLSDKVFGVEVNKEVLHQVIVAQLANKRQGTQSSKTRAEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+  GG  F P P     A+PK ++ +A++ ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRAPQWIKGGVVFAPKPRDYSMAIPKSMKRVAMKSALSSKVQE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+I+++++L +   KTK +V    A +    LI+   + ++N   +ARNI  + +LPV  
Sbjct: 121 NEIVILESLEADAPKTKEIVKMLAAFNAKKTLIVT-EESNKNIYKSARNIEGVTVLPVNN 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYDILR  K +++K A+  +E+ +
Sbjct: 180 INVYDILRYDKFIITKDAVSKIEEVY 205


>gi|224477219|ref|YP_002634825.1| 50S ribosomal protein L4 [Staphylococcus carnosus subsp. carnosus
           TM300]
 gi|254803753|sp|B9DM18|RL4_STACT RecName: Full=50S ribosomal protein L4
 gi|222421826|emb|CAL28640.1| 50S ribosomal protein L4 [Staphylococcus carnosus subsp. carnosus
           TM300]
          Length = 207

 Score =  128 bits (322), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 108/204 (52%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M    V  +DG   G + +S+ +FA++P + ++   +  Q    R G    K RS V   
Sbjct: 1   MANYDVLKVDGSKAGSVELSDSVFAIEPNKDVIFEAINLQRASLRQGTHSVKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  +    Q+RGGG  FGP P    + +PKK+R LALR ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGTIRAPQWRGGGIVFGPTPRSYSYKMPKKMRRLALRSALSFKVQE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N   V+D    +  KTK        L+L   +++     D N +L+ARNIP + +  V G
Sbjct: 121 NGFTVVDAFGLEAPKTKEFTKVLSNLELPKKVLVVTESEDVNVELSARNIPGVQITTVTG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV DI     ++++++A + +E+
Sbjct: 181 LNVLDITSADSVLITEAAAKKVEE 204


>gi|227512865|ref|ZP_03942914.1| 50S ribosomal protein L4 [Lactobacillus buchneri ATCC 11577]
 gi|227522993|ref|ZP_03953042.1| 50S ribosomal protein L4 [Lactobacillus hilgardii ATCC 8290]
 gi|227083865|gb|EEI19177.1| 50S ribosomal protein L4 [Lactobacillus buchneri ATCC 11577]
 gi|227089811|gb|EEI25123.1| 50S ribosomal protein L4 [Lactobacillus hilgardii ATCC 8290]
          Length = 207

 Score =  128 bits (322), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 111/204 (54%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++   DG   G +S+++DIF ++P   ++   +  Q   +R G    K RS V   
Sbjct: 1   MTDVALYKQDGSQNGTVSLNDDIFGIEPNNNVVFDAVVMQRASRRQGTHSVKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LPKKV  LAL+  LS+K   
Sbjct: 61  GKKPWRQKGTGRARQGSIRSPQWRGGGIVFGPTPRSYAYHLPKKVSRLALKSVLSEKVAD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             ++V+D+LV +  KTK        L++S   +I     +    L+A N+ N+ ++   G
Sbjct: 121 EKLVVVDSLVFETPKTKEFAALLEKLNVSTKTLIVLEDGNEKASLSAHNLENVKVVSADG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           IN  D+    K+V++K+A+  +E+
Sbjct: 181 INTLDVADHDKVVITKAALSQVEE 204


>gi|223042572|ref|ZP_03612621.1| ribosomal protein L4/L1 family [Staphylococcus capitis SK14]
 gi|314934296|ref|ZP_07841655.1| ribosomal protein L4/L1 family protein [Staphylococcus caprae C87]
 gi|222444235|gb|EEE50331.1| ribosomal protein L4/L1 family [Staphylococcus capitis SK14]
 gi|313652226|gb|EFS15989.1| ribosomal protein L4/L1 family protein [Staphylococcus caprae C87]
          Length = 207

 Score =  128 bits (322), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 106/204 (51%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M    V  +DG   G + +S+ +FA++P   +L   +  Q    R G    K RS V   
Sbjct: 1   MANYDVLKVDGSKSGSVELSDSVFAIEPNNSVLFEAINLQRASLRQGTHAVKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  +    Q+RGGG  FGP P    + +PKK+R LALR ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGTIRAPQWRGGGIVFGPTPRSYSYKMPKKMRRLALRSALSFKVQE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N   V+D+      KTK        L+    +++     D N +L+ARNIP + +   QG
Sbjct: 121 NGFTVVDSFGFDAPKTKEFKNVLSTLEQPKKVLVVTEDEDVNVELSARNIPGVQVSTAQG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV DI     +V++++A + +E+
Sbjct: 181 LNVLDITSADSVVITEAAAKKVEE 204


>gi|294463048|gb|ADE77062.1| unknown [Picea sitchensis]
          Length = 323

 Score =  128 bits (322), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 75/206 (36%), Positives = 114/206 (55%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           + L V N+  EDKG+I ++ D+F +  ++ I+ RV+RWQ  ++R G   +K  SEV+ TG
Sbjct: 112 LTLRVTNMRNEDKGMIVLAGDVFDVPIRKDIIHRVVRWQLAKRRQGTHSTKTISEVSGTG 171

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K + QKGTG+ARH +    QFR G    GP P      L KKVR L L+ ALS +    
Sbjct: 172 RKPWPQKGTGKARHGTLRGPQFRHGATMHGPKPRSHAIKLQKKVRRLGLKIALSARAAEG 231

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALD-LSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            +MV D       KTK +      L+     L+++G  +++   LA +N+   N+LP  G
Sbjct: 232 KLMVFDTFDLTTHKTKEVAKYVSQLENCKKILLVEGGPVNKKLGLATQNLHYANVLPSIG 291

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVY IL+   LV++  A+  + +R 
Sbjct: 292 LNVYSILQHDTLVMTADAVNRIVERM 317


>gi|282926795|ref|ZP_06334422.1| 50S ribosomal protein L4/L1 [Staphylococcus aureus A10102]
 gi|282591246|gb|EFB96319.1| 50S ribosomal protein L4/L1 [Staphylococcus aureus A10102]
          Length = 207

 Score =  128 bits (322), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 106/204 (51%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M    V  LDG   G I +S+ +F ++P   +L   +  Q      G    K RS V+  
Sbjct: 1   MANYDVLKLDGTKSGSIELSDAVFGIEPNNSVLFEAINLQRASLCQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  +    Q+RGGG  FGP P    + +PKK+R LALR ALS K   
Sbjct: 61  GRKPWKQKGTGRARQGTIRAPQWRGGGIVFGPTPRSYAYKMPKKMRRLALRSALSFKAQE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N + V+D    +  KTK        L+    +++     D N +L+ARNIP + +   QG
Sbjct: 121 NGLTVVDAFNFEAPKTKEFKNVLSTLEQPKKVLVVTENEDVNVELSARNIPGVQVTTAQG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV DI     LV++++A + +E+
Sbjct: 181 LNVLDITNADSLVITEAAAKKVEE 204


>gi|226309809|ref|YP_002769703.1| 50S ribosomal protein L4 [Brevibacillus brevis NBRC 100599]
 gi|254803719|sp|C0ZII1|RL4_BREBN RecName: Full=50S ribosomal protein L4
 gi|226092757|dbj|BAH41199.1| 50S ribosomal protein L4 [Brevibacillus brevis NBRC 100599]
          Length = 207

 Score =  128 bits (321), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 115/204 (56%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N  G   G I +++ +F ++P   +L   +  Q   +R G    K RSEV   
Sbjct: 1   MPKVALYNQTGSQVGEIDLADSVFGIEPNSAVLYDAIVMQQASQRQGTHDVKNRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q++GGG  FGP P    + L +KVR LAL+ ALS K  +
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWKGGGVVFGPTPRKYGYKLNRKVRRLALKSALSTKVQN 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+++V++ L     KTK +     +L +   ++I   + D+N  LA+RNIP   ++   G
Sbjct: 121 NELLVLEALNFAAPKTKEMTAVLSSLKVDRKVLIVTSEYDQNVALASRNIPGTKIVDAAG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           INV D++   K+++++ A+  +E+
Sbjct: 181 INVLDLVAHDKVIVTREAVAKVEE 204


>gi|227530206|ref|ZP_03960255.1| ribosomal protein L4 [Lactobacillus vaginalis ATCC 49540]
 gi|227349881|gb|EEJ40172.1| ribosomal protein L4 [Lactobacillus vaginalis ATCC 49540]
          Length = 207

 Score =  128 bits (321), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 110/204 (53%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +++   DG   G I ++ DIF ++P +      +  Q    R G    K RS V+  
Sbjct: 1   MTSVNLYKQDGSQNGTIDLNADIFGIEPNENAEFEAILRQRASMRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    QFRGGG  FGP P    ++LP+KVR LA++ ALS K   
Sbjct: 61  GKKPWRQKGTGRARQGSIRSPQFRGGGIVFGPTPRSYKYSLPRKVRQLAIKSALSQKVLD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N ++V+D L     KTK        L ++  +++     D+N  L+ARN+ N  ++   G
Sbjct: 121 NALVVVDALNFDAPKTKEFAGVMDNLKVAEKVLVVVTDDDKNAALSARNLANATVVTPAG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +N+  ++   K+V++KSA+  +E+
Sbjct: 181 VNILSVVDSQKIVITKSALSQVEE 204


>gi|73661973|ref|YP_300754.1| 50S ribosomal protein L4 [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|82581595|sp|Q49ZG7|RL4_STAS1 RecName: Full=50S ribosomal protein L4
 gi|72494488|dbj|BAE17809.1| 50S ribosomal protein L4 [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
          Length = 207

 Score =  128 bits (321), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 106/204 (51%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M    V  +DG   G + +S+ +FA++P   +L   +  Q    R G    K RS V   
Sbjct: 1   MANYDVLKVDGTKSGSVELSDAVFAIEPNNNVLFEAINLQRASLRQGTHAVKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  +    Q+RGGG  FGP P    + +PKK+R LALR ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGTIRAPQWRGGGIVFGPTPRSYSYKMPKKMRRLALRSALSFKVQE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             + V+D L     KTK   T    L+    +++     D N  L+ARNIP + +   QG
Sbjct: 121 KGLTVVDALNLDAPKTKEFKTVLSNLEQPKKVLVVTESEDVNVALSARNIPGVQVTTAQG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV DI     +V+++SA + +E+
Sbjct: 181 LNVLDITSADSVVITESAAKKVEE 204


>gi|227509932|ref|ZP_03939981.1| 50S ribosomal protein L4 [Lactobacillus brevis subsp. gravesensis
           ATCC 27305]
 gi|227190538|gb|EEI70605.1| 50S ribosomal protein L4 [Lactobacillus brevis subsp. gravesensis
           ATCC 27305]
          Length = 207

 Score =  128 bits (321), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 111/204 (54%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++   DG   G +S+++D+F ++P   ++   +  Q   +R G    K RS V   
Sbjct: 1   MTDVALYKQDGSQNGTVSLNDDVFGIEPNNNVVFDAVVMQRASRRQGTHSVKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LPKKV  LAL+  LS+K   
Sbjct: 61  GKKPWRQKGTGRARQGSIRSPQWRGGGIVFGPTPRSYAYHLPKKVSRLALKSVLSEKVAD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             ++V+D+LV +  KTK        L++S   +I     +    L+A N+ N+ ++   G
Sbjct: 121 EKLVVVDSLVFETPKTKEFAALLEKLNVSTKTLIVLEDGNEKASLSAHNLENVKVVSADG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           IN  D+    K+V++K+A+  +E+
Sbjct: 181 INTLDVADHDKVVITKAALSQVEE 204


>gi|168041144|ref|XP_001773052.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162675599|gb|EDQ62092.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 269

 Score =  128 bits (321), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 74/207 (35%), Positives = 116/207 (56%), Gaps = 2/207 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +E+ V N   EDKG+ +++ D+F +  +  ++ RV+RWQ  ++R G + +KG  EV+ TG
Sbjct: 57  VEVKVTNFQSEDKGLATLAGDVFDVPIRPDVVHRVVRWQLAKRRQGTASTKGIHEVSGTG 116

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K   QKG+GRARH S    QFRGG    GP P      L K+VR L L+ ALS +    
Sbjct: 117 RKPGPQKGSGRARHGSLRGPQFRGGATQHGPKPRSHEIGLQKQVRRLGLKVALSSRVAEG 176

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALD-LSNALIIDGCQ-LDRNFQLAARNIPNINLLPVQ 179
            + V D++     KT+ +      ++     LI+D  + ++ +   A  N+  +N+LP +
Sbjct: 177 KLKVFDSVEPPTLKTREMERLIADIEGCKKVLIVDDAETVNESLCRATGNLHYVNVLPAK 236

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRF 206
           G+NVY IL+   LV+S  AI  +E+R 
Sbjct: 237 GLNVYSILQHDTLVMSVGAIRRIEERL 263


>gi|167519925|ref|XP_001744302.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163777388|gb|EDQ91005.1| predicted protein [Monosiga brevicollis MX1]
          Length = 229

 Score =  127 bits (320), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 78/195 (40%), Positives = 109/195 (55%), Gaps = 5/195 (2%)

Query: 15  GVISVSEDIFALKPQQGILARVLRWQS--WRKRIGCSKSKGRSEVAYTGSKMYVQKGTGR 72
           GV+ +   +F  + +  I+ RV+ WQ   WRK  G +K+K R EV   G K + QKGTGR
Sbjct: 14  GVMELDPTVFGEEIRVDIMHRVVVWQRALWRK--GNAKTKTRGEVRGGGRKPHPQKGTGR 71

Query: 73  ARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNLVSK 132
           AR  S  V  +RGGG   GP+P      LP+KVR   +R A+S ++  ND++++D+LV  
Sbjct: 72  ARTGSIRVPNWRGGGVVHGPIPRDWSQKLPRKVRQKGVRVAISTRYQQNDLVIVDDLVLP 131

Query: 133 ECKTKYLVTRFRALDLSNALIIDGCQLDR-NFQLAARNIPNINLLPVQGINVYDILRCSK 191
             KTK L        L +AL + G   D  N + A RN+P  +     G +VY+IL+  K
Sbjct: 132 TLKTKSLAEIAAQHRLESALFVYGHDEDSMNLKWACRNMPAFHATSAAGAHVYNILKHDK 191

Query: 192 LVLSKSAIEALEDRF 206
           LVLS SA+  LE R 
Sbjct: 192 LVLSVSAVRDLERRL 206


>gi|298243967|ref|ZP_06967774.1| ribosomal protein L4/L1e [Ktedonobacter racemifer DSM 44963]
 gi|297557021|gb|EFH90885.1| ribosomal protein L4/L1e [Ktedonobacter racemifer DSM 44963]
          Length = 234

 Score =  127 bits (320), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 72/208 (34%), Positives = 114/208 (54%), Gaps = 2/208 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M   +V N+ GE    + +SE +F + P   +L +V+  Q   +R G + +K RSEV+  
Sbjct: 1   MPSTTVYNMAGEAVEQLELSEQVFGVTPNMAVLHQVVTAQLVNRRQGNASTKTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
             K Y QKGTGRAR  S    QFRGGG  FGP P    H +PKK+R LA+R  LSDK  +
Sbjct: 61  NKKPYRQKGTGRARQGSTRAPQFRGGGTVFGPKPHPYHHDVPKKMRRLAIRSVLSDKVAN 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNA--LIIDGCQLDRNFQLAARNIPNINLLPV 178
             +++++ L  +  +TK ++   + L  S    +++   + D N  L+ RNIP+  +  V
Sbjct: 121 QSLIIVNKLEMETPRTKDMLELLKKLPSSEGKKVLMMLPKRDENVVLSTRNIPSAKVQHV 180

Query: 179 QGINVYDILRCSKLVLSKSAIEALEDRF 206
             INV ++L+   +V++   +  +E  F
Sbjct: 181 SSINVVELLKHDYIVMTPKTVRWIELVF 208


>gi|18399235|ref|NP_565463.1| ribosomal protein L4 family protein [Arabidopsis thaliana]
 gi|18252969|gb|AAL62411.1| 50S ribosomal protein L4 [Arabidopsis thaliana]
 gi|20197568|gb|AAD24390.2| 50S ribosomal protein L4 [Arabidopsis thaliana]
 gi|25084070|gb|AAN72167.1| 50S ribosomal protein L4 [Arabidopsis thaliana]
 gi|330251866|gb|AEC06960.1| large subunit ribosomal protein L4 [Arabidopsis thaliana]
          Length = 300

 Score =  127 bits (320), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 116/204 (56%), Gaps = 1/204 (0%)

Query: 4   LSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSK 63
           + V N   E+KG + ++ D+F +  ++ I+  V+RWQ  +++ G   +K  SEV+ TG K
Sbjct: 91  IPVTNFQNEEKGFMVLAGDVFDVPIRKDIIHNVVRWQLAKRQQGTHSTKTLSEVSGTGRK 150

Query: 64  MYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDI 123
            + QKGTGRARH +    QFRGG    GP P      + K+VR L L+ AL+ +     +
Sbjct: 151 PWNQKGTGRARHGTLRGPQFRGGCVMHGPKPRSHAIKMNKQVRRLGLKIALTARAAEGKL 210

Query: 124 MVIDNLVSKECKTKYLVTRFRALD-LSNALIIDGCQLDRNFQLAARNIPNINLLPVQGIN 182
           +V D+L     KTK +V  +  ++     L+++G  +D   +LA +N+  +N++P  G+N
Sbjct: 211 LVFDDLGLPTHKTKNIVNYYNQMENTKKVLVVEGGPIDEKLKLATQNLHYVNIIPSIGLN 270

Query: 183 VYDILRCSKLVLSKSAIEALEDRF 206
           VY IL    L++S+ A+  + +R 
Sbjct: 271 VYSILLHDTLLMSRDAVNKIVERM 294


>gi|27468741|ref|NP_765378.1| 50S ribosomal protein L4 [Staphylococcus epidermidis ATCC 12228]
 gi|57867722|ref|YP_189393.1| 50S ribosomal protein L4 [Staphylococcus epidermidis RP62A]
 gi|242243948|ref|ZP_04798391.1| 50S ribosomal protein L4 [Staphylococcus epidermidis W23144]
 gi|251812048|ref|ZP_04826521.1| 50S ribosomal protein L4 [Staphylococcus epidermidis BCM-HMP0060]
 gi|282875343|ref|ZP_06284216.1| ribosomal protein L4/L1 family protein [Staphylococcus epidermidis
           SK135]
 gi|293368434|ref|ZP_06615058.1| 50S ribosomal protein L4 [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|46577254|sp|Q8CRG1|RL4_STAES RecName: Full=50S ribosomal protein L4
 gi|81673579|sp|Q5HM00|RL4_STAEQ RecName: Full=50S ribosomal protein L4
 gi|27316289|gb|AAO05464.1|AE016750_69 50S ribosomal protein L4 [Staphylococcus epidermidis ATCC 12228]
 gi|57638380|gb|AAW55168.1| ribosomal protein L4 [Staphylococcus epidermidis RP62A]
 gi|242232581|gb|EES34893.1| 50S ribosomal protein L4 [Staphylococcus epidermidis W23144]
 gi|251804382|gb|EES57039.1| 50S ribosomal protein L4 [Staphylococcus epidermidis BCM-HMP0060]
 gi|261264939|gb|ACX55828.1| 50S ribosomal protein L4 [Staphylococcus epidermidis]
 gi|281296108|gb|EFA88629.1| ribosomal protein L4/L1 family protein [Staphylococcus epidermidis
           SK135]
 gi|291317392|gb|EFE57814.1| 50S ribosomal protein L4 [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|319400622|gb|EFV88847.1| 50S ribosomal protein L4 [Staphylococcus epidermidis FRI909]
 gi|329736448|gb|EGG72716.1| 50S ribosomal protein L4 [Staphylococcus epidermidis VCU028]
 gi|329737013|gb|EGG73268.1| 50S ribosomal protein L4 [Staphylococcus epidermidis VCU045]
          Length = 207

 Score =  127 bits (319), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 106/204 (51%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M    V  +DG   G + +++ +FA++P   +L   +  Q    R G    K RS V   
Sbjct: 1   MANYDVLKVDGSKSGSVELNDAVFAIEPNNSVLFEAINLQRASLRQGTHAVKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  +    Q+RGGG  FGP P    + +PKK+R LALR ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGTIRAPQWRGGGVVFGPTPRSYAYKMPKKMRRLALRSALSFKVQE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N   ++D    +  KTK        L+    +++     D N +L+ARNIP + +   QG
Sbjct: 121 NSFTIVDTFGFEAPKTKEFKNVLTTLEQPKKVLVVTENEDVNVELSARNIPGVQVTTAQG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV D+     ++++++A + +E+
Sbjct: 181 LNVLDLTSADSVIITEAAAKKVEE 204


>gi|259500893|ref|ZP_05743795.1| 50S ribosomal protein L4 [Lactobacillus iners DSM 13335]
 gi|302190654|ref|ZP_07266908.1| 50S ribosomal protein L4 [Lactobacillus iners AB-1]
 gi|309803686|ref|ZP_07697776.1| 50S ribosomal protein L4 [Lactobacillus iners LactinV 11V1-d]
 gi|309804951|ref|ZP_07699009.1| 50S ribosomal protein L4 [Lactobacillus iners LactinV 09V1-c]
 gi|309806704|ref|ZP_07700699.1| 50S ribosomal protein L4 [Lactobacillus iners LactinV 03V1-b]
 gi|309808465|ref|ZP_07702364.1| 50S ribosomal protein L4 [Lactobacillus iners LactinV 01V1-a]
 gi|309809135|ref|ZP_07703008.1| 50S ribosomal protein L4 [Lactobacillus iners SPIN 2503V10-D]
 gi|312871314|ref|ZP_07731412.1| 50S ribosomal protein L4 [Lactobacillus iners LEAF 3008A-a]
 gi|312872623|ref|ZP_07732688.1| 50S ribosomal protein L4 [Lactobacillus iners LEAF 2062A-h1]
 gi|312874014|ref|ZP_07734049.1| 50S ribosomal protein L4 [Lactobacillus iners LEAF 2052A-d]
 gi|312874786|ref|ZP_07734805.1| 50S ribosomal protein L4 [Lactobacillus iners LEAF 2053A-b]
 gi|315654025|ref|ZP_07906941.1| 50S ribosomal protein L4 [Lactobacillus iners ATCC 55195]
 gi|325912358|ref|ZP_08174754.1| 50S ribosomal protein L4 [Lactobacillus iners UPII 143-D]
 gi|325913218|ref|ZP_08175587.1| 50S ribosomal protein L4 [Lactobacillus iners UPII 60-B]
 gi|329920653|ref|ZP_08277340.1| 50S ribosomal protein L4 [Lactobacillus iners SPIN 1401G]
 gi|259167587|gb|EEW52082.1| 50S ribosomal protein L4 [Lactobacillus iners DSM 13335]
 gi|308164284|gb|EFO66541.1| 50S ribosomal protein L4 [Lactobacillus iners LactinV 11V1-d]
 gi|308165711|gb|EFO67936.1| 50S ribosomal protein L4 [Lactobacillus iners LactinV 09V1-c]
 gi|308166884|gb|EFO69068.1| 50S ribosomal protein L4 [Lactobacillus iners LactinV 03V1-b]
 gi|308168293|gb|EFO70412.1| 50S ribosomal protein L4 [Lactobacillus iners LactinV 01V1-a]
 gi|308170580|gb|EFO72600.1| 50S ribosomal protein L4 [Lactobacillus iners SPIN 2503V10-D]
 gi|311089531|gb|EFQ47956.1| 50S ribosomal protein L4 [Lactobacillus iners LEAF 2053A-b]
 gi|311090354|gb|EFQ48763.1| 50S ribosomal protein L4 [Lactobacillus iners LEAF 2052A-d]
 gi|311091665|gb|EFQ50044.1| 50S ribosomal protein L4 [Lactobacillus iners LEAF 2062A-h1]
 gi|311093328|gb|EFQ51674.1| 50S ribosomal protein L4 [Lactobacillus iners LEAF 3008A-a]
 gi|315488721|gb|EFU78367.1| 50S ribosomal protein L4 [Lactobacillus iners ATCC 55195]
 gi|325475829|gb|EGC78999.1| 50S ribosomal protein L4 [Lactobacillus iners UPII 143-D]
 gi|325477482|gb|EGC80625.1| 50S ribosomal protein L4 [Lactobacillus iners UPII 60-B]
 gi|328935911|gb|EGG32371.1| 50S ribosomal protein L4 [Lactobacillus iners SPIN 1401G]
          Length = 204

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 115/203 (56%), Gaps = 2/203 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           + + V +  G+  G + +++ IF ++P   ++   +  Q   KR G   +K RS V+  G
Sbjct: 1   MAIKVIDQKGKSVGEVDLNKCIFEVEPNDSVVFEAIIRQRAGKRQGTHATKNRSAVSGGG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K + QKGTGRAR  S    Q+RGGG  FGP P      +P+K R LA++  LS K    
Sbjct: 61  KKPWKQKGTGRARQGSIRAPQWRGGGTVFGPTPRSYKVDMPRKARRLAIKSVLSQKVADG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           +++V+D L     KTK L   F A+ +S  +++     D+N QL+ +N+P + ++PV G+
Sbjct: 121 NLIVLDQLTLATPKTKDLKAIFSAIKVSGKVLV--VSDDKNVQLSGKNLPQVKVVPVNGL 178

Query: 182 NVYDILRCSKLVLSKSAIEALED 204
           NV D +   KL+L++ AI+ +E+
Sbjct: 179 NVVDAVDYEKLLLTQDAIKRIEE 201


>gi|302344355|ref|YP_003808884.1| ribosomal protein L4/L1e [Desulfarculus baarsii DSM 2075]
 gi|301640968|gb|ADK86290.1| ribosomal protein L4/L1e [Desulfarculus baarsii DSM 2075]
          Length = 206

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 113/204 (55%), Gaps = 1/204 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ V +   +  G I +++++FA + +  +L  V+ WQ  ++R G + +K RSEV   
Sbjct: 1   MPKVDVYDEKKQKVGEIELADEVFAAEVKAHLLHEVVVWQLAKRRAGTACTKTRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S+    +RGGG   GP P    + +PKKVR  AL+ ALSDK   
Sbjct: 61  GRKPWRQKGTGRARVGSRRSPLWRGGGTTHGPKPRDYDYNVPKKVRKAALKSALSDKLAE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             +MV+     +  KTK            N L++     D   + +ARNIP + +L  +G
Sbjct: 121 EKLMVLRGFGLEAIKTKAFAEVLATFQTQNVLVVTAGP-DEVLEKSARNIPMVKVLRAEG 179

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NVYDILR  +L+L + A+  +E+
Sbjct: 180 LNVYDILRYDRLMLLEPAVGRIEE 203


>gi|261264935|gb|ACX55826.1| 50S ribosomal protein L4 [Staphylococcus epidermidis]
          Length = 207

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 106/204 (51%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M    V  +DG   G + +++ +FA++P   +L   +  Q    R G    K RS V   
Sbjct: 1   MANYDVLKVDGSKSGSVELNDAVFAIEPNNSVLFEAINLQRASLRQGTHAVKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  +    Q+RGGG  FGP P    + +PKK+R LALR ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGTIRAPQWRGGGVVFGPTPRSYAYKMPKKMRRLALRSALSFKVQE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N   ++D    +  KTK        L+    +++     D N +L+ARNIP + +   QG
Sbjct: 121 NSFTIVDTFGFEAPKTKEFKNVLTTLEQPKKVLVVTESEDVNVELSARNIPGVQVTTAQG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV D+     ++++++A + +E+
Sbjct: 181 LNVLDLTSADSVIITEAAAKKVEE 204


>gi|319893199|ref|YP_004150074.1| LSU ribosomal protein L4p (L1e) [Staphylococcus pseudintermedius
           HKU10-03]
 gi|317162895|gb|ADV06438.1| LSU ribosomal protein L4p (L1e) [Staphylococcus pseudintermedius
           HKU10-03]
 gi|323463753|gb|ADX75906.1| ribosomal protein L4 [Staphylococcus pseudintermedius ED99]
          Length = 207

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 107/204 (52%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M    V  +DG   G + +S+ +F ++P   +L   +  Q    R G    K RS V   
Sbjct: 1   MANYDVYKVDGSKAGTVELSDSVFGIEPNNDVLFEAINLQRASLRQGTHAVKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  +    Q+RGGG  FGP P    + +PKK+R LALR ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGTIRAPQWRGGGIVFGPTPRSYGYKMPKKMRRLALRSALSYKVQE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N   ++D+   +  KTK   T    L+L   +++     D N +L+ARNIP + +   +G
Sbjct: 121 NGFKIVDSFNLEAPKTKEFKTTLTNLELPKKVLVVTVGEDVNVELSARNIPGVTITTPEG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV ++     +++++ A + +E+
Sbjct: 181 LNVLELTHADSVLITQEAAKKVEE 204


>gi|329731224|gb|EGG67594.1| 50S ribosomal protein L4 [Staphylococcus epidermidis VCU144]
          Length = 207

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 106/204 (51%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M    V  +DG   G + +++ +FA++P   +L   +  Q    R G    K RS V   
Sbjct: 1   MANYDVLKVDGSKSGSVDLNDAVFAIEPNNSVLFEAINLQRASLRQGTHAVKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  +    Q+RGGG  FGP P    + +PKK+R LALR ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGTIRAPQWRGGGVVFGPTPRSYAYKMPKKMRRLALRSALSFKVQE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N   ++D    +  KTK        L+    +++     D N +L+ARNIP + +   QG
Sbjct: 121 NSFTIVDTFGFEAPKTKEFKNVLTTLEQPKKVLVVTENEDVNVELSARNIPGVQVTTAQG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV D+     ++++++A + +E+
Sbjct: 181 LNVLDLTSADSVIITEAAAKKVEE 204


>gi|260893371|ref|YP_003239468.1| ribosomal protein L4/L1e [Ammonifex degensii KC4]
 gi|260865512|gb|ACX52618.1| ribosomal protein L4/L1e [Ammonifex degensii KC4]
          Length = 207

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 116/207 (56%), Gaps = 6/207 (2%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M + +V NL GE  G + + E++F ++P   ++  V+      +R G   +K R EV   
Sbjct: 1   MPKATVYNLAGEPVGEMELKEEVFGIEPNPYVVHEVVVMHLANRRRGTHSTKTRGEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRARH S     +R GG  FGP P    + +PKKVR LAL+  LSDK  +
Sbjct: 61  GRKPWRQKGTGRARHGSIRSPIWRKGGVVFGPKPRDYDYTVPKKVRRLALKSVLSDKLRA 120

Query: 121 NDIMVIDNLVSKECKTKY---LVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLP 177
            +++V++ L  +  KTK    L++RF    +   +++ G   D   +LA  N+  +  LP
Sbjct: 121 GNLVVLEELRLEAPKTKLAKELLSRF---GVETGVLLVGADPDPVVKLATANLEGVKFLP 177

Query: 178 VQGINVYDILRCSKLVLSKSAIEALED 204
           V  +NVYD+LR  K+ +++ A+  +E+
Sbjct: 178 VNNLNVYDLLRYPKVFITREALARVEE 204


>gi|317131370|ref|YP_004090684.1| ribosomal protein L4/L1e [Ethanoligenens harbinense YUAN-3]
 gi|315469349|gb|ADU25953.1| ribosomal protein L4/L1e [Ethanoligenens harbinense YUAN-3]
          Length = 207

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 72/206 (34%), Positives = 112/206 (54%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M + +V N+ GE  G I +++ +F ++P +  L  V+      +R G   +  RSEV+  
Sbjct: 1   MPKATVFNIAGEQVGEIELADSVFGIEPNKTALHTVVVNYLANQRQGTQSTLTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q++ GG A GP P    + + KKVR LAL+ ALS K  +
Sbjct: 61  GRKPWRQKGTGHARQGSTRAPQWKHGGIALGPKPRSYTYTVNKKVRRLALKSALSAKLAA 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            +++V+D +   E KTK +VT     + S   +     ++ N   +ARNIP +       
Sbjct: 121 GELVVLDAISLPEIKTKQVVTILSKFETSKKALFVTAGVNENLVKSARNIPGVKTASTGS 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVYD+L  +K  +SK A+ ALE+ +
Sbjct: 181 LNVYDLLDSNKFFISKDAVAALEEVY 206


>gi|295694838|ref|YP_003588076.1| ribosomal protein L4/L1e [Bacillus tusciae DSM 2912]
 gi|295410440|gb|ADG04932.1| ribosomal protein L4/L1e [Bacillus tusciae DSM 2912]
          Length = 207

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 113/206 (54%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +++V N  GE  G + +SE +F +  +  +L + +  Q    R G   +K R+ V   
Sbjct: 1   MPKVAVYNAAGEQVGELELSEKVFGVDVKPAVLHQAVVAQLANARQGTRATKNRALVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+ GGG  FGP P      LPKK+R LA+R ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRAPQWVGGGTVFGPQPRDFSMRLPKKLRRLAIRGALSSKVSE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             ++V+D+L  +  KTK ++     L +    ++ G  L++   L+ARNIP +  LP   
Sbjct: 121 GSLIVLDSLQIEAPKTKEMIRILSNLKVPGKALVVGEGLNQPAHLSARNIPGVKYLPATD 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INV D+L    LV++ +A++ +E+ F
Sbjct: 181 INVVDLLHHDHLVVTTAAVKRIEEVF 206


>gi|94266252|ref|ZP_01289959.1| Ribosomal protein L4/L1e [delta proteobacterium MLMS-1]
 gi|93453178|gb|EAT03642.1| Ribosomal protein L4/L1e [delta proteobacterium MLMS-1]
          Length = 207

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 69/206 (33%), Positives = 114/206 (55%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M    + N   E  G I +++ +  L+    +L  ++R Q   +R G + +K R EV+ +
Sbjct: 1   MAVTEIYNTSKEKVGEIDLNDQLVKLEVNPHLLHDIVRMQRANRRAGTAATKTRKEVSGS 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
             K + QKGTGRAR  ++    +RGGG  FGP P      +P+K R L LR A+S ++  
Sbjct: 61  SKKPWRQKGTGRARAGTRKSPVWRGGGTVFGPQPRDYSFRMPRKARRLGLRMAISARYQE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           + ++V+++    E KTK  V       + NALI+   +L+ N + ++RN+P   +LP +G
Sbjct: 121 DMLLVLEDFQLDEIKTKKFVEVMDNFAIDNALIVVAERLE-NLERSSRNVPGFKVLPAEG 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVYDIL    ++L K ++  LE+R 
Sbjct: 180 LNVYDILLHKHIILLKPSVGQLEERL 205


>gi|325663061|ref|ZP_08151511.1| 50S ribosomal protein L4 [Lachnospiraceae bacterium 4_1_37FAA]
 gi|331086668|ref|ZP_08335745.1| 50S ribosomal protein L4 [Lachnospiraceae bacterium 9_1_43BFAA]
 gi|325470515|gb|EGC73745.1| 50S ribosomal protein L4 [Lachnospiraceae bacterium 4_1_37FAA]
 gi|330409834|gb|EGG89269.1| 50S ribosomal protein L4 [Lachnospiraceae bacterium 9_1_43BFAA]
          Length = 206

 Score =  126 bits (317), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/208 (35%), Positives = 117/208 (56%), Gaps = 5/208 (2%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +SV N++G++ G I +S+ +F ++  + +L   +  Q   KR G  K+K RSEV   
Sbjct: 1   MANVSVYNIEGKEVGTIDLSDAVFGVEVNEHLLHMAVVSQLANKRQGTQKAKTRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+ GGG  F P P      L KK +  AL+ AL+ +   
Sbjct: 61  GRKPWRQKGTGHARQGSTRAPQWTGGGVVFAPTPRDYSFKLNKKEKRAALKSALTSRVEE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALII--DGCQLDRNFQLAARNIPNINLLPV 178
              +V+D +   E KTK        L+++ AL++  DG   ++N +L+ARNIP++     
Sbjct: 121 KKFIVLDEINFGEIKTKNFQNVLNNLNVAKALVVLEDG---NKNAELSARNIPSVKTART 177

Query: 179 QGINVYDILRCSKLVLSKSAIEALEDRF 206
             INVYDIL+ + ++ +K+A+E +E+ +
Sbjct: 178 NTINVYDILKYNTVIATKAAVETIEEVY 205


>gi|148544695|ref|YP_001272065.1| 50S ribosomal protein L4 [Lactobacillus reuteri DSM 20016]
 gi|184154048|ref|YP_001842389.1| 50S ribosomal protein L4 [Lactobacillus reuteri JCM 1112]
 gi|194466952|ref|ZP_03072939.1| ribosomal protein L4/L1e [Lactobacillus reuteri 100-23]
 gi|227363818|ref|ZP_03847925.1| ribosomal protein L4 [Lactobacillus reuteri MM2-3]
 gi|227543622|ref|ZP_03973671.1| ribosomal protein L4 [Lactobacillus reuteri CF48-3A]
 gi|300909349|ref|ZP_07126810.1| ribosomal protein L4/L1 family protein [Lactobacillus reuteri
           SD2112]
 gi|325683029|ref|ZP_08162545.1| 50S ribosomal protein L4 [Lactobacillus reuteri MM4-1A]
 gi|166990950|sp|A5VLK4|RL4_LACRD RecName: Full=50S ribosomal protein L4
 gi|226730679|sp|B2G8X7|RL4_LACRJ RecName: Full=50S ribosomal protein L4
 gi|148531729|gb|ABQ83728.1| LSU ribosomal protein L4P [Lactobacillus reuteri DSM 20016]
 gi|183225392|dbj|BAG25909.1| 50S ribosomal protein L4 [Lactobacillus reuteri JCM 1112]
 gi|194453988|gb|EDX42885.1| ribosomal protein L4/L1e [Lactobacillus reuteri 100-23]
 gi|227071175|gb|EEI09491.1| ribosomal protein L4 [Lactobacillus reuteri MM2-3]
 gi|227186462|gb|EEI66533.1| ribosomal protein L4 [Lactobacillus reuteri CF48-3A]
 gi|300893214|gb|EFK86573.1| ribosomal protein L4/L1 family protein [Lactobacillus reuteri
           SD2112]
 gi|324977379|gb|EGC14330.1| 50S ribosomal protein L4 [Lactobacillus reuteri MM4-1A]
          Length = 207

 Score =  126 bits (317), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 112/204 (54%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +++   DG   G + +++ +F ++P + ++   +  Q    R G    K RS V+  
Sbjct: 1   MTSVNLYKQDGSQNGTVELNDAVFGVEPNENVVFDAILRQRASLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    QFRGGG  FGP P    ++LP+KVR LA++ ALS K   
Sbjct: 61  GKKPWRQKGTGRARQGSIRSPQFRGGGIVFGPTPRSYKYSLPRKVRQLAIKSALSQKVLD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N  +V+D L     KTK        L+++   ++     D+N  L+ARN+ N  ++   G
Sbjct: 121 NSFVVVDALNFDAPKTKEFADVMGNLNVAEKTLVVVTDDDKNAALSARNLANATVVTPAG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +N+ +++   K+V++KSA+  +E+
Sbjct: 181 VNILNVVDNQKIVITKSALSQVEE 204


>gi|255038090|ref|YP_003088711.1| 50S ribosomal protein L4 [Dyadobacter fermentans DSM 18053]
 gi|254950846|gb|ACT95546.1| ribosomal protein L4/L1e [Dyadobacter fermentans DSM 18053]
          Length = 209

 Score =  126 bits (317), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 119/209 (56%), Gaps = 6/209 (2%)

Query: 2   IELSVRNLDGEDKGV-ISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           +ELSV N+ GED G  ++VSE++F ++P    +   ++     +R G  KSK R+EV+++
Sbjct: 1   MELSVLNIKGEDTGKKVTVSEEVFGIEPSTHAIYLDVKLYLANQRQGTHKSKERAEVSHS 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
             K+  QKGTG AR  S     F GGG+ FGP P      L KKV++LA R ALS K  +
Sbjct: 61  TRKIKRQKGTGGARAGSIKSPVFVGGGRIFGPRPRTYGFKLNKKVKALARRSALSVKAQA 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNA---LIIDGCQLDRNFQLAARNIPNINLLP 177
           N + V++       KTK  +    +L L+N    LI+   ++D N  L++RNIP   +  
Sbjct: 121 NAVSVLEAFTFDAPKTKSYLNVLNSLSLANTKTLLIL--PEIDNNVYLSSRNIPKAKVTT 178

Query: 178 VQGINVYDILRCSKLVLSKSAIEALEDRF 206
           V  +N YD++   +L++S+SAI  LE + 
Sbjct: 179 VDSVNTYDLMNADRLLISESAISILETQL 207


>gi|255282606|ref|ZP_05347161.1| ribosomal protein L4/L1 family protein [Bryantella formatexigens
           DSM 14469]
 gi|255266899|gb|EET60104.1| ribosomal protein L4/L1 family protein [Bryantella formatexigens
           DSM 14469]
          Length = 206

 Score =  126 bits (317), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 71/206 (34%), Positives = 117/206 (56%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +SV N++G++ G + +S+ +F ++  + ++   +  Q    R G  K+K RSEV+  
Sbjct: 1   MANVSVYNMEGKEVGTMELSDAVFGVEINEHLVHMAVLSQLANNRQGTQKAKTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q++GGG  F PVP      + KK +  AL+ AL+ +   
Sbjct: 61  GRKPWRQKGTGHARQGSTRAPQWKGGGVVFAPVPRDYSFKMNKKEKRAALKSALTSRVQE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N ++V+D L     KTK +V   + ++   AL++   + D N  ++ARNI  +       
Sbjct: 121 NKLVVLDELKLDAIKTKSMVNVLKNVNAEKALVVLN-ENDENVVMSARNIAGVKTALTNT 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYDIL+ + LV++K+A EA+E+ +
Sbjct: 180 INVYDILKYNTLVMTKAAAEAIEEVY 205


>gi|291562767|emb|CBL41583.1| LSU ribosomal protein L4P [butyrate-producing bacterium SS3/4]
          Length = 206

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 115/206 (55%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +SV N++G++ G I +++ +F ++  + ++   +  Q   KR G  K+K RSEV+  
Sbjct: 1   MANVSVYNMEGKEVGTIELNDAVFGVEVNEHLVHMAVVAQLANKRQGTQKAKTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+ GGG  F P P      L KK +  AL+ AL+ +   
Sbjct: 61  GRKPWRQKGTGHARQGSTRSPQWTGGGMVFAPTPRDYTITLNKKEKRAALKSALTSRVNE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N  +V+D L   E KTK        L +S AL++     D+N  L+ARNIP +    V  
Sbjct: 121 NKFVVVDELKFDEVKTKNFKAVMNNLKVSKALVVLADN-DQNTVLSARNIPEVKTSLVNT 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INV+DIL+ + +V +K+A+ ++E+ +
Sbjct: 180 INVFDILKYNTVVATKAAVASIEEVY 205


>gi|258591317|emb|CBE67616.1| 50S ribosomal subunit protein L4 [NC10 bacterium 'Dutch sediment']
          Length = 211

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 72/198 (36%), Positives = 112/198 (56%), Gaps = 12/198 (6%)

Query: 17  ISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGTGRARHS 76
           +++ E +F       ++  V+R Q   +R G + ++ RSEV   G K + QKGTGRAR  
Sbjct: 18  VTLDEMVFGAVGPSHLMHDVVRMQLANRRQGTASTRRRSEVRGGGKKPWKQKGTGRARSG 77

Query: 77  SKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNLVSKECKT 136
           ++    +RGGG  FGP P    + +P++VR+ ALR ALS+K  +   +V+D L   E  T
Sbjct: 78  TRRSPLWRGGGTVFGPQPRSYAYEIPRQVRASALRTALSEKVRAGQFVVVDGLSLAEPST 137

Query: 137 ---KYLVTRF----RALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRC 189
              K L+TR     RAL      + D    D    ++ RN+P++ L+P  G+NVYDILR 
Sbjct: 138 KAFKALLTRLGVQGRAL-----FVTDQVHQDDAVSMSCRNLPDVTLVPTAGLNVYDILRH 192

Query: 190 SKLVLSKSAIEALEDRFK 207
             L+++K A+ A+E+ +K
Sbjct: 193 DTLIMTKGAVSAVEEAWK 210


>gi|94985966|ref|YP_605330.1| 50S ribosomal protein L4 [Deinococcus geothermalis DSM 11300]
 gi|166234661|sp|Q1IX73|RL4_DEIGD RecName: Full=50S ribosomal protein L4
 gi|94556247|gb|ABF46161.1| ribosomal protein L4 [Deinococcus geothermalis DSM 11300]
          Length = 213

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 80/200 (40%), Positives = 114/200 (57%), Gaps = 10/200 (5%)

Query: 8   NLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQ 67
           N+ G++ G  S+  D+  + P   +L  V+ WQ   +R G + +K R+EV+ +G KMY Q
Sbjct: 5   NVIGQNGGR-SIDLDLPEVNPH--VLHEVVTWQLAGRRRGTASTKTRAEVSRSGKKMYSQ 61

Query: 68  KGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVID 127
           KGTG ARH  +SV  F GGG AFGP P    + LP+KVR L L  AL+D+     +  +D
Sbjct: 62  KGTGNARHGDRSVPTFVGGGVAFGPKPRSYSYTLPRKVRQLGLAMALADRQQQGKLTAVD 121

Query: 128 NLVSKECKTKYLVT--RFRALDLSN-ALIIDGCQLDRNFQLAARNIPNINLLPVQGINVY 184
                + KTK  V+  +   LD S   LI+   +L R    AARN+    +LPV G+NVY
Sbjct: 122 GF-GLDGKTKSFVSWAKENGLDGSERVLIVTDDELTRR---AARNVAWATVLPVAGLNVY 177

Query: 185 DILRCSKLVLSKSAIEALED 204
           DILR  +LV+   A+E  ++
Sbjct: 178 DILRHERLVIDAVALEPAQE 197


>gi|225574701|ref|ZP_03783311.1| hypothetical protein RUMHYD_02778 [Blautia hydrogenotrophica DSM
           10507]
 gi|225038091|gb|EEG48337.1| hypothetical protein RUMHYD_02778 [Blautia hydrogenotrophica DSM
           10507]
          Length = 206

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 115/206 (55%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +SV N++G + G I +++ +F ++  + ++   +  Q   KR G  K+K RSEV   
Sbjct: 1   MANVSVLNMEGNEVGTIELNDAVFGVEINEHLVHLAVVRQLANKRQGTQKAKTRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+ GGG  F PVP      + +K R  AL+ AL+ K   
Sbjct: 61  GRKPWRQKGTGHARQGSIRAPQWTGGGVVFAPVPRDYSVKMNRKERLAALKSALTAKVQD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N ++V+D+L  +  KTK +      L    AL++    +D+N  L+ARNIP +    V  
Sbjct: 121 NKLIVVDDLKFEAIKTKDMQNVLNNLKAEKALVVTPA-VDQNVVLSARNIPEVQTATVNT 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYD+++   LVL+K A+ ++E+ +
Sbjct: 180 INVYDVMKHKTLVLTKDAVASIEEVY 205


>gi|302669962|ref|YP_003829922.1| ribosomal protein L4 RplD [Butyrivibrio proteoclasticus B316]
 gi|302394435|gb|ADL33340.1| ribosomal protein L4 RplD [Butyrivibrio proteoclasticus B316]
          Length = 207

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 113/206 (54%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +SV N++G++ G I +S+ IF ++  + ++   +  Q    R G  K+K RSEV+  
Sbjct: 1   MANVSVYNMEGKEVGKIDLSDAIFGVEVNEHLVHMAVLQQLADNRQGTQKAKTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q++GGG  F PVP      + KK +  AL+ AL+DK  +
Sbjct: 61  GRKPWRQKGTGHARQGSIRAPQWKGGGVVFAPVPRDYSFKMNKKEKRAALKSALTDKVQN 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+I+V+D L   E KTK        L+ +   ++     D+N  L+ARN+   N      
Sbjct: 121 NNIVVVDELKFDEIKTKRFAEVMNNLNATRKALVVLADNDQNVVLSARNLAEANTTLTNT 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVYDI+    LVL+K A+  +E+ +
Sbjct: 181 LNVYDIVNARTLVLTKDAVAKIEEVY 206


>gi|297582451|ref|YP_003698231.1| 50S ribosomal protein L4/L1e [Bacillus selenitireducens MLS10]
 gi|297140908|gb|ADH97665.1| ribosomal protein L4/L1e [Bacillus selenitireducens MLS10]
          Length = 207

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 111/204 (54%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N  G   G I +++ +F ++P + ++   +  Q    R G    KGRS+V   
Sbjct: 1   MPKVNLYNQTGSQAGDIELNDAVFGIEPNESVVYDAIIMQQASMRQGTHAVKGRSDVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRARH +     + GGG  FGP P    + +PKK R LAL+ ALS K   
Sbjct: 61  GRKPWRQKGTGRARHGTNRSPIWVGGGVVFGPTPRSYAYNMPKKQRRLALKSALSSKVNE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           + I V++ L     KTK +     AL     +++     + N  L+ARN+PN+  +  +G
Sbjct: 121 DAIYVMEGLSFDAPKTKEMKKVLEALSAGKKVLVVTADYEDNVALSARNLPNVKFVTAEG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV D++    LV+++ A++ +E+
Sbjct: 181 VNVLDLVNFESLVITQDAVKQVEE 204


>gi|196006758|ref|XP_002113245.1| hypothetical protein TRIADDRAFT_27010 [Trichoplax adhaerens]
 gi|190583649|gb|EDV23719.1| hypothetical protein TRIADDRAFT_27010 [Trichoplax adhaerens]
          Length = 220

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 103/176 (58%), Gaps = 1/176 (0%)

Query: 32  ILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGTGRARHSSKSVSQFRGGGKAFG 91
           IL R + WQ  ++R G +K+K R EV   G K + QKG+GRAR  S     FRGGG   G
Sbjct: 5   ILHRYVVWQLAKRRAGTAKTKNRGEVRGGGRKPWPQKGSGRARQGSIRAPHFRGGGTVHG 64

Query: 92  PVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNLVSKECKTKYLVTRFRALDLSNA 151
           P P       P+KVRS+A+R ALS KF   D+ ++D+   +  KT+ L       +  +A
Sbjct: 65  PRPRSYDFTFPRKVRSMAIRVALSVKFAQGDLYIVDSFGLETHKTQNLKDLLDQRNWYSA 124

Query: 152 LIIDG-CQLDRNFQLAARNIPNINLLPVQGINVYDILRCSKLVLSKSAIEALEDRF 206
           L++DG   +D N +LAARNI   ++LP   +NV+ +L+   LVLS  A++ L++R 
Sbjct: 125 LLVDGNTYVDENLRLAARNIQKCDVLPSYALNVHMMLKRHALVLSLPALKILQERL 180


>gi|289548390|ref|YP_003473378.1| ribosomal protein L4/L1e [Thermocrinis albus DSM 14484]
 gi|289182007|gb|ADC89251.1| ribosomal protein L4/L1e [Thermocrinis albus DSM 14484]
          Length = 197

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 71/192 (36%), Positives = 110/192 (57%), Gaps = 2/192 (1%)

Query: 17  ISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGTGRARHS 76
           + + EDIF ++ ++ +L   ++WQ   +R G   +K R+EV Y+G K+  QKGTG ARH 
Sbjct: 4   LQLREDIFGVEVKKHVLWEAVKWQLAARRQGTHSTKTRAEVNYSGRKILPQKGTGNARHG 63

Query: 77  SKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNL-VSKECK 135
            +    F GGG A GP P    + LPKKVR LALR ALS K     ++++D + + +  K
Sbjct: 64  ERGAPIFVGGGVAHGPKPRDYYYTLPKKVRKLALRMALSSKAKEGKVLLVDKVEIGEVPK 123

Query: 136 TKYLVTRFRALDLSNA-LIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRCSKLVL 194
           TK  V   +  ++++  +++   Q D     + RNIP   +LPV G+NVYDIL    L++
Sbjct: 124 TKKAVEFLKTHNVADQKVLLIVPQKDEVVIKSFRNIPTAKVLPVDGLNVYDILWADWLII 183

Query: 195 SKSAIEALEDRF 206
            K A+  + +R 
Sbjct: 184 DKMALGKIYERL 195


>gi|157816923|ref|NP_001102224.1| 39S ribosomal protein L4, mitochondrial [Rattus norvegicus]
 gi|149020531|gb|EDL78336.1| mitochondrial ribosomal protein L4 (predicted), isoform CRA_b
           [Rattus norvegicus]
          Length = 294

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 75/207 (36%), Positives = 118/207 (57%), Gaps = 6/207 (2%)

Query: 5   SVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKM 64
           S+R  + E  G+  +  D+FA  P+  IL +V  WQ   KRI  +K+K R+EV+  G K 
Sbjct: 68  SLRGFEQERIGLAELHPDVFATTPRLDILHQVAVWQRNFKRISYAKTKTRAEVSGGGRKP 127

Query: 65  YVQKGTGRARHSSKSVSQFRGGGKAFGPV-PIIGVHALPKKVRSLALRHALSDKFCSNDI 123
           + QKG+GRARH S     +RGGG A GP  P    + LP KVR+L L+ AL+ K   +D+
Sbjct: 128 WQQKGSGRARHGSIRSPIWRGGGVAHGPRGPTSYYYMLPMKVRALGLKVALTVKLMQDDL 187

Query: 124 MVIDNLVSKECKTKYL--VTRFRALDLSNALIIDGC--QLDRNFQLAARNIPNINLLPVQ 179
            ++D+L       +YL  + ++R    S+ L++D    ++ +N   A   + + NL+P  
Sbjct: 188 HIVDSLELPTADPQYLTELAQYRHWG-SSVLLVDLTHEEMPKNVMAATSRLNSFNLIPAV 246

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRF 206
           G+NVY +L+   LVL+  ++  LED+ 
Sbjct: 247 GLNVYSMLKHQTLVLTLPSVAFLEDKL 273


>gi|325288579|ref|YP_004264760.1| LSU ribosomal protein L4P [Syntrophobotulus glycolicus DSM 8271]
 gi|324963980|gb|ADY54759.1| LSU ribosomal protein L4P [Syntrophobotulus glycolicus DSM 8271]
          Length = 209

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 76/206 (36%), Positives = 113/206 (54%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ V N+ G   G I ++E IF + P  G++  V+  Q    R+G   + GRSEV   
Sbjct: 1   MPKVQVVNMQGSPVGEIELNERIFGVTPNIGVMHSVVVAQMANARVGTHSTLGRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  +     +RGGG  FGP P      +PKKV+ LAL  ALS K   
Sbjct: 61  GRKPWRQKGTGRARAGTIRSPLWRGGGIVFGPKPRDYSKKVPKKVKRLALCSALSSKVNE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           ++++V+D+L     KTK +V    A+ +    ++     D+N QL+ARNI  +     + 
Sbjct: 121 SNLIVVDDLKFDAPKTKDMVKFLEAIKVDRKALVVTEGSDKNVQLSARNIQGVKTASAES 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INV D+L+   LV+SK A+   E+ +
Sbjct: 181 INVVDLLKHDVLVISKQAVIKAEEVY 206


>gi|242371895|ref|ZP_04817469.1| 50S ribosomal protein L4 [Staphylococcus epidermidis M23864:W1]
 gi|242350402|gb|EES42003.1| 50S ribosomal protein L4 [Staphylococcus epidermidis M23864:W1]
          Length = 207

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 104/204 (50%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M    V  +DG   G + +S+ +FA++P   +L   +  Q    R G    K RS V   
Sbjct: 1   MANYDVLKVDGSKSGSVELSDAVFAIEPNNSVLFEAINLQRASLRQGTHSVKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  +    Q+RGGG  FGP P    + +PKK+R LALR ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGTIRAPQWRGGGIVFGPTPRSYSYKMPKKMRRLALRSALSFKVQE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
               V+D       KTK        L+    +++     D N +L+ARNIP + +   QG
Sbjct: 121 KGFTVVDTFGFDAPKTKEFKNVLTTLEQPKKVLVVTEGEDVNVELSARNIPGVQVTTAQG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV DI     +V++++A + +E+
Sbjct: 181 LNVLDITSADSVVITEAAAKKVEE 204


>gi|239787564|emb|CAX84032.1| 50S ribosomal protein L4 [uncultured bacterium]
          Length = 217

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 119/205 (58%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           MIE  V +   +    +++S   F  + +  +L RV+ +Q  ++R+G + +K R EV   
Sbjct: 1   MIEFPVVDAANQTSHTVNLSSHAFGCEVRGDLLTRVVHYQLAKRRLGTASTKRRGEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K Y QKGTG AR  +    Q+R GG  FGP P      + +K R+L LR ALS K  +
Sbjct: 61  GHKPYRQKGTGNARQGTIRAPQYRTGGVVFGPHPRDYSVKMNRKERALGLRTALSAKREA 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            +++V+ +    E KT+ ++     L+ +N+++I   + D   + +ARN+P ++++ V G
Sbjct: 121 EELIVLTDFGLTEIKTRSMLQVLTRLNAANSVLIVLPESDERIERSARNLPGVDVIQVDG 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDR 205
           +NVYD+L   KL+++++A++ LE R
Sbjct: 181 VNVYDLLVHEKLLMTEAALQKLEAR 205


>gi|302388087|ref|YP_003823909.1| ribosomal protein L4/L1e [Clostridium saccharolyticum WM1]
 gi|302198715|gb|ADL06286.1| ribosomal protein L4/L1e [Clostridium saccharolyticum WM1]
          Length = 206

 Score =  125 bits (315), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 114/206 (55%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +SV N++G++ G + +++ +F +   + ++   +  Q   KR G  K+K R+EV+  
Sbjct: 1   MANVSVYNMEGKEVGTLELNDAVFGVDVNEHLVHMAVVSQLANKRQGTQKAKTRAEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+ GGG  F P P      L KK R LAL+ AL+ +   
Sbjct: 61  GRKPWKQKGTGHARQGSTRSPQWTGGGVVFAPTPRDYTIRLNKKERRLALKSALTSRVNE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N  +V+D L   E KTK   T    L +S AL++ G +   N  ++ARNI  +       
Sbjct: 121 NKFIVVDELKFDEIKTKKFQTVLNNLKVSKALVVMG-EDSTNAVMSARNIAAVKTAFANT 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYDIL+ S +V +K+A+ A+E+ +
Sbjct: 180 INVYDILKYSTVVATKTAVAAIEEVY 205


>gi|261264931|gb|ACX55824.1| 50S ribosomal protein L4 [Staphylococcus epidermidis]
          Length = 207

 Score =  125 bits (314), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 105/204 (51%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M    V  +DG   G + +++ +FA++P   +L   +  Q    R G    K RS V   
Sbjct: 1   MANYDVLKVDGSKSGSVELNDAVFAIEPNNSVLFEAINLQRASLRQGTHAVKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + Q GTGRAR  +    Q+RGGG  FGP P    + +PKK+R LALR ALS K   
Sbjct: 61  GRKPWRQNGTGRARQGTIRAPQWRGGGVVFGPTPRSYAYKMPKKMRRLALRSALSFKVQE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N   ++D    +  KTK        L+    +++     D N +L+ARNIP + +   QG
Sbjct: 121 NSFTIVDTFGFEAPKTKEFKNVLTTLEQPKKVLVVTENEDVNVELSARNIPGVQVTTAQG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV D+     ++++++A + +E+
Sbjct: 181 LNVLDLTSADSVIITEAAAKKVEE 204


>gi|225571553|ref|ZP_03780549.1| hypothetical protein CLOHYLEM_07651 [Clostridium hylemonae DSM
           15053]
 gi|225159630|gb|EEG72249.1| hypothetical protein CLOHYLEM_07651 [Clostridium hylemonae DSM
           15053]
          Length = 206

 Score =  125 bits (314), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 71/208 (34%), Positives = 116/208 (55%), Gaps = 5/208 (2%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +SV N++G++ G I +++ +F ++  + ++   +  Q   KR G  K+K RSEV+  
Sbjct: 1   MANVSVYNIEGKEVGTIDLNDAVFGVEVNEHLVHMAVVSQLANKRQGTQKAKTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+ GGG  F P P      + KK +  AL+ AL+ K   
Sbjct: 61  GRKPWRQKGTGHARQGSTRAPQWTGGGVVFAPTPRDYSFKMNKKEKRAALKSALTTKVEE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALII--DGCQLDRNFQLAARNIPNINLLPV 178
              +V+D +   E KTK      + LD+S AL++  DG   + N +L+ARNI ++     
Sbjct: 121 KKFIVVDEIAFDEIKTKNFANVLKNLDVSKALVVLEDG---NTNAELSARNIADVKTAKT 177

Query: 179 QGINVYDILRCSKLVLSKSAIEALEDRF 206
             INVYDIL+ + ++ +K+A+  +E+ +
Sbjct: 178 NTINVYDILKYNTVIATKAAVANIEEVY 205


>gi|163847924|ref|YP_001635968.1| 50S ribosomal protein L4/L1e [Chloroflexus aurantiacus J-10-fl]
 gi|222525804|ref|YP_002570275.1| 50S ribosomal protein L4/L1e [Chloroflexus sp. Y-400-fl]
 gi|163669213|gb|ABY35579.1| ribosomal protein L4/L1e [Chloroflexus aurantiacus J-10-fl]
 gi|222449683|gb|ACM53949.1| ribosomal protein L4/L1e [Chloroflexus sp. Y-400-fl]
          Length = 222

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 69/206 (33%), Positives = 114/206 (55%), Gaps = 4/206 (1%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++ ++ N  GE  G I VS+ IF ++P   ++ + +  Q+   R+G   ++GR EV  + 
Sbjct: 1   MQATLYNQAGEQVGAIEVSDYIFGIEPNVAVMHQYVVMQNANARLGTHNTRGRGEVKGST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTGRAR  S      +GGG A GP P     A+P+K+R L +R ALS KF ++
Sbjct: 61  RKLYRQKGTGRARQGSIRAPHHKGGGVAHGPHPRSYRLAMPRKMRRLGVRSALSAKFAAD 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNA---LIIDG-CQLDRNFQLAARNIPNINLLP 177
            I  +D L  +  +TK  +   +A  L++    ++ID     + N + +A N+P +  L 
Sbjct: 121 QIRFVDELTFERPRTKDFIAFLKAHGLADKKTLVVIDSKSPANENLRRSANNLPQVKTLL 180

Query: 178 VQGINVYDILRCSKLVLSKSAIEALE 203
              +NV D+L    +V+ K+A+E +E
Sbjct: 181 AHYLNVRDLLVYDHIVMPKAAVEVVE 206


>gi|262197187|ref|YP_003268396.1| ribosomal protein L4/L1e [Haliangium ochraceum DSM 14365]
 gi|262080534|gb|ACY16503.1| ribosomal protein L4/L1e [Haliangium ochraceum DSM 14365]
          Length = 215

 Score =  125 bits (314), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 78/208 (37%), Positives = 114/208 (54%), Gaps = 7/208 (3%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +L ++N  GE  G I + + IFA +  + +   V++WQ  R+R G   +K R EV  +
Sbjct: 1   MPKLDIKNTAGETVGDIDLDDAIFAEEVHEHLFWEVVKWQRARRRAGTHSTKRRGEVRGS 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
             K Y QKGTGRAR   +    + GGG  FGP P    +ALPKKVR  ALR ALS +   
Sbjct: 61  NIKPYRQKGTGRARQGDRKAPHWVGGGSVFGPKPRSYDYALPKKVRKKALRSALSLRAKE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNA----LIID-GCQLDRNFQLAARNIPNINL 175
             ++V+D    +  KT+ +V+   AL  ++     LI+D G  LD       RN+     
Sbjct: 121 QKLVVLDAFPVEGGKTRNVVSALAALGAAHTDNRVLIVDAGDNLD--LIRGTRNLRGSKW 178

Query: 176 LPVQGINVYDILRCSKLVLSKSAIEALE 203
           L  +G+NVYDIL  S LV++ + ++A+E
Sbjct: 179 LAPEGLNVYDILDHSTLVMTSATVKAVE 206


>gi|148655336|ref|YP_001275541.1| 50S ribosomal protein L4/L1e [Roseiflexus sp. RS-1]
 gi|148567446|gb|ABQ89591.1| LSU ribosomal protein L4P [Roseiflexus sp. RS-1]
          Length = 223

 Score =  125 bits (313), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 67/199 (33%), Positives = 111/199 (55%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +E  + N  GE+ GVI +S+ +F ++P   ++ + +  Q    R+G   + GR EV  + 
Sbjct: 1   MEARLYNQSGEEVGVIQISDYVFGIEPNVPVMHQAMERQRANARLGTHNTLGRGEVEGST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTGRAR  S      +GGG A GP P     A+P+K+R LA+R ALS ++   
Sbjct: 61  RKLYRQKGTGRARQGSIRAPHRKGGGIAHGPHPRKYTKAMPRKMRRLAVRSALSARYRDG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            I  +D L  ++ +TK ++    AL+L+   +I   Q D   + +A N+PN+  L    +
Sbjct: 121 AITFLDRLTFEKPRTKDMIAVLNALNLTGKTLIVLDQKDEYVRRSANNLPNVKTLLAHYL 180

Query: 182 NVYDILRCSKLVLSKSAIE 200
           NV D+L    +V+ ++A++
Sbjct: 181 NVIDLLTHDHIVMLQAAVD 199


>gi|210623189|ref|ZP_03293628.1| hypothetical protein CLOHIR_01578 [Clostridium hiranonis DSM 13275]
 gi|210153726|gb|EEA84732.1| hypothetical protein CLOHIR_01578 [Clostridium hiranonis DSM 13275]
          Length = 207

 Score =  125 bits (313), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 72/206 (34%), Positives = 114/206 (55%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +++V N++G++ G I + + IF ++  + +L   ++ Q   +R G   +K R+EV   
Sbjct: 1   MPKINVMNINGQNVGEIELCDSIFNVEVNEHVLYEAVKCQLANRRQGTQSAKTRAEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+ GGG AF P P    + LPKKVR LA++ ALS K  +
Sbjct: 61  GRKPWKQKGTGRARQGSTRSVQWVGGGVAFAPKPRSYKYTLPKKVRRLAMKCALSSKVQN 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+I+V+D L     KTK  V     +  S   ++   + + N   +ARNI  +    V  
Sbjct: 121 NEIIVLDALTMDAPKTKEFVAILNNIKASRKALVVTAEKNENVIKSARNIEGVQTALVNT 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVYDIL     V++  A++ +E+ +
Sbjct: 181 LNVYDILNHDTFVITTDAVKKVEEVY 206


>gi|266620262|ref|ZP_06113197.1| ribosomal protein L4/L1 family protein [Clostridium hathewayi DSM
           13479]
 gi|288868165|gb|EFD00464.1| ribosomal protein L4/L1 family protein [Clostridium hathewayi DSM
           13479]
          Length = 206

 Score =  125 bits (313), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 112/206 (54%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +SV N++G + G + +++ +F +   + ++   +  Q   KR G  K+K R+EV+  
Sbjct: 1   MANVSVYNMEGNEVGTLELNDAVFGVNVNEHLVHLAVVSQLANKRQGTQKAKTRAEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+ GGG  F P P      L KK R LAL+ AL+ +   
Sbjct: 61  GRKPWKQKGTGHARQGSTRSPQWTGGGVVFAPTPRDYTIKLNKKERKLALKSALTSRVNE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N  +V+D L   E KTK        L +S AL++ G     N   +ARNIP +    V  
Sbjct: 121 NKFIVVDELKFDEIKTKKFQNVLNNLKVSKALVVVGDD-STNAVKSARNIPAVKTAFVNT 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYDIL+ + +V +K+A+ A+E+ +
Sbjct: 180 INVYDILKYNTVVATKTAVAAIEEVY 205


>gi|225175673|ref|ZP_03729667.1| ribosomal protein L4/L1e [Dethiobacter alkaliphilus AHT 1]
 gi|225169002|gb|EEG77802.1| ribosomal protein L4/L1e [Dethiobacter alkaliphilus AHT 1]
          Length = 208

 Score =  125 bits (313), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 74/207 (35%), Positives = 113/207 (54%), Gaps = 1/207 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N  GE +G I +SE +FA K  +  + + +      +R+G +K+K R+EV   
Sbjct: 1   MPKVALYNTAGEQQGEIELSEAVFASKVNEAAMHQAVLAYLANQRLGTAKTKDRTEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGV-HALPKKVRSLALRHALSDKFC 119
           G K + QKGTGRARH S     +RGGG  FGP        +LPKK+R LAL+ AL+ K  
Sbjct: 61  GRKPWRQKGTGRARHGSIRSPIWRGGGITFGPDGRRNYKQSLPKKIRRLALKSALTSKVN 120

Query: 120 SNDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
           +  ++V+D L     KTK +V     L+    ++I       N   +ARNIP +      
Sbjct: 121 TGSLIVLDQLAMDAPKTKEMVQVLNNLNTGRKVLIITDTPQENVIKSARNIPGVKTTSTN 180

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRF 206
            +NVYDIL    LV+++ A+  +E+ F
Sbjct: 181 QLNVYDILNTDNLVITRDAVVQVEEVF 207


>gi|184155990|ref|YP_001844330.1| 50S ribosomal protein L4 [Lactobacillus fermentum IFO 3956]
 gi|227515488|ref|ZP_03945537.1| ribosomal protein L4 [Lactobacillus fermentum ATCC 14931]
 gi|260662753|ref|ZP_05863647.1| 50S ribosomal protein L4/L1 [Lactobacillus fermentum 28-3-CHN]
 gi|226730678|sp|B2GDW8|RL4_LACF3 RecName: Full=50S ribosomal protein L4
 gi|183227334|dbj|BAG27850.1| 50S ribosomal protein L4 [Lactobacillus fermentum IFO 3956]
 gi|227086101|gb|EEI21413.1| ribosomal protein L4 [Lactobacillus fermentum ATCC 14931]
 gi|260552834|gb|EEX25833.1| 50S ribosomal protein L4/L1 [Lactobacillus fermentum 28-3-CHN]
          Length = 207

 Score =  125 bits (313), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 111/204 (54%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +++   DG   G + +++ +F+++  +      +  Q    R G    K RS V   
Sbjct: 1   MTSVALFKQDGSQNGTVELNDSVFSVEANESAEFDAILRQRASLRQGTHAVKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    QFRGGG  FGP P    +ALP+KVR LA++ ALS K  +
Sbjct: 61  GKKPWRQKGTGRARQGSIRAPQFRGGGIVFGPTPRSYNYALPRKVRQLAIKSALSQKVAN 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           +  +V+D L     KTK        L +S  +++     D+N QL+ARN+P   ++   G
Sbjct: 121 DKFVVVDGLNFDAPKTKEFAGVMNNLKVSERVLVVVTDEDKNAQLSARNLPKTTVVTPAG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +N+ +++   K+++++SA+  +E+
Sbjct: 181 VNILNVVDAQKIIITQSALSQVEE 204


>gi|226323011|ref|ZP_03798529.1| hypothetical protein COPCOM_00783 [Coprococcus comes ATCC 27758]
 gi|225208578|gb|EEG90932.1| hypothetical protein COPCOM_00783 [Coprococcus comes ATCC 27758]
          Length = 206

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 72/208 (34%), Positives = 117/208 (56%), Gaps = 5/208 (2%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +SV N++G++ G I +++ +F ++  + ++   +  Q   KR G  K+K RSEV+  
Sbjct: 1   MANVSVYNIEGKEVGTIDLNDAVFGVEVNEHLVHMAVVSQLANKRQGTQKAKTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+ GGG  F P P      L KK R  AL+ AL+ +   
Sbjct: 61  GRKPWRQKGTGHARQGSTRAPQWTGGGVVFAPTPRDYSFKLNKKERRAALKSALTSRVEE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALII--DGCQLDRNFQLAARNIPNINLLPV 178
              +V+D +   E KTK        L +S AL++  DG   ++N +L+ARNI ++     
Sbjct: 121 KKFIVVDEINFDEIKTKKFQDVLNNLSVSKALVVLEDG---NKNAELSARNIADVKTAKT 177

Query: 179 QGINVYDILRCSKLVLSKSAIEALEDRF 206
             INVYDIL+ + ++ +K+A++A+E+ +
Sbjct: 178 NTINVYDILKYNTVIATKAAVQAIEEVY 205


>gi|313887073|ref|ZP_07820772.1| 50S ribosomal protein L4 [Porphyromonas asaccharolytica
           PR426713P-I]
 gi|312923484|gb|EFR34294.1| 50S ribosomal protein L4 [Porphyromonas asaccharolytica
           PR426713P-I]
          Length = 207

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 74/213 (34%), Positives = 117/213 (54%), Gaps = 14/213 (6%)

Query: 2   IELSVRNLDGEDKG-VISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           +ELS+ N+ GED G  I++   +F ++P    +   ++     +R G  K+K RSE++ +
Sbjct: 1   MELSIYNIQGEDTGRKIALESSVFGIEPNDHAIYLTVKQYRANQRQGTHKAKERSEMSGS 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
             K++ QKGTG AR    + +  RGG + FGP P      L KK+R LA R AL+ K   
Sbjct: 61  TRKLFRQKGTGGARRGDINSNILRGGARVFGPRPRSYSFKLNKKLRQLARRSALTYKAQD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDG-------CQLDRNFQLAARNIPNI 173
           N IMV+D L  +  KTK  V+      ++ AL +DG        Q++    L+ARNIP +
Sbjct: 121 NQIMVLDQLSFETPKTKSFVS------MAKALNVDGQKTLYVVSQIEDTVALSARNIPGV 174

Query: 174 NLLPVQGINVYDILRCSKLVLSKSAIEALEDRF 206
           N++  Q +N Y +L C K+V ++ A+  + + F
Sbjct: 175 NIVRAQDLNTYCVLDCRKIVFTEDALAQVNEMF 207


>gi|218186003|gb|EEC68430.1| hypothetical protein OsI_36619 [Oryza sativa Indica Group]
          Length = 273

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 75/202 (37%), Positives = 110/202 (54%), Gaps = 11/202 (5%)

Query: 6   VRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMY 65
           V N   EDKG + +  D+F +  ++ I+ RV          G   +K  SEV+ TG K Y
Sbjct: 76  VTNFHNEDKGFMVLDGDVFDVPIRKDIVHRV----------GTHSTKTISEVSGTGRKPY 125

Query: 66  VQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMV 125
            QKGTGRARH +    QFRGG    GP P      L KKVR L L+ ALS +     ++V
Sbjct: 126 NQKGTGRARHGTLRGPQFRGGATMHGPKPRSHAIKLQKKVRRLGLKIALSARTAEGKLLV 185

Query: 126 IDNLVSKECKTKYLVTRFRALD-LSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVY 184
            D+L     KTK +V     ++     L++DG  +D+  +LA +N+  +N+LP  G+NVY
Sbjct: 186 FDDLEVPSHKTKNIVQYIGQMEGTKKVLLVDGGDIDKKLKLATQNLHYVNVLPSIGLNVY 245

Query: 185 DILRCSKLVLSKSAIEALEDRF 206
            IL+   LV++++AI  + +R 
Sbjct: 246 SILQHDTLVMTRNAINRIVERM 267


>gi|260886877|ref|ZP_05898140.1| ribosomal protein L4/L1 family protein [Selenomonas sputigena ATCC
           35185]
 gi|330839325|ref|YP_004413905.1| ribosomal protein L4/L1e [Selenomonas sputigena ATCC 35185]
 gi|260863476|gb|EEX77976.1| ribosomal protein L4/L1 family protein [Selenomonas sputigena ATCC
           35185]
 gi|329747089|gb|AEC00446.1| ribosomal protein L4/L1e [Selenomonas sputigena ATCC 35185]
          Length = 207

 Score =  125 bits (313), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 113/204 (55%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +++V N   +  G I +++ +F ++   G++ + +  Q   +R+G   +K R  V   
Sbjct: 1   MPKVAVYNSANQQVGDIELNDSVFGVEMNAGLVHQAVVMQLASRRLGTHATKTRGLVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     + GGG  FGP P      +PKK R LA++ ALSDK  S
Sbjct: 61  GRKPWRQKGTGRARSGSTRSPLWVGGGTVFGPQPRSYAFRMPKKQRRLAIKCALSDKVAS 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            D +V+D+L     KTK +V       +    +I     + N +L++RNIP +  +   G
Sbjct: 121 GDFIVLDDLQFDAPKTKSVVKMLGDFGVDAKSLIITLDENENVELSSRNIPGVKAINTMG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NVYDIL  +KL ++K+AIE +E+
Sbjct: 181 LNVYDILNHTKLFITKAAIEKIEE 204


>gi|330795906|ref|XP_003286011.1| hypothetical protein DICPUDRAFT_149944 [Dictyostelium purpureum]
 gi|325084009|gb|EGC37447.1| hypothetical protein DICPUDRAFT_149944 [Dictyostelium purpureum]
          Length = 258

 Score =  124 bits (312), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 72/206 (34%), Positives = 114/206 (55%), Gaps = 3/206 (1%)

Query: 2   IELSVRNLDGEDK-GVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           IE  + + D +   G I +S+DIF+   +  +L R++R+Q  + + G  ++        +
Sbjct: 46  IEFPIIDFDSKSNVGTIQLSKDIFSRPLRIDLLHRMVRYQRAKSQQGTHQALNMERKTSS 105

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
             K + QKGTGRAR  +    Q +GG +AF P      H LPKKVR L L+ ALS K   
Sbjct: 106 NKKPFKQKGTGRARQGTNHAVQMKGGARAFPPTSRSHAHDLPKKVRQLCLKVALSSKLAQ 165

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N +++ID       KTK LV++    +   +L++D   +  N   ++ N+  I+ LP +G
Sbjct: 166 NKLIIIDEFKLSSHKTKDLVSKL-PQEWGRSLLVDK-DISENLNRSSLNVQKIDTLPERG 223

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVY IL+   LVL++S+IEAL+ R 
Sbjct: 224 LNVYSILQNDTLVLTRSSIEALQSRL 249


>gi|325294397|ref|YP_004280911.1| ribosomal protein L4/L1e [Desulfurobacterium thermolithotrophum DSM
           11699]
 gi|325064845|gb|ADY72852.1| ribosomal protein L4/L1e [Desulfurobacterium thermolithotrophum DSM
           11699]
          Length = 208

 Score =  124 bits (312), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 115/206 (55%), Gaps = 1/206 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +E+ V N   ++ G +++ ++I     ++  +   ++WQ  ++R G   +K R EV   G
Sbjct: 1   MEIKVVNAANQEVGTVTIKDEIANAPIKKHAVWETVKWQLAKRRRGTHSTKTRGEVRGGG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K + QK TGRAR  S    Q+ GGG   GP P    + LPKKVR +ALR  ++ +    
Sbjct: 61  KKPWPQKHTGRARQGSIRAPQWVGGGVVHGPKPRDYYYPLPKKVRKVALRSVVAGRLQEG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNA-LIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           +++V+++   ++ KTK  +   R L L N  ++I   +L+ N   + RN+PN+ LL ++G
Sbjct: 121 NLIVVEDFTFEKPKTKQAIEFLRNLGLENEKVLIVVPELEENTYKSFRNLPNVKLLEIEG 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVYD+L   K +  KS +  LE+R 
Sbjct: 181 LNVYDMLCYDKCIFFKSTLPKLEERL 206


>gi|295109478|emb|CBL23431.1| LSU ribosomal protein L4P [Ruminococcus obeum A2-162]
          Length = 206

 Score =  124 bits (312), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 71/206 (34%), Positives = 115/206 (55%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  ++V N++G + G + +++ +F ++  + ++   +  Q    R G  K+K RSEV+  
Sbjct: 1   MANVTVYNMEGNEVGTMELNDAVFGVEINEHLVHLAVVRQLANNRQGTQKAKTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+ GGG  F PVP      + KK R  AL+ AL+ K   
Sbjct: 61  GRKPWRQKGTGHARQGSIRAPQWTGGGVVFAPVPRDYEVKMNKKERRAALKSALTSKVQD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N ++V+D+L   E KTK +      L    ALI+     D+N  L+ARNI ++    V  
Sbjct: 121 NKLVVVDSLALAEVKTKEMQKVLTNLKAEKALIVTAGD-DQNVVLSARNIADVQTATVNT 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYD+++ S +V++K A+ ++E+ +
Sbjct: 180 INVYDVMKHSTVVVTKDAVASIEEVY 205


>gi|20808659|ref|NP_623830.1| 50S ribosomal protein L4 [Thermoanaerobacter tengcongensis MB4]
 gi|46577279|sp|Q8R7V5|RL4_THETN RecName: Full=50S ribosomal protein L4
 gi|20517293|gb|AAM25434.1| Ribosomal protein L4 [Thermoanaerobacter tengcongensis MB4]
          Length = 206

 Score =  124 bits (312), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 72/206 (34%), Positives = 114/206 (55%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ V N+ GE  G I + + +F +     ++ + +      +R G   +K R EV   
Sbjct: 1   MPKVPVYNVKGEQVGEIELKDSVFGVPVNVAVMHQAVVNYLANQRQGTHSTKTRGEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+  GG  FGP P    + LPKKV+ LAL+ ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRAPQWIKGGVVFGPKPRDYSYKLPKKVKRLALKSALSSKVRD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+I+V+D    ++ KTK +    +  +  +ALI+   Q ++N +L+ARN+PN   L    
Sbjct: 121 NEIIVLDEFKLEQPKTKKVAELLKNFNAKSALIVV-PQGEKNVELSARNMPNAKALYANL 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +N YD+L+  K +++K A+  +E+ F
Sbjct: 180 LNTYDVLKYEKFIITKDAVAIVEEVF 205


>gi|302390959|ref|YP_003826779.1| 50S ribosomal protein L4P [Acetohalobium arabaticum DSM 5501]
 gi|302203036|gb|ADL11714.1| LSU ribosomal protein L4P [Acetohalobium arabaticum DSM 5501]
          Length = 209

 Score =  124 bits (312), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 69/205 (33%), Positives = 117/205 (57%), Gaps = 1/205 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M EL++ + +G   G + +++ IF ++  + ++   +  Q   KR G + +K R+EV   
Sbjct: 1   MPELTLFDAEGSQVGEVELNQSIFDVEINEHVVHEAVTAQLAAKRAGTASTKTRAEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRARH S     + GGG  FGP P      +PKKV+ LA++ AL+ K   
Sbjct: 61  GRKPWRQKGTGRARHGSIRSPIWVGGGTTFGPQPRDYSKDIPKKVKRLAVKSALTAKVQD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSN-ALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
            ++ V+D     + KTK +V    ALD  +  +++   + D N   +ARNIP++ +L   
Sbjct: 121 EELTVVDGFNFDQPKTKQMVKVLEALDAKDKKVLVITAEKDDNLYKSARNIPDVKVLLGS 180

Query: 180 GINVYDILRCSKLVLSKSAIEALED 204
            +NVYD+L   +++++K AI+ +E+
Sbjct: 181 AVNVYDVLDNEQIIITKEAIKKVEE 205


>gi|83591275|ref|YP_431284.1| 50S ribosomal protein L4P [Moorella thermoacetica ATCC 39073]
 gi|109893605|sp|Q2RFP8|RL4_MOOTA RecName: Full=50S ribosomal protein L4
 gi|83574189|gb|ABC20741.1| LSU ribosomal protein L4P [Moorella thermoacetica ATCC 39073]
          Length = 207

 Score =  124 bits (312), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 116/204 (56%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +++ N+ G+  G + + + +F  +  + +L   +  Q   +R G + ++G ++V+  
Sbjct: 1   MPRVALYNIQGQQVGEVDLDDSVFGGEVNEAVLHDAVVMQLASRRRGTAATRGWADVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     +RGG   FGP P    + LPKKVR LALR AL+ K   
Sbjct: 61  GRKPWRQKGTGRARAGSIRSPLWRGGAVIFGPQPRDYGYRLPKKVRRLALRSALASKVRD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            +I+V+D L  ++ +TK +    + L+  N  ++     + N +L+ARN+P +  L   G
Sbjct: 121 GNIIVLDELKMEKPRTKDMAHILKNLNAENKALVVTATREPNVELSARNLPGVRFLTSDG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           INVYD+L   KLV++K A+  +++
Sbjct: 181 INVYDLLAHDKLVITKDAVARVQE 204


>gi|167755913|ref|ZP_02428040.1| hypothetical protein CLORAM_01433 [Clostridium ramosum DSM 1402]
 gi|237733229|ref|ZP_04563710.1| 50S ribosomal protein L4 [Mollicutes bacterium D7]
 gi|167703905|gb|EDS18484.1| hypothetical protein CLORAM_01433 [Clostridium ramosum DSM 1402]
 gi|229383610|gb|EEO33701.1| 50S ribosomal protein L4 [Coprobacillus sp. D7]
          Length = 207

 Score =  124 bits (312), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 114/204 (55%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M+ + V N +G +   + ++E +F ++P +  L  ++  Q    R G  K K R+EV   
Sbjct: 1   MLTVKVYNQEGSEVKDLELNEAVFGIEPNKQALFDMVLLQRASLRQGTHKVKNRTEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P      L +KVR LAL+ ALS K   
Sbjct: 61  GKKPWRQKGTGRARQGSIRAPQWRGGGVVFGPTPRSYKFKLNRKVRRLALKSALSTKIND 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+ M ++ +     KTK +V     L+     +I   ++  N   +A NIP + LL  + 
Sbjct: 121 NEFMALEAIKFDAPKTKEMVKVLANLEAPVKTLIVVDEICPNVARSANNIPGVKLLDAKH 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NVYDIL  +KL+++++AI+++E+
Sbjct: 181 VNVYDILNSNKLIMTEAAIKSVEE 204


>gi|42524374|ref|NP_969754.1| 50S ribosomal protein L4 [Bdellovibrio bacteriovorus HD100]
 gi|46576695|sp|P61061|RL4_BDEBA RecName: Full=50S ribosomal protein L4
 gi|39576583|emb|CAE80747.1| 50S ribosomal protein L4 [Bdellovibrio bacteriovorus HD100]
          Length = 209

 Score =  124 bits (312), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 71/205 (34%), Positives = 110/205 (53%), Gaps = 2/205 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  ++V N   E  G + ++ D+F    ++ +L  V++WQ   +R G   +K +  V+  
Sbjct: 1   MATVNVLNWKKEKVGSVELAADVFETPVKKEVLHTVVQWQLAARRQGTHMTKTKGLVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S       GGG AFGP P      LPKKVR L L  ALS     
Sbjct: 61  GKKPFKQKGTGGARQGSSRSILMPGGGTAFGPQPRSYAFVLPKKVRRLGLSMALSHLQKE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             + ++D++ S E KT  L  R +A  L  A+++D   +D  F  A++N+P     PV+G
Sbjct: 121 GKLFIVDSMAS-EGKTAELNKRLQAFGLKKAVLVDSV-VDDKFNRASKNLPTFKYFPVEG 178

Query: 181 INVYDILRCSKLVLSKSAIEALEDR 205
           +NV+D+L+    V++K ++  + DR
Sbjct: 179 LNVFDLLKYDAAVITKDSVAKIVDR 203


>gi|218135280|ref|ZP_03464084.1| hypothetical protein BACPEC_03185 [Bacteroides pectinophilus ATCC
           43243]
 gi|217990665|gb|EEC56676.1| hypothetical protein BACPEC_03185 [Bacteroides pectinophilus ATCC
           43243]
          Length = 206

 Score =  124 bits (312), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 72/206 (34%), Positives = 114/206 (55%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +SV N++G++ G + +++ IF ++  + ++   +  Q    R G  K+K RSEV+  
Sbjct: 1   MANVSVYNIEGKEVGSLELNDAIFGVEINEHLVHMAVVQQLANNRQGTQKAKTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+ GGG  F P P      + KK +  AL+ AL+ +   
Sbjct: 61  GRKPWRQKGTGHARQGSTRAPQWTGGGVVFAPTPRDYSFKMNKKEKRAALKSALTSRVVD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           + I+V+D +   E KTK      + L L  AL++ G   D N  L+ARNIP++ +     
Sbjct: 121 SKIVVLDEIKFNEIKTKNFANVMKNLKLDKALMVIGDN-DANVILSARNIPDVKVSQPNT 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYDIL+   LV++K A+  +E+ +
Sbjct: 180 INVYDILKYDTLVVTKDAVAKIEEVY 205


>gi|288818163|ref|YP_003432511.1| ribosomal protein L4 [Hydrogenobacter thermophilus TK-6]
 gi|288787563|dbj|BAI69310.1| ribosomal protein L4 [Hydrogenobacter thermophilus TK-6]
 gi|308751764|gb|ADO45247.1| ribosomal protein L4/L1e [Hydrogenobacter thermophilus TK-6]
          Length = 199

 Score =  124 bits (312), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 70/196 (35%), Positives = 110/196 (56%), Gaps = 6/196 (3%)

Query: 15  GVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGTGRAR 74
           G + + +D+F ++ ++ IL  V++WQ   +R G   +K R E++Y+G K+  QKGTG AR
Sbjct: 4   GDMELRDDVFNVEVKRHILWEVIKWQLACRRQGTHSTKTRGELSYSGRKLLPQKGTGNAR 63

Query: 75  HSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNL----V 130
           H  +  + F GGG A GP P    ++LPKKVR L L+ ALS K     +++ D++    V
Sbjct: 64  HGDRGANIFVGGGVAHGPRPTDYYYSLPKKVRKLGLKMALSSKAQEGKMLLFDSINIGDV 123

Query: 131 SKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRCS 190
            K  K    +      D+   ++I   + D     + RN+PN+ +LP +G+NVYDIL   
Sbjct: 124 PKTKKAIEFLNSNGIKDIKVTIVI--PEKDEIVMKSFRNLPNVKVLPAEGLNVYDILWAD 181

Query: 191 KLVLSKSAIEALEDRF 206
            L + K AIE + +R 
Sbjct: 182 VLAIQKQAIEKIYERL 197


>gi|259502532|ref|ZP_05745434.1| 50S ribosomal protein L4 [Lactobacillus antri DSM 16041]
 gi|259169484|gb|EEW53979.1| 50S ribosomal protein L4 [Lactobacillus antri DSM 16041]
          Length = 207

 Score =  124 bits (312), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 109/204 (53%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +++   DG   G I ++  +F ++P Q      +  Q    R G    K RS V+  
Sbjct: 1   MTSVNLYKQDGSQNGTIELNAAVFGIEPNQNAEFDAILRQRASLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    QFRGGG  FGP P    + LP+KVR LA++ ALS K   
Sbjct: 61  GKKPWRQKGTGRARQGSIRAPQFRGGGIVFGPSPRSYKYNLPRKVRQLAIKSALSQKVLD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N ++V+D L     KTK        L+++   ++   + D+N  L+ARN+ N  ++   G
Sbjct: 121 NALVVVDALNFDAPKTKEFAGVMNNLNVAEKALVVVTEDDKNAALSARNLANATVVTPAG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +N+ ++    K++++KSA+  +E+
Sbjct: 181 VNILNVADAQKVIITKSALSQVEE 204


>gi|15805341|ref|NP_294035.1| 50S ribosomal protein L4 [Deinococcus radiodurans R1]
 gi|45477175|sp|Q9RXK1|RL4_DEIRA RecName: Full=50S ribosomal protein L4
 gi|16975049|pdb|1JZX|K Chain K, Structural Basis For The Interaction Of Antibiotics With
           The Peptidyl Transferase Center In Eubacteria
 gi|16975053|pdb|1JZY|K Chain K, Structural Basis For The Interaction Of Antibiotics With
           The Peptidyl Transferase Center In Eubacteria
 gi|16975057|pdb|1JZZ|K Chain K, Structural Basis For The Interaction Of Antibiotics With
           The Peptidyl Transferase Center In Eubacteria
 gi|16975065|pdb|1K01|K Chain K, Structural Basis For The Interaction Of Antibiotics With
           The Peptidyl Transferase Center In Eubacteria
 gi|20150343|pdb|1J5A|K Chain K, Structural Basis For The Interaction Of Antibiotics With
           The Peptidyl Transferase Center In Eubacteria
 gi|28948922|pdb|1NKW|C Chain C, Crystal Structure Of The Large Ribosomal Subunit From
           Deinococcus Radiodurans
 gi|51247375|pdb|1SM1|C Chain C, Complex Of The Large Ribosomal Subunit From Deinococcus
           Radiodurans With Quinupristin And Dalfopristin
 gi|190613492|pdb|2ZJP|C Chain C, Thiopeptide Antibiotic Nosiheptide Bound To The Large
           Ribosomal Subunit Of Deinococcus Radiodurans
 gi|190613522|pdb|2ZJQ|C Chain C, Interaction Of L7 With L11 Induced By Microccocin Binding
           To The Deinococcus Radiodurans 50s Subunit
 gi|190613553|pdb|2ZJR|C Chain C, Refined Native Structure Of The Large Ribosomal Subunit
           (50s) From Deinococcus Radiodurans
 gi|190613660|pdb|3CF5|C Chain C, Thiopeptide Antibiotic Thiostrepton Bound To The Large
           Ribosomal Subunit Of Deinococcus Radiodurans
 gi|203282459|pdb|3DLL|C Chain C, The Oxazolidinone Antibiotics Perturb The Ribosomal
           Peptidyl-Transferase Center And Effect Trna Positioning
 gi|323714543|pdb|3PIO|C Chain C, Crystal Structure Of The Synergistic Antibiotic Pair
           Lankamycin And Lankacidin In Complex With The Large
           Ribosomal Subunit
 gi|323714573|pdb|3PIP|C Chain C, Crystal Structure Of The Synergistic Antibiotic Pair
           Lankamycin And Lankacidin In Complex With The Large
           Ribosomal Subunit
 gi|6457986|gb|AAF09893.1|AE001892_4 ribosomal protein L4 [Deinococcus radiodurans R1]
          Length = 205

 Score =  124 bits (312), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 66/171 (38%), Positives = 103/171 (60%), Gaps = 4/171 (2%)

Query: 31  GILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGTGRARHSSKSVSQFRGGGKAF 90
           G+L  V+ WQ   +R G + ++ R++V+ TG KMY QKGTG ARH  +SV  F GGG AF
Sbjct: 25  GVLHEVVTWQLASRRRGTASTRTRAQVSKTGRKMYGQKGTGNARHGDRSVPTFVGGGVAF 84

Query: 91  GPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNLVSKECKTKYLVT--RFRALDL 148
           GP P    + LP++VR L L  A++ +     ++ +D     + KTK  ++  +   LD 
Sbjct: 85  GPKPRSYDYTLPRQVRQLGLAMAIASRQEGGKLVAVDGFDIADAKTKNFISWAKQNGLDG 144

Query: 149 SNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRCSKLVLSKSAI 199
           +  +++     D N + AARN+  +++LPV G+NVYDILR  +LV+  +A+
Sbjct: 145 TEKVLL--VTDDENTRRAARNVSWVSVLPVAGVNVYDILRHDRLVIDAAAL 193


>gi|29726790|pdb|1NWX|C Chain C, Complex Of The Large Ribosomal Subunit From Deinococcus
           Radiodurans With Abt-773
 gi|29726821|pdb|1NWY|C Chain C, Complex Of The Large Ribosomal Subunit From Deinococcus
           Radiodurans With Azithromycin
 gi|61680338|pdb|1XBP|C Chain C, Inhibition Of Peptide Bond Formation By Pleuromutilins:
           The Structure Of The 50s Ribosomal Subunit From
           Deinococcus Radiodurans In Complex With Tiamulin
          Length = 204

 Score =  124 bits (312), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 66/171 (38%), Positives = 103/171 (60%), Gaps = 4/171 (2%)

Query: 31  GILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGTGRARHSSKSVSQFRGGGKAF 90
           G+L  V+ WQ   +R G + ++ R++V+ TG KMY QKGTG ARH  +SV  F GGG AF
Sbjct: 24  GVLHEVVTWQLASRRRGTASTRTRAQVSKTGRKMYGQKGTGNARHGDRSVPTFVGGGVAF 83

Query: 91  GPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNLVSKECKTKYLVT--RFRALDL 148
           GP P    + LP++VR L L  A++ +     ++ +D     + KTK  ++  +   LD 
Sbjct: 84  GPKPRSYDYTLPRQVRQLGLAMAIASRQEGGKLVAVDGFDIADAKTKNFISWAKQNGLDG 143

Query: 149 SNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRCSKLVLSKSAI 199
           +  +++     D N + AARN+  +++LPV G+NVYDILR  +LV+  +A+
Sbjct: 144 TEKVLL--VTDDENTRRAARNVSWVSVLPVAGVNVYDILRHDRLVIDAAAL 192


>gi|167036802|ref|YP_001664380.1| 50S ribosomal protein L4 [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|167039521|ref|YP_001662506.1| 50S ribosomal protein L4 [Thermoanaerobacter sp. X514]
 gi|256752633|ref|ZP_05493485.1| ribosomal protein L4/L1e [Thermoanaerobacter ethanolicus CCSD1]
 gi|300915228|ref|ZP_07132543.1| ribosomal protein L4/L1e [Thermoanaerobacter sp. X561]
 gi|307267013|ref|ZP_07548529.1| ribosomal protein L4/L1e [Thermoanaerobacter wiegelii Rt8.B1]
 gi|307725152|ref|YP_003904903.1| 50S ribosomal protein L4/L1e [Thermoanaerobacter sp. X513]
 gi|320115224|ref|YP_004185383.1| 50S ribosomal protein L4/L1e [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
 gi|326390660|ref|ZP_08212215.1| ribosomal protein L4/L1e [Thermoanaerobacter ethanolicus JW 200]
 gi|226731436|sp|B0KCK1|RL4_THEP3 RecName: Full=50S ribosomal protein L4
 gi|226731437|sp|B0K5P4|RL4_THEPX RecName: Full=50S ribosomal protein L4
 gi|166853761|gb|ABY92170.1| ribosomal protein L4/L1e [Thermoanaerobacter sp. X514]
 gi|166855636|gb|ABY94044.1| ribosomal protein L4/L1e [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|256748453|gb|EEU61505.1| ribosomal protein L4/L1e [Thermoanaerobacter ethanolicus CCSD1]
 gi|300888952|gb|EFK84099.1| ribosomal protein L4/L1e [Thermoanaerobacter sp. X561]
 gi|306917998|gb|EFN48256.1| ribosomal protein L4/L1e [Thermoanaerobacter wiegelii Rt8.B1]
 gi|307582213|gb|ADN55612.1| ribosomal protein L4/L1e [Thermoanaerobacter sp. X513]
 gi|319928315|gb|ADV79000.1| ribosomal protein L4/L1e [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|325993338|gb|EGD51775.1| ribosomal protein L4/L1e [Thermoanaerobacter ethanolicus JW 200]
          Length = 206

 Score =  124 bits (311), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 72/206 (34%), Positives = 115/206 (55%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +++V N+ GE  G I + + +F +     ++   +      +R G   +K R EV   
Sbjct: 1   MPKVAVYNVKGEQVGEIELKDSVFGVPVNVPVMHEAVLNYLANQRQGTHSTKTRGEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+  GG  FGP P    + LPKKV+ LAL+ ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRAPQWIKGGIVFGPKPRDYSYKLPKKVKRLALKSALSSKVRD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+I+V+D     + KTK +V   +  ++ +ALI+   + ++N +L+ARNIP +  L    
Sbjct: 121 NEIIVLDEFKLDQPKTKKVVELLKNFNVDSALIVV-PEGEKNVELSARNIPGVKTLYANY 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +N YDIL+  K +++K A+  +E+ +
Sbjct: 180 LNTYDILKYDKFIITKDAVGIVEEVY 205


>gi|297588192|ref|ZP_06946836.1| ribosomal protein L4/L1 family protein [Finegoldia magna ATCC
           53516]
 gi|297574881|gb|EFH93601.1| ribosomal protein L4/L1 family protein [Finegoldia magna ATCC
           53516]
          Length = 207

 Score =  124 bits (311), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 114/207 (55%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ + N  GE+ G + ++E IF +   + ++  V+R Q   KR G   +K RSEV   
Sbjct: 1   MPKVQILNQQGENVGELELNEAIFGVDVNEHVVYEVVRNQLANKRQGTQSAKTRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  F P P    +A+PKKVR LA++  L+DK   
Sbjct: 61  GKKPWRQKGTGRARQGSIRSPQWRGGGVVFAPKPRDYSYAVPKKVRRLAIKSVLTDKVND 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+++V+D L      TK  V   + +      ++   + D     + RNI N+ +   + 
Sbjct: 121 NEMIVLDKLSLDAISTKKAVEVLKNIKADKKALVVVDKNDDTLYRSFRNIENVAICEARL 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRFK 207
           INVYD L+ + LV++  A++ LE+ F+
Sbjct: 181 INVYDCLKYNSLVITTDAVKILEEVFQ 207


>gi|58584598|ref|YP_198171.1| 50S ribosomal protein L4 [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
 gi|75497927|sp|Q5GSU5|RL4_WOLTR RecName: Full=50S ribosomal protein L4
 gi|58418914|gb|AAW70929.1| Ribosomal protein L4 [Wolbachia endosymbiont strain TRS of Brugia
           malayi]
          Length = 204

 Score =  124 bits (311), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 115/205 (56%), Gaps = 2/205 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +E  + NL   D G   ++  IF+++ +  IL  ++RWQ  ++R G  K KG S+V+ T 
Sbjct: 1   MECKLVNLSNNDVGTTQLNPLIFSVEQKLSILHDIVRWQLAKRRAGTHKVKGISDVSGTT 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +K Y QK TGRAR  S    QFRGGG  FGP+     ++L KKVR   L+ ALS K+ +N
Sbjct: 61  AKPYSQKRTGRARQGSLRSPQFRGGGVIFGPIVRSHAYSLNKKVRKFGLKVALSLKYLNN 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            +++++NL     KT  +    +    S+ LI+     + +   AARN+  +NL+   G+
Sbjct: 121 QVIILNNLNINVKKTSEMCKYIQNFKFSSFLIVG--DYEDSLLRAARNLHYVNLIKPIGL 178

Query: 182 NVYDILRCSKLVLSKSAIEALEDRF 206
           NV+DIL    ++L+  A+  LE R 
Sbjct: 179 NVFDILNHECIMLTSDALRYLEGRL 203


>gi|116490659|ref|YP_810203.1| 50S ribosomal protein L4P [Oenococcus oeni PSU-1]
 gi|290890075|ref|ZP_06553158.1| hypothetical protein AWRIB429_0548 [Oenococcus oeni AWRIB429]
 gi|122277157|sp|Q04G84|RL4_OENOB RecName: Full=50S ribosomal protein L4
 gi|116091384|gb|ABJ56538.1| LSU ribosomal protein L4P [Oenococcus oeni PSU-1]
 gi|290480266|gb|EFD88907.1| hypothetical protein AWRIB429_0548 [Oenococcus oeni AWRIB429]
          Length = 207

 Score =  124 bits (311), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 63/204 (30%), Positives = 114/204 (55%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++   DG   G + +++ IFA++P + ++   +  Q    R G    K RS V+  
Sbjct: 1   MTKVALYKQDGTQAGEVELADSIFAIEPNEAVVTDAVLMQRASLRQGTHSVKNRSTVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+RGG  + GP+P    + + +K   LAL+  LSDK  +
Sbjct: 61  GRKPWRQKGTGNARQGSIRAPQWRGGAISMGPIPRPYAYKINRKAYRLALKSVLSDKVSA 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            + ++ID L  ++  TK +      L+ +   ++     + N +L+ARN+PN+ +    G
Sbjct: 121 KNFVIIDELNFEKPSTKAIADSLNKLEATKKTLLVVDDANENAKLSARNLPNVQVTTASG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NVYD+++  K+V+ +SA++ +E+
Sbjct: 181 VNVYDLVKAQKVVIVQSAVKQVEE 204


>gi|312870511|ref|ZP_07730630.1| 50S ribosomal protein L4 [Lactobacillus oris PB013-T2-3]
 gi|311093973|gb|EFQ52298.1| 50S ribosomal protein L4 [Lactobacillus oris PB013-T2-3]
          Length = 207

 Score =  124 bits (311), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 108/204 (52%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +++   DG   G I ++  +F ++P Q      +  Q    R G    K RS V+  
Sbjct: 1   MTSVNLYKQDGSQNGTIELNAAVFGIEPNQNAEFDAILRQRASLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    QFRGGG  FGP P    + LP+KVR LA++ ALS K   
Sbjct: 61  GKKPWRQKGTGRARQGSIRAPQFRGGGIVFGPSPRSYKYNLPRKVRQLAIKSALSQKVLD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N ++V+D L     KTK        L+++   +I     D+N  L+ARN+ N  ++   G
Sbjct: 121 NALVVVDALNFDAPKTKEFAGVMNNLNVAEKALIVVTDDDKNAALSARNLANATVVTPAG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +N+ ++    K++++KSA+  +E+
Sbjct: 181 VNILNVADAQKVIITKSALSQVEE 204


>gi|331702079|ref|YP_004399038.1| 50S ribosomal protein L4/L1e [Lactobacillus buchneri NRRL B-30929]
 gi|329129422|gb|AEB73975.1| ribosomal protein L4/L1e [Lactobacillus buchneri NRRL B-30929]
          Length = 207

 Score =  124 bits (310), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 109/204 (53%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++   DG   G +++++ IF ++P   ++   +  Q    R G    K RS V   
Sbjct: 1   MTDVALYKQDGSKNGTVALNDGIFGIEPNNNVVFDAIVMQRASLRQGTHSVKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LPKKV  LAL+  LS+K   
Sbjct: 61  GKKPWRQKGTGRARQGSIRSPQWRGGGIVFGPTPRSYSYRLPKKVSRLALKSVLSEKVSD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N ++V+D L     KTK        LD+S   ++     +    L+ARN+ N+ ++  QG
Sbjct: 121 NKLVVVDTLQFDAPKTKEFAELLGKLDVSTKTLVVLEDDNEKAVLSARNLENVKVVSAQG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           IN  D+    K+V++K+A+  +E+
Sbjct: 181 INTLDVADHDKVVITKAALSQVEE 204


>gi|166031658|ref|ZP_02234487.1| hypothetical protein DORFOR_01358 [Dorea formicigenerans ATCC
           27755]
 gi|166028635|gb|EDR47392.1| hypothetical protein DORFOR_01358 [Dorea formicigenerans ATCC
           27755]
          Length = 206

 Score =  124 bits (310), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 69/208 (33%), Positives = 119/208 (57%), Gaps = 5/208 (2%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +SV N++G++   I +S+ +F ++  + ++   +  Q    R G  K+K RSEV+  
Sbjct: 1   MANVSVYNIEGKEVETIELSDAVFGVEVNEHLVHMAVVNQLANNRQGTQKAKTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+ GGG  F PVP      + KK +  AL+ AL+ +   
Sbjct: 61  GRKPWRQKGTGHARQGSTRAPQWTGGGVVFAPVPRDYSFKMNKKEKRAALKSALTSRVEE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALII--DGCQLDRNFQLAARNIPNINLLPV 178
           N  +V+D+L   E KTK +    + L++S AL++  DG   + N +L+A+NI  +     
Sbjct: 121 NKFIVVDSLTFDEIKTKNVANALKNLNVSKALVVLEDG---NVNAELSAKNIAGVKTAKT 177

Query: 179 QGINVYDILRCSKLVLSKSAIEALEDRF 206
             INVYD+++ + ++ +K+A++A+E+ +
Sbjct: 178 NTINVYDVMKYNTVIATKAAVKAIEEVY 205


>gi|167759861|ref|ZP_02431988.1| hypothetical protein CLOSCI_02224 [Clostridium scindens ATCC 35704]
 gi|167662480|gb|EDS06610.1| hypothetical protein CLOSCI_02224 [Clostridium scindens ATCC 35704]
          Length = 206

 Score =  124 bits (310), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 73/208 (35%), Positives = 117/208 (56%), Gaps = 5/208 (2%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +SV N++G++ G + +S+ +F ++  + +L   +  Q   KR G  K+K RSEV+  
Sbjct: 1   MANVSVYNIEGKEVGTMDLSDAVFGVEINEHLLHMAVVNQLANKRQGTQKAKTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+ GGG  F PVP      + KK +  AL+ AL+ K   
Sbjct: 61  GRKPWRQKGTGHARQGSTRAPQWTGGGVVFAPVPRDYSFKMNKKEKRAALKSALTAKVEE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALII--DGCQLDRNFQLAARNIPNINLLPV 178
              +V+D +   E KTK      + LD+S AL++  DG   + N +++ARNI +I     
Sbjct: 121 KKFIVVDEIKLDEIKTKNFANILKNLDVSKALVVLEDG---NTNAEVSARNIADIKTARS 177

Query: 179 QGINVYDILRCSKLVLSKSAIEALEDRF 206
             INVYDIL+ + ++ +K+A+  +E+ +
Sbjct: 178 NTINVYDILKYNTVIATKAAVANIEEVY 205


>gi|291542036|emb|CBL15146.1| LSU ribosomal protein L4P [Ruminococcus bromii L2-63]
          Length = 207

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 113/206 (54%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  L+V +++G++ G I ++E +F ++P   ++ +++      +R G   +  RSEV+  
Sbjct: 1   MPNLAVVDMEGKNVGTIELAESVFGIEPNAAVMHQMVVNYLAAQRQGTQSALTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+  GG  F P P     ++ KKVR LA++ A S K   
Sbjct: 61  GKKPWRQKGTGRARQGSTRAPQWTHGGVVFAPKPRDYRFSVNKKVRRLAMKSAFSSKVME 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+++V+D++   E KTK +V    A+      +I   ++D     +A NIP +    V  
Sbjct: 121 NELIVVDSISMDEYKTKKIVAMLSAIGAEKKALIVLPEVDSKVIKSANNIPGVKTAQVNT 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVYDIL   KL++ K A+  +E+ +
Sbjct: 181 LNVYDILNADKLIIVKDAVSKIEEVY 206


>gi|270291132|ref|ZP_06197355.1| 50S ribosomal protein L4/L1 [Pediococcus acidilactici 7_4]
 gi|304385413|ref|ZP_07367758.1| ribosomal protein L4/L1 family protein [Pediococcus acidilactici
           DSM 20284]
 gi|270280528|gb|EFA26363.1| 50S ribosomal protein L4/L1 [Pediococcus acidilactici 7_4]
 gi|304328620|gb|EFL95841.1| ribosomal protein L4/L1 family protein [Pediococcus acidilactici
           DSM 20284]
          Length = 207

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 108/204 (52%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +S+   DG   G + ++ DIF ++P   ++   +  Q    R G    K RS V   
Sbjct: 1   MANVSLFKQDGTQNGTVELNADIFGIEPNNDVVFEAVVMQRASMRQGTHAVKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    +++PKK+R LAL+  LS K   
Sbjct: 61  GKKPWRQKGTGRARQGSIRSPQWRGGGIVFGPTPRSYAYSIPKKMRRLALKSVLSQKVLD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             ++V+D    +  KTK        L++    ++   + + +  LAARN+ N+ ++   G
Sbjct: 121 ESLVVVDEFKFETPKTKDFAQSLSKLNVEKKALLVLEEDNESAVLAARNLSNVKIVEPTG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           INV DI+   KLV+++ A+  +E+
Sbjct: 181 INVLDIMNSDKLVITQKALSQVEE 204


>gi|57239335|ref|YP_180471.1| 50S ribosomal protein L4 [Ehrlichia ruminantium str. Welgevonden]
 gi|58579301|ref|YP_197513.1| 50S ribosomal protein L4 [Ehrlichia ruminantium str. Welgevonden]
 gi|81557285|sp|Q5HAS3|RL4_EHRRW RecName: Full=50S ribosomal protein L4
 gi|57161414|emb|CAH58338.1| 50S ribosomal protein L4 [Ehrlichia ruminantium str. Welgevonden]
 gi|58417927|emb|CAI27131.1| 50S ribosomal protein L4 [Ehrlichia ruminantium str. Welgevonden]
          Length = 205

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 73/205 (35%), Positives = 119/205 (58%), Gaps = 1/205 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +E++V N++ ++ G I ++  IF++  +  IL  V+ WQ  ++RIG  K+K   +V+ T 
Sbjct: 1   MEVNVINIESQNIGKIDLNPLIFSVNYRPDILKMVVEWQLSKRRIGAHKTKTIGDVSGTT 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +K Y QK TGRAR  S    QFRGG   FGPV     ++L KKVR+L L+ ALS K   N
Sbjct: 61  AKPYRQKHTGRARQGSLRSPQFRGGAVIFGPVVRTHAYSLNKKVRNLGLKVALSLKNSCN 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++++D++     KT  ++   +  +  + LII G   ++    + +N+ N+ LL   G 
Sbjct: 121 KLLILDSIDVNFVKTAQVLRFIKNFEHQSFLII-GKDYNKGMMYSCKNLHNVTLLKQIGT 179

Query: 182 NVYDILRCSKLVLSKSAIEALEDRF 206
           NV+DILR   ++L+   ++ LEDR 
Sbjct: 180 NVFDILRHDCVILTVDTVKYLEDRL 204


>gi|210611126|ref|ZP_03288740.1| hypothetical protein CLONEX_00930 [Clostridium nexile DSM 1787]
 gi|210152113|gb|EEA83120.1| hypothetical protein CLONEX_00930 [Clostridium nexile DSM 1787]
          Length = 206

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 72/208 (34%), Positives = 115/208 (55%), Gaps = 5/208 (2%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +SV N++G++ G I +++ +F ++  + +L   +  Q   KR G  K+K RSEV+  
Sbjct: 1   MANVSVYNIEGKEVGTIDLNDAVFGVEVNEHLLHMAVVNQLANKRQGTQKAKTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+ GGG  F P P      L KK +  AL+ AL+ +   
Sbjct: 61  GRKPWRQKGTGHARQGSTRSPQWTGGGVVFAPTPRDYSFKLNKKEKRAALKSALTTRVLE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALII--DGCQLDRNFQLAARNIPNINLLPV 178
           N  +V+D +   E KTK        L++S AL++  DG   + N  L+ARNI N+     
Sbjct: 121 NKFIVLDEMNFGEIKTKNFQNMLNNLEVSKALVVLEDG---NTNAALSARNIANVKTAWT 177

Query: 179 QGINVYDILRCSKLVLSKSAIEALEDRF 206
             INVYDIL+ + ++++K+ +  +E+ +
Sbjct: 178 NTINVYDILKYNTVIVTKAVVATIEEVY 205


>gi|260438215|ref|ZP_05792031.1| ribosomal protein L4/L1 family protein [Butyrivibrio crossotus DSM
           2876]
 gi|292809407|gb|EFF68612.1| ribosomal protein L4/L1 family protein [Butyrivibrio crossotus DSM
           2876]
          Length = 206

 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 70/206 (33%), Positives = 115/206 (55%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++SV N++G+  G + +++ +F ++    ++ + +  Q   KR G   +K RSEV+  
Sbjct: 1   MAKVSVYNIEGKVVGDMELNDAVFGVEVNTHLVHQAVVLQLANKRQGTQSAKTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+ GGG  F P P      + KK ++LAL+  L+ K   
Sbjct: 61  GRKPWRQKGTGHARQGSTRSPQWTGGGIVFAPKPRDYSFKMNKKEKNLALKSVLTTKVAE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N  +V+D L   E KTK +V   + L++  AL++     ++N  L++RNIP +       
Sbjct: 121 NKFIVVDGLSFDEIKTKNMVNVLKNLEVKKALVVTDDD-NKNVTLSSRNIPGVKTAFTNT 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYDIL+  K+V++K  I  +E+ +
Sbjct: 180 INVYDILKYDKMVVAKDVISKIEEVY 205


>gi|289550144|ref|YP_003471048.1| LSU ribosomal protein L4p (L1e) [Staphylococcus lugdunensis
           HKU09-01]
 gi|289179676|gb|ADC86921.1| LSU ribosomal protein L4p (L1e) [Staphylococcus lugdunensis
           HKU09-01]
          Length = 207

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 104/204 (50%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M    V  +DG   G + +S+ +F ++P   +L   +  Q    R G    K RS V   
Sbjct: 1   MANYDVLKVDGSKAGSVELSDAVFGIEPNNSVLFEAITLQRASLRQGTHAVKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  +    Q+RGGG  FGP P    + +PKK+R LALR ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGTIRAPQWRGGGIVFGPTPRSYAYKMPKKMRRLALRSALSFKVKE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N   V+D+   +  KTK        L+    +++     D N  L+ARNIP + +    G
Sbjct: 121 NGFTVVDSFGFETPKTKEFKNVLTTLEQPKKVLVVTENEDVNVALSARNIPGVQVTTATG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV DI     ++++++A + +E+
Sbjct: 181 LNVLDISSADSVIITEAAAKKVEE 204


>gi|320335522|ref|YP_004172233.1| 50S ribosomal protein L4/L1e [Deinococcus maricopensis DSM 21211]
 gi|319756811|gb|ADV68568.1| ribosomal protein L4/L1e [Deinococcus maricopensis DSM 21211]
          Length = 201

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 101/175 (57%), Gaps = 5/175 (2%)

Query: 32  ILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGTGRARHSSKSVSQFRGGGKAFG 91
           +L  V+ WQ  ++R G + +K R++V+  G KMY QKGTG ARH  +SV  F GGG AFG
Sbjct: 26  VLHEVVSWQLAKRRQGSASTKTRAQVSRGGKKMYSQKGTGNARHGDRSVPTFVGGGVAFG 85

Query: 92  PVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNLVSKECKTKYLV--TRFRALDLS 149
           P P    + LPKKVR L L  AL+D+   + ++ +D     + KTK  V   +   +D S
Sbjct: 86  PKPRSYAYTLPKKVRQLGLAMALADRQAQDKLLAVDGF-GLDGKTKSFVAWAKENGMDGS 144

Query: 150 NALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRCSKLVLSKSAIEALED 204
             + +     D   + AARN+  +  LPV G+NVYDILR  +L++   A+E  ++
Sbjct: 145 ERVFL--VTDDEATRRAARNLSWVTALPVAGLNVYDILRHERLIIDAIALEPAKE 197


>gi|197303813|ref|ZP_03168849.1| hypothetical protein RUMLAC_02552 [Ruminococcus lactaris ATCC
           29176]
 gi|197297106|gb|EDY31670.1| hypothetical protein RUMLAC_02552 [Ruminococcus lactaris ATCC
           29176]
          Length = 206

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 69/208 (33%), Positives = 120/208 (57%), Gaps = 5/208 (2%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++SV N++G++   I +++ +F ++  + ++   +  Q    R G  K+K RSEV+  
Sbjct: 1   MAKVSVYNIEGKEVDTIELNDAVFGVEVNEHLVHMAVVNQLANNRQGTQKAKTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+ GGG  F PVP      + KK +  AL+ AL+ +   
Sbjct: 61  GRKPWRQKGTGHARQGSTRSPQWTGGGVVFAPVPRDYSFKMNKKEKRAALKSALTSRVEE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALII--DGCQLDRNFQLAARNIPNINLLPV 178
           N  +V+D +   E KTK   T    L+++ AL++  +G   D+N +++A+NIP++    V
Sbjct: 121 NKFIVVDEMKFDEIKTKKFQTVLNNLNVNKALVVLEEG---DKNAEISAKNIPDVKTARV 177

Query: 179 QGINVYDILRCSKLVLSKSAIEALEDRF 206
             INVYDIL+ + ++ +K+ + A+E+ +
Sbjct: 178 NTINVYDILKYNTVIATKAVVAAIEEVY 205


>gi|23097575|ref|NP_691041.1| 50S ribosomal protein L4 [Oceanobacillus iheyensis HTE831]
 gi|46577267|sp|Q8ETY1|RL4_OCEIH RecName: Full=50S ribosomal protein L4
 gi|22775798|dbj|BAC12076.1| 50S ribosomal protein L4 [Oceanobacillus iheyensis HTE831]
          Length = 207

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 71/200 (35%), Positives = 108/200 (54%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++   DG + G I +++ +F ++P   +L   +  Q    R G    K RSEV   
Sbjct: 1   MPKVALLKQDGSNVGDIELNDSVFGIEPNTHVLHEAVVMQRASLRQGTHAVKNRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+ GGG  FGP P    + LPKKVR LALR ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGSTRSPQWVGGGTVFGPTPRSYSYKLPKKVRRLALRSALSSKVNE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             ++V++N+     KTK +V   + L +    +I   + D     +A N+ N+ +L V+ 
Sbjct: 121 ESLLVLENISIDAPKTKEIVNILKGLQVDAKALIVLSEKDETVIRSANNLQNVTVLTVEE 180

Query: 181 INVYDILRCSKLVLSKSAIE 200
           +N+ D+L   KL+++K A E
Sbjct: 181 LNILDLLMHDKLIITKDAAE 200


>gi|162446958|ref|YP_001620090.1| 50S ribosomal protein L4 [Acholeplasma laidlawii PG-8A]
 gi|189029489|sp|A9NED4|RL4_ACHLI RecName: Full=50S ribosomal protein L4
 gi|161985065|gb|ABX80714.1| large subunit ribosomal protein L4 [Acholeplasma laidlawii PG-8A]
          Length = 207

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 117/204 (57%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  L++ N  GE    +++++ IF + P Q +L  V+  Q    R G +K+K R+EV   
Sbjct: 1   MPTLNLFNQAGEKISEVALNDAIFGITPNQQVLYDVVNAQRAALRQGTAKTKTRAEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP+P      + +KV+ LAL+ ALS    +
Sbjct: 61  GKKPWRQKGTGRARQGSIRSPQWRGGGIVFGPIPRSYAVKVNQKVKQLALKSALSYHVLA 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            +++++DN+   E KTK  +     L L +  I+    +D+N  LA+ N+P   +  V  
Sbjct: 121 ENLVLVDNITVAEPKTKLFIEIMNNLKLDDRSIVLVDSVDKNLLLASNNLPGAVVREVSQ 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           ++VY++L+  ++VL++ A++  E+
Sbjct: 181 VSVYELLKFKQVVLTQGAVKYYEE 204


>gi|328951235|ref|YP_004368570.1| ribosomal protein L4/L1e [Marinithermus hydrothermalis DSM 14884]
 gi|328451559|gb|AEB12460.1| ribosomal protein L4/L1e [Marinithermus hydrothermalis DSM 14884]
          Length = 207

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 119/207 (57%), Gaps = 12/207 (5%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  L V +  G+ +  +++ E+I    P   +L  V+RWQ  ++R G + +K R EVAY+
Sbjct: 1   MYTLPVISKSGKKEVQVNLPEEI---NPH--VLYEVVRWQLAKRRRGTASTKTRGEVAYS 55

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
             K+Y QK TGRARH  +    F GGG  FGP P    + LPKKVR L L  A++D+   
Sbjct: 56  SRKLYPQKHTGRARHGDRGAPIFVGGGTVFGPKPRDYSYTLPKKVRKLGLAMAIADRAKE 115

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRA--LDLSNA-LIIDGCQLDRNFQLAARNIPNINLLP 177
             ++V++       KTK  +   +A  LD S   L++   +L R    AARN+P  ++L 
Sbjct: 116 EKLLVVEAFEGVNGKTKEFLAWAKANGLDGSETVLVVTENELVRR---AARNLPWASVLE 172

Query: 178 VQGINVYDILRCSKLVLSKSAIE-ALE 203
            +G+NVYDILR  +L+L ++A++ ALE
Sbjct: 173 PEGLNVYDILRHERLLLDEAALKLALE 199


>gi|150020846|ref|YP_001306200.1| 50S ribosomal protein L4 [Thermosipho melanesiensis BI429]
 gi|166199920|sp|A6LLL4|RL4_THEM4 RecName: Full=50S ribosomal protein L4
 gi|149793367|gb|ABR30815.1| ribosomal protein L4/L1e [Thermosipho melanesiensis BI429]
          Length = 221

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 71/218 (32%), Positives = 123/218 (56%), Gaps = 14/218 (6%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ + N+ GE+ G + + E++FA++P Q ++ R +  Q    R G + +K R EV+  
Sbjct: 1   MAKVDLFNIKGENIGTVELKEEVFAIEPNQDVMWRYIDMQLTNSRAGTASTKTRGEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K ++QK TGRAR  S     +R GG A GP P +    L KK++ LAL+ ALS +   
Sbjct: 61  GRKPWIQKHTGRARQGSIRAPHWRHGGVAHGPKPRVYFKRLNKKMKRLALKSALSLRLKE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNA---LIIDGCQLD-RNFQLAARNIPNINLL 176
           N+++V+D++  ++ +TK L    + L L N    +++   + +  N +++ RNIP + +L
Sbjct: 121 NNLVVVDDIKFEKPRTKDLREVLKNLGLENQKVLIVLPKKESEYENVKISGRNIPGVKVL 180

Query: 177 ----------PVQGINVYDILRCSKLVLSKSAIEALED 204
                      + G+NVYDIL   KLVL +  ++ +E+
Sbjct: 181 IADNPGVDRVNIDGLNVYDILNHDKLVLLQGTVQKIEE 218


>gi|154505168|ref|ZP_02041906.1| hypothetical protein RUMGNA_02681 [Ruminococcus gnavus ATCC 29149]
 gi|153794647|gb|EDN77067.1| hypothetical protein RUMGNA_02681 [Ruminococcus gnavus ATCC 29149]
          Length = 206

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 72/208 (34%), Positives = 117/208 (56%), Gaps = 5/208 (2%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +SV N++G++ G I +S+ +F ++  + ++   +  Q   KR G  K+K RSEV+  
Sbjct: 1   MANVSVYNIEGKEVGTIDLSDAVFGVEVNEHLVHMAVVSQLANKRQGTQKAKTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+ GGG  F P P      L KK +  AL+ ALS +   
Sbjct: 61  GRKPWRQKGTGHARQGSTRSPQWTGGGVVFAPTPRDYSMKLNKKEKRAALKSALSSRVAE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALII--DGCQLDRNFQLAARNIPNINLLPV 178
           N  +VID +   E KTK       +L+++ AL++  DG   + N +L+ARNI ++     
Sbjct: 121 NKFIVIDEMNFGEIKTKNFQNMLNSLNVNKALVVLEDG---NVNAELSARNIADVKTART 177

Query: 179 QGINVYDILRCSKLVLSKSAIEALEDRF 206
             INV+DIL+ + ++ +K+A+  +E+ +
Sbjct: 178 NTINVFDILKYNTVIATKAAVANIEEVY 205


>gi|315659226|ref|ZP_07912090.1| ribosomal protein L4/L1 family protein [Staphylococcus lugdunensis
           M23590]
 gi|315495651|gb|EFU83982.1| ribosomal protein L4/L1 family protein [Staphylococcus lugdunensis
           M23590]
          Length = 207

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 104/204 (50%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M    V  +DG   G + +S+ +F ++P   +L   +  Q    R G    K RS V   
Sbjct: 1   MANYDVLKVDGSKAGSVELSDAVFGIEPNNSVLFEAITLQRASLRQGTHAVKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  +    Q+RGGG  FGP P    + +PKK+R LALR ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGTIRAPQWRGGGIVFGPTPRSYAYKMPKKMRRLALRSALSFKVKE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N   V+D+   +  KTK        L+    +++     D N  L+ARNIP + +    G
Sbjct: 121 NGFTVVDSFGFEAPKTKEFKNVLTTLEQPKKVLVVTENEDVNVALSARNIPGVQVTTATG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV DI     ++++++A + +E+
Sbjct: 181 LNVLDISSADSVIITEAAAKKVEE 204


>gi|153854971|ref|ZP_01996184.1| hypothetical protein DORLON_02190 [Dorea longicatena DSM 13814]
 gi|149752468|gb|EDM62399.1| hypothetical protein DORLON_02190 [Dorea longicatena DSM 13814]
          Length = 206

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 69/206 (33%), Positives = 116/206 (56%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +SV N++G++ G I +S+ +F ++  + ++   +  Q    R G  K+K RSEV+  
Sbjct: 1   MANVSVYNIEGKEVGKIDLSDAVFGVEVNEHLVHMAVVSQLANNRQGTQKAKTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+ GGG  F PVP      + K+ +  AL+ AL+ +   
Sbjct: 61  GRKPWRQKGTGHARQGSTRAPQWTGGGVVFAPVPRDYSFKMNKREKRAALKSALTSRVEE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N  +VID +  +E KTK      + LD+S AL++     ++N +L+ARNI ++       
Sbjct: 121 NKFIVIDEINFEEAKTKNFANILKNLDVSKALVVLEDD-NKNAELSARNIADVKTAKTNT 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYDIL+ + ++ +K+ +  +E+ +
Sbjct: 180 INVYDILKYNTVITTKAVVAKIEEVY 205


>gi|160941068|ref|ZP_02088406.1| hypothetical protein CLOBOL_05961 [Clostridium bolteae ATCC
           BAA-613]
 gi|158436017|gb|EDP13784.1| hypothetical protein CLOBOL_05961 [Clostridium bolteae ATCC
           BAA-613]
          Length = 206

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 115/206 (55%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +SV N++G++ G + +++ +F ++  + ++   +  Q   KR G  K+K RSEV+  
Sbjct: 1   MANVSVYNMEGKEVGALELNDAVFGVEVNEHLVHLAVVAQLANKRQGTQKAKTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q++GGG  F P P      L KK +  ALR AL+ +   
Sbjct: 61  GRKPWRQKGTGHARQGSTRSPQWKGGGVVFAPTPRDYTIRLNKKEKRAALRSALTSRVQD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N  +V+D L   E KTK        L +S AL++     D+N  L+ARNI  +    V  
Sbjct: 121 NKFIVVDELKFDEIKTKKFQNVMDNLKVSKALVVLADN-DQNTVLSARNIAGVKTSQVGS 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYDIL+ + +V +K+A+ ++E+ +
Sbjct: 180 INVYDILKYNTVVATKAAVASIEEVY 205


>gi|156743947|ref|YP_001434076.1| 50S ribosomal protein L4/L1e [Roseiflexus castenholzii DSM 13941]
 gi|156235275|gb|ABU60058.1| ribosomal protein L4/L1e [Roseiflexus castenholzii DSM 13941]
          Length = 221

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 66/199 (33%), Positives = 111/199 (55%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +E  + N  GE+ GVI +S+ +F ++P   ++ + +  Q    R+G   + GR EV  + 
Sbjct: 1   MEAKLYNQSGEEVGVIQISDYVFGIEPNVPVMHQAMERQRANARLGTHNTLGRGEVEGST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTGRAR  S      +GGG A GP P      +P+K+R LA+R ALS +    
Sbjct: 61  RKLYRQKGTGRARQGSIRAPHRKGGGIAHGPHPRSYTKDMPRKMRRLAVRSALSARHRDG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            I+ +D L  ++ +TK ++    AL+L+   +I   + D + + +A N+PN+  L    +
Sbjct: 121 AILFLDRLTFEQPRTKDMIAVLNALNLTGKTLIVLDRKDEHVRRSANNLPNVKTLLAHYL 180

Query: 182 NVYDILRCSKLVLSKSAIE 200
           NV D+L    +V+ K+A++
Sbjct: 181 NVIDLLTHDHVVMLKAAVD 199


>gi|325179760|emb|CCA14163.1| 50S ribosomal protein L4 putative [Albugo laibachii Nc14]
          Length = 279

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 74/192 (38%), Positives = 106/192 (55%)

Query: 15  GVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGTGRAR 74
             +++   +F +  ++ IL RV+RWQ   +R G  K+K RSE   +  K+  QKG+G+AR
Sbjct: 85  NTLALDPSVFNVPLRKDILHRVVRWQLACRRSGNHKAKSRSETRGSTRKVRPQKGSGQAR 144

Query: 75  HSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNLVSKEC 134
                  Q+RGG    GPV     + L KKVR+  +R ALS K     + +++NL     
Sbjct: 145 VGDVRAPQWRGGYCVHGPVVRDHSYTLQKKVRAFGIRVALSQKLREGKLAIVENLDWDVV 204

Query: 135 KTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRCSKLVL 194
           KTK L     A    NAL IDG ++  NF L++RNIP I+++P   INVY IL+   L+ 
Sbjct: 205 KTKELRDTLIARKWDNALFIDGEEVTTNFILSSRNIPCIDVIPQHKINVYSILKRDLLIT 264

Query: 195 SKSAIEALEDRF 206
           +  AI   EDRF
Sbjct: 265 TVDAITYFEDRF 276


>gi|323483300|ref|ZP_08088690.1| hypothetical protein HMPREF9474_00439 [Clostridium symbiosum
           WAL-14163]
 gi|323691202|ref|ZP_08105478.1| ribosomal protein L4/L1 family protein [Clostridium symbiosum
           WAL-14673]
 gi|323403398|gb|EGA95706.1| hypothetical protein HMPREF9474_00439 [Clostridium symbiosum
           WAL-14163]
 gi|323504721|gb|EGB20507.1| ribosomal protein L4/L1 family protein [Clostridium symbiosum
           WAL-14673]
          Length = 206

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 72/208 (34%), Positives = 115/208 (55%), Gaps = 5/208 (2%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +SV N++G + G + +++ +F ++  + ++   +  Q   KR G  K+K RSEV+  
Sbjct: 1   MANVSVYNIEGNEVGTLELNDSVFGVEVNEHLVHLAVVAQLANKRQGTQKAKTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+ GGG  F P P      L KK +  AL+ AL+ +   
Sbjct: 61  GRKPWRQKGTGHARQGSTRSPQWTGGGVVFAPTPRDYTIRLNKKEKRAALKSALTSRVNE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALII--DGCQLDRNFQLAARNIPNINLLPV 178
           N  +V+D +   E KTK   +    L ++ AL++  D C    N  L+ARNIP +    V
Sbjct: 121 NKFIVVDAMNFDEIKTKKFQSVMNNLKVNKALVVLDDTCG---NTVLSARNIPTVKTASV 177

Query: 179 QGINVYDILRCSKLVLSKSAIEALEDRF 206
             INVYDIL+ + +V +K+A+ ++E+ +
Sbjct: 178 NTINVYDILKYNTVVATKAAVASIEEVY 205


>gi|228470744|ref|ZP_04055595.1| ribosomal protein L4/L1 family protein [Porphyromonas uenonis 60-3]
 gi|228307601|gb|EEK16597.1| ribosomal protein L4/L1 family protein [Porphyromonas uenonis 60-3]
          Length = 207

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 117/213 (54%), Gaps = 14/213 (6%)

Query: 2   IELSVRNLDGEDKG-VISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           +ELS+ N+ GED G  I++   +F ++P    +   ++     +R G  K+K RSE++ +
Sbjct: 1   MELSIYNIQGEDTGRKIALESSVFGIEPNDHAIYLTVKQYRANQRQGTHKTKERSEMSGS 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
             K++ QKGTG AR    + +  RGG + FGP P      L KK+R LA R AL+ K   
Sbjct: 61  TRKLFRQKGTGGARRGDINSNILRGGARVFGPRPRSYSFKLNKKLRQLARRSALTYKAQD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDG-------CQLDRNFQLAARNIPNI 173
           N IMV+D L  +  KTK  V+      ++ AL +DG        Q++    L+ARNIP +
Sbjct: 121 NQIMVLDQLSFEAPKTKSFVS------MAKALNVDGQKTLYVVSQIEDTVALSARNIPGV 174

Query: 174 NLLPVQGINVYDILRCSKLVLSKSAIEALEDRF 206
           +++  Q +N Y +L C K+V ++ A+  + + F
Sbjct: 175 SIIRAQDLNTYCVLDCRKIVFTEDALAQVNEMF 207


>gi|323141357|ref|ZP_08076248.1| 50S ribosomal protein L4 [Phascolarctobacterium sp. YIT 12067]
 gi|322414106|gb|EFY04934.1| 50S ribosomal protein L4 [Phascolarctobacterium sp. YIT 12067]
          Length = 211

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 74/207 (35%), Positives = 113/207 (54%), Gaps = 5/207 (2%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +LSV +L G   G I +++ +F  +  + ++ + +  Q   +R G S +K R+ V   
Sbjct: 4   MPKLSVYDLSGAQTGEIELNDSVFGAEFNEAVVHQAVVMQLANQRQGTSATKTRAMVRGG 63

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     + GGG  FGP P      +P+K R LAL  ALS K  +
Sbjct: 64  GRKPWKQKGTGRARCGSNRSPVWVGGGTTFGPQPRSYAKKMPRKARRLALCCALSAKVAA 123

Query: 121 NDIMVIDNLVSKECKTKY---LVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLP 177
            +++V++ L     KTK    L+  F A+D    LI DG   + N  L+ARN+P +  + 
Sbjct: 124 GELVVVEGLAFDAPKTKQVASLLKAFEAVDTKALLITDGS--NENVALSARNMPKVTTIT 181

Query: 178 VQGINVYDILRCSKLVLSKSAIEALED 204
             G+N +DIL   K+ L+K A+E +E+
Sbjct: 182 NMGLNCFDILNSKKVFLAKDAVEKIEE 208


>gi|88606786|ref|YP_504893.1| 50S ribosomal protein L4 [Anaplasma phagocytophilum HZ]
 gi|109893574|sp|Q2GL58|RL4_ANAPZ RecName: Full=50S ribosomal protein L4
 gi|88597849|gb|ABD43319.1| ribosomal protein L4 [Anaplasma phagocytophilum HZ]
          Length = 208

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 76/208 (36%), Positives = 120/208 (57%), Gaps = 6/208 (2%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +E+++ N+  E  G I ++  +F L+P++ +L  V+ WQ  ++R G  K+KG S+++ T 
Sbjct: 1   MEVNIVNIANEVVGSIDLNPQVFGLEPRRDVLKEVVNWQLAKRRAGTHKAKGISDISGTT 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +K Y QK TGRAR  S    QFRGG   FGPVP    ++L KKVR L L+ ALS K  +N
Sbjct: 61  AKPYRQKHTGRARQGSLRSPQFRGGAVIFGPVPRSHEYSLNKKVRRLGLKVALSMKVAAN 120

Query: 122 DIMVIDNL---VSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPV 178
            ++V+D+L   + K    K +   F A   S  ++ + C+       A RN+  ++LL  
Sbjct: 121 KLVVLDSLDVDLKKTADAKGVFGNF-AGHSSYLVVSESCK--EEVVRACRNLRGVDLLKC 177

Query: 179 QGINVYDILRCSKLVLSKSAIEALEDRF 206
            GINV DIL+   ++L+   +++LE R 
Sbjct: 178 VGINVLDILKHDCVILTVDTVKSLEGRL 205


>gi|239623348|ref|ZP_04666379.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239522314|gb|EEQ62180.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
          Length = 206

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 70/206 (33%), Positives = 118/206 (57%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +SV N++G++ G + +++ +F ++  + ++   +  Q   KR G  K+K RSEV+  
Sbjct: 1   MANVSVYNMEGKEVGTLELNDAVFGVEVNEHLVHLAVVAQLANKRQGTQKAKTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q++GGG  F P P      L KK +  AL+ AL+ +  +
Sbjct: 61  GRKPWRQKGTGHARQGSTRSPQWKGGGVVFAPTPRDYTIRLNKKEKRAALKSALTSRVQA 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N  +V+D L   E KTK       +L ++ AL++     D+N  L+ARN+ ++    V  
Sbjct: 121 NKFIVVDELKFDEIKTKKFQGVMDSLKVNKALVVLADN-DQNTVLSARNVADVKTAQVDS 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYDIL+ + +V +K+A+ ++E+ +
Sbjct: 180 INVYDILKYNTVVATKAAVASIEEVY 205


>gi|303240970|ref|ZP_07327481.1| ribosomal protein L4/L1e [Acetivibrio cellulolyticus CD2]
 gi|302591556|gb|EFL61293.1| ribosomal protein L4/L1e [Acetivibrio cellulolyticus CD2]
          Length = 207

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 71/206 (34%), Positives = 115/206 (55%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ + +++G+  G I +SE +F +   + ++ + +  Q   KR G   +K +SEV   
Sbjct: 1   MPKVDLYDMNGKVVGDIDLSEAVFGIDVNKEVVHQAVVNQLANKRQGTQSTKTKSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S   +Q+  GG   GP P    + LPKKV+ LAL+  LS K   
Sbjct: 61  GIKPWKQKGTGRARQGSIRSAQWIKGGIVLGPKPRSYRYTLPKKVKRLALKSVLSSKVSE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+I+V+D L   + KTK +    + L +    +I     + N + +A NIP +  L    
Sbjct: 121 NEIIVLDKLNFDKIKTKQMAEVLKNLKIDGTAVILIADKNENVERSANNIPGVKTLLANT 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYDI++ SKL+++K A+  +E+ +
Sbjct: 181 INVYDIVKHSKLIITKDAVSKVEEVY 206


>gi|289579144|ref|YP_003477771.1| ribosomal protein L4/L1e [Thermoanaerobacter italicus Ab9]
 gi|297545328|ref|YP_003677630.1| ribosomal protein L4/L1e [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
 gi|289528857|gb|ADD03209.1| ribosomal protein L4/L1e [Thermoanaerobacter italicus Ab9]
 gi|296843103|gb|ADH61619.1| ribosomal protein L4/L1e [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
          Length = 206

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 70/206 (33%), Positives = 115/206 (55%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +++V N+ GE  G I + + +F +     ++ + +      +R G   +K R EV   
Sbjct: 1   MAKVAVYNVKGEQVGEIELKDSVFGVPVNVPVMHQAVLNYLANQRQGTHSTKTRGEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+  GG  FGP P    + LPKKV+ LAL+ ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRAPQWIKGGVVFGPKPRDYSYKLPKKVKRLALKSALSSKVRD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+I+V+D     + KTK +V   +  ++ +ALI+   + ++N +L+ RNIP +  L    
Sbjct: 121 NEIIVLDEFKLDQPKTKKVVELLKNFNVDSALIVV-PEGEKNVELSTRNIPGVKTLYANY 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +N YD+L+  K +++K A+  +E+ +
Sbjct: 180 LNTYDVLKYDKFIITKDAVGIVEEVY 205


>gi|220903935|ref|YP_002479247.1| ribosomal protein L4/L1e [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|254803730|sp|B8IYH3|RL4_DESDA RecName: Full=50S ribosomal protein L4
 gi|219868234|gb|ACL48569.1| ribosomal protein L4/L1e [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 210

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 117/207 (56%), Gaps = 1/207 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + V + + ++ G ++++ D+F ++ +  IL  V R Q   KR G    K R+ V+  
Sbjct: 1   MATVKVYDQNKQESGEVTLASDVFEIEVRPEILNLVARAQMAAKRAGTHNVKTRAFVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G+K + QKGTGRAR  S     +RGG   FGP P      +  KVRSLAL+ ALS +  +
Sbjct: 61  GAKPWKQKGTGRARAGSNRSPIWRGGAITFGPSPRDYTFKVNSKVRSLALKMALSSRLAA 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             +MV+  +V  E KTK+       L L+ ALI+   + + +   +ARNIP + L  V  
Sbjct: 121 ESLMVVKGIVLPEAKTKHFAKVADTLGLTKALIV-APEENADLTRSARNIPGLTLTTVDR 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRFK 207
           ++V +IL+  +LVL + A+E+++ RF+
Sbjct: 180 LSVLEILKHKQLVLLEGAVESVQARFE 206


>gi|332176632|gb|AEE12322.1| ribosomal protein L4/L1e [Porphyromonas asaccharolytica DSM 20707]
          Length = 207

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 117/213 (54%), Gaps = 14/213 (6%)

Query: 2   IELSVRNLDGEDKG-VISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           +ELS+ N+ GED G  I++   +F ++P    +   ++     +R G  K+K RSE++ +
Sbjct: 1   MELSIYNIQGEDTGRKIALESSVFGIEPNDHAIYLTVKQYRANQRQGTHKTKERSEMSGS 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
             K++ QKGTG AR    + +  RGG + FGP P      L KK+R LA R AL+ K   
Sbjct: 61  TRKLFRQKGTGGARRGDINSNILRGGARVFGPRPRSYSFKLNKKLRQLARRSALTYKAQD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDG-------CQLDRNFQLAARNIPNI 173
           N IMV+D L  +  KTK  V+      ++ AL +DG        Q++    L+ARNIP +
Sbjct: 121 NQIMVLDQLSFEAPKTKSFVS------MAKALNVDGQKTLYVVSQIEDTVALSARNIPGV 174

Query: 174 NLLPVQGINVYDILRCSKLVLSKSAIEALEDRF 206
           +++  Q +N Y +L C K+V ++ A+  + + F
Sbjct: 175 SIVRAQDLNTYCVLDCRKIVFTEDALAQVNEMF 207


>gi|331091666|ref|ZP_08340500.1| 50S ribosomal protein L4 [Lachnospiraceae bacterium 2_1_46FAA]
 gi|330403423|gb|EGG82982.1| 50S ribosomal protein L4 [Lachnospiraceae bacterium 2_1_46FAA]
          Length = 206

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 72/206 (34%), Positives = 113/206 (54%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +SV N++G + G I +++ +F ++  + +L   +  Q   KR G  K+K RSEV+  
Sbjct: 1   MANVSVYNIEGNEVGTIDLNDAVFGVEVNEHLLHMAVVNQLANKRQGTQKAKTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+ GGG  F P P      L KK +  AL+ AL+ +   
Sbjct: 61  GRKPWRQKGTGHARQGSTRSPQWTGGGVVFAPTPRDYSFKLNKKEKRAALKSALTSRVLE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N  +V+D +   E KTK        L++S AL++     +RN +L+ARNI  +       
Sbjct: 121 NKFIVLDEINFGEIKTKNFQNVLNNLNVSKALVVLEDD-NRNAELSARNIAAVKTARTNT 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYDIL+ + +V +K+ +E +E+ +
Sbjct: 180 INVYDILKYNTVVTTKAVVEKIEEVY 205


>gi|225630300|ref|YP_002727091.1| ribosomal protein L4 [Wolbachia sp. wRi]
 gi|254803765|sp|C0R308|RL4_WOLWR RecName: Full=50S ribosomal protein L4
 gi|225592281|gb|ACN95300.1| ribosomal protein L4 [Wolbachia sp. wRi]
          Length = 204

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 119/207 (57%), Gaps = 6/207 (2%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +E ++ NL  ++ G   ++  IF+ K +  IL  ++RWQ  ++R G  K+KG S+V+ T 
Sbjct: 1   MECNLVNLSNDNVGTAQLNPLIFSAKQKLSILHDIVRWQLAKRRAGTHKTKGISDVSGTT 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +K Y QK TGRAR  S    QFRGGG  FGPV     ++L KKVR   L+ ALS K+ +N
Sbjct: 61  AKPYGQKRTGRARQGSLRSPQFRGGGIIFGPVVRSHTYSLNKKVRKFGLKIALSLKYLNN 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIID--GCQLDRNFQLAARNIPNINLLPVQ 179
            ++++DNL     KT  +    +    S+ LI+   G  L R    AA+N+  ++L+   
Sbjct: 121 QVIILDNLNIDVKKTSEMCKCIKNFKFSSFLIVGDYGDDLLR----AAKNLHYVDLIKPI 176

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRF 206
           G+NV+DIL    ++L+K  ++ LE R 
Sbjct: 177 GLNVFDILNHECVMLTKDTLKHLEGRL 203


>gi|258646052|ref|ZP_05733521.1| ribosomal protein L4/L1 family protein [Dialister invisus DSM
           15470]
 gi|260403422|gb|EEW96969.1| ribosomal protein L4/L1 family protein [Dialister invisus DSM
           15470]
          Length = 208

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 115/205 (56%), Gaps = 1/205 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N  G   G I +++ +F ++  + ++ + +  Q   +R+G   +K R  V   
Sbjct: 1   MPKVTLYNTAGAAAGEIELNDSVFGVEYNEAVIHQAVVRQMANERLGTHATKTRGLVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     + GGG  FGP P      + +K R LA++ ALS+K  +
Sbjct: 61  GRKPWKQKGTGRARVGSIRSPLWVGGGTVFGPTPRSHAKDMTRKARQLAVKSALSEKLRA 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSN-ALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
           N+++V+D +     KTK +V    A ++   ALI+DG     N  L+ARNIP +      
Sbjct: 121 NELIVVDAINFDTPKTKEVVKFLAAFNVDGKALIVDGGTASENTVLSARNIPGVKAYAPS 180

Query: 180 GINVYDILRCSKLVLSKSAIEALED 204
           G+N+YDI+  +KL L++ A++ +E+
Sbjct: 181 GLNIYDIVHYTKLFLTQDAVKKIEE 205


>gi|218294755|ref|ZP_03495609.1| ribosomal protein L4/L1e [Thermus aquaticus Y51MC23]
 gi|218244663|gb|EED11187.1| ribosomal protein L4/L1e [Thermus aquaticus Y51MC23]
          Length = 213

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 64/175 (36%), Positives = 97/175 (55%)

Query: 32  ILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGTGRARHSSKSVSQFRGGGKAFG 91
           +L  V+RWQ   +R G + +K R EVAY+G K+Y QK TGRARH       F GGG  FG
Sbjct: 35  LLWEVVRWQLASRRRGTASTKTRGEVAYSGRKIYPQKHTGRARHGDIGAPIFVGGGTVFG 94

Query: 92  PVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNLVSKECKTKYLVTRFRALDLSNA 151
           P P    + LPKKVR   L  A++D+     +++++  +  + KT+  +   + + L  +
Sbjct: 95  PKPRDYSYTLPKKVRKAGLAMAVADRAKEGKLLLVEAFLGVQGKTREFLAWAKEVGLDGS 154

Query: 152 LIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRCSKLVLSKSAIEALEDRF 206
             +     D   + AARN+P +  L  +G+NVYDILR  +LV+   A E  ++R 
Sbjct: 155 ETVLLVTADEAVRRAARNLPWVVTLAPEGLNVYDILRTGRLVMDLKAWEVFQERL 209


>gi|261264933|gb|ACX55825.1| 50S ribosomal protein L4 [Staphylococcus epidermidis]
          Length = 208

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 106/205 (51%), Gaps = 1/205 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M    V  +DG   G + +++ +FA++P   +L   +  Q    R G    K RS V   
Sbjct: 1   MANYDVLKVDGSKSGSVELNDAVFAIEPNNSVLFEAINLQRASLRQGTHAVKNRSAVRGG 60

Query: 61  GSKMYVQKGTG-RARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFC 119
           G K + QKGTG RAR  +    Q+RGGG  FGP P    + +PKK+R LALR ALS K  
Sbjct: 61  GRKPWRQKGTGGRARQGTIRAPQWRGGGVVFGPTPRSYAYKMPKKMRRLALRSALSFKVQ 120

Query: 120 SNDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
            N   ++D    +  KTK        L+    +++     D N +L+ARNIP + +   Q
Sbjct: 121 ENSFTIVDTFGFEAPKTKEFKNVLTTLEQPKKVLVVTENEDVNVELSARNIPGVQVTTAQ 180

Query: 180 GINVYDILRCSKLVLSKSAIEALED 204
           G+NV D+     ++++++A + +E+
Sbjct: 181 GLNVLDLTSADSVIITEAAAKKVEE 205


>gi|217967370|ref|YP_002352876.1| ribosomal protein L4/L1e [Dictyoglomus turgidum DSM 6724]
 gi|217336469|gb|ACK42262.1| ribosomal protein L4/L1e [Dictyoglomus turgidum DSM 6724]
          Length = 209

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 113/207 (54%), Gaps = 1/207 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           MI++ V N   E  G I + E++F ++ +  +    +       R G   +K RSEV  +
Sbjct: 1   MIQVPVYNQKAEKVGEIELKEELFGVERRPDLFYTCVVMHLANGRQGTHSTKRRSEVNRS 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K++ QKGTG AR   +  + + GGG+ FGP P    + +PKK+R LA+R ALS K   
Sbjct: 61  GRKVWPQKGTGHARQGDRKATHWVGGGRPFGPKPRDYSYKIPKKMRRLAIRSALSTKLKE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQL-DRNFQLAARNIPNINLLPVQ 179
           N+++++D +   + KTK LV       L+++ ++ G    D N + AA N+  +  +   
Sbjct: 121 NNLIILDKIELPQPKTKELVNILNNFGLADSKVLIGVPTKDENLKKAAMNLERVKTMIAS 180

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRF 206
            +NVYD+L+   L+L+  AI  LE+ F
Sbjct: 181 VLNVYDLLKYDYLILTVDAIPVLEEAF 207


>gi|42520529|ref|NP_966444.1| 50S ribosomal protein L4 [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|46577161|sp|P61071|RL4_WOLPM RecName: Full=50S ribosomal protein L4
 gi|42410268|gb|AAS14378.1| ribosomal protein L4 [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 204

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 119/207 (57%), Gaps = 6/207 (2%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +E ++ NL  ++ G   ++  IF+ K +  IL  ++RWQ  ++R G  K+KG S+V+ T 
Sbjct: 1   MECNLVNLSNDNVGAAQLNPLIFSAKQKLSILHDIVRWQLAKRRAGTHKTKGISDVSGTT 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +K Y QK TGRAR  S    QFRGGG  FGPV     ++L KKVR   L+ ALS K+ +N
Sbjct: 61  AKPYGQKRTGRARQGSLRSPQFRGGGIIFGPVVRSHTYSLNKKVRKFGLKIALSLKYLNN 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIID--GCQLDRNFQLAARNIPNINLLPVQ 179
            ++++DNL     KT  +    +    S+ LI+   G  L R    AA+N+  ++L+   
Sbjct: 121 QVIILDNLNIDVKKTSEMCKCIKNFKFSSFLIVGDYGDDLLR----AAKNLHYVDLIKPI 176

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRF 206
           G+NV+DIL    ++L+K  ++ LE R 
Sbjct: 177 GLNVFDILNHECVMLTKDTLKHLEGRL 203


>gi|291296990|ref|YP_003508388.1| 50S ribosomal protein L4/L1e [Meiothermus ruber DSM 1279]
 gi|290471949|gb|ADD29368.1| ribosomal protein L4/L1e [Meiothermus ruber DSM 1279]
          Length = 206

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 93/175 (53%), Gaps = 1/175 (0%)

Query: 32  ILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGTGRARHSSKSVSQFRGGGKAFG 91
           +L  V+RWQ   +R G + +K R  V +T  KMY QK TGRARH       F GGG  FG
Sbjct: 25  VLYEVVRWQLASRRRGTAATKTRGMVNFTTKKMYAQKHTGRARHGDYGAPIFVGGGTVFG 84

Query: 92  PVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNLVSKECKTKYLVTRFRALDLSNA 151
           P P    + LPKKVR L L  AL+D+       ++++      KTK  V   +A +L   
Sbjct: 85  PQPRDYSYTLPKKVRKLGLAMALADRAKEGKFFLVEDFKGVNGKTKEFVAWLKAHNLEGP 144

Query: 152 LIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRCSKLVLSKSAIEALEDRF 206
            I+     D     AARN+P + +L  +G+NVYDI+R   LV+  SA E ++ + 
Sbjct: 145 SILL-VTSDEKVARAARNLPKVRVLAPEGLNVYDIMRQEALVMEASAWEGVQAKL 198


>gi|89893218|ref|YP_516705.1| 50S ribosomal protein L4 [Desulfitobacterium hafniense Y51]
 gi|122483925|sp|Q250N1|RL4_DESHY RecName: Full=50S ribosomal protein L4
 gi|89332666|dbj|BAE82261.1| 50S ribosomal protein L4 [Desulfitobacterium hafniense Y51]
          Length = 207

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 112/204 (54%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ V N+ G   G + + E +F ++P   ++ + +  Q   +R G   +  R EV   
Sbjct: 1   MPKVQVVNMQGSPVGELELDEYVFGIEPNTHVMHQAVVGQLASQRRGTHSTLLRGEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     +RGG   FGP P     +LPKKVR LALR ALS K   
Sbjct: 61  GRKPWRQKGTGRARAGSIRSPLWRGGAVLFGPKPRKYGFSLPKKVRRLALRSALSSKVNE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             ++V+++L   E KT+ +V   +AL++S   +I   +     + +ARNI  I    V+G
Sbjct: 121 QKLIVLEDLSLNEAKTREMVKVLQALNVSKKALIVTDEFMETIERSARNIAGIKTTAVEG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +N+YD+L    +V++K+A+   E+
Sbjct: 181 MNIYDLLNSDVIVMTKAAVTKTEE 204


>gi|326792606|ref|YP_004310427.1| ribosomal protein L4/L1e [Clostridium lentocellum DSM 5427]
 gi|326543370|gb|ADZ85229.1| ribosomal protein L4/L1e [Clostridium lentocellum DSM 5427]
          Length = 207

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 74/209 (35%), Positives = 117/209 (55%), Gaps = 6/209 (2%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +++V N+ G   G + +++ IFA++ ++ ++ + +      +R G   +K R+EV   
Sbjct: 1   MAKVAVLNMTGAQVGEVELNDSIFAVEVKEHLVHQAVVAHLANRRQGTQSAKTRAEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVP---IIGVHALPKKVRSLALRHALSDK 117
           G K + QKGTGRAR  S    Q+ GGG AF P P    I V+A   K R LAL+ AL+ +
Sbjct: 61  GRKPWKQKGTGRARQGSIRAVQWVGGGVAFAPKPRNYSIKVNA---KERRLALKSALTSR 117

Query: 118 FCSNDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLP 177
              +  +V+D+L   E KTK +     AL L+ ALI+   +  +N  L+A+NI  I    
Sbjct: 118 VNESKFIVLDSLELAEIKTKAMANVLEALKLNKALIVTEGEASKNVMLSAKNIQGIKTAA 177

Query: 178 VQGINVYDILRCSKLVLSKSAIEALEDRF 206
           V  INVYDIL+    V++K A+  +E+ +
Sbjct: 178 VNNINVYDILKYDTFVVTKDALNKIEEVY 206


>gi|242278659|ref|YP_002990788.1| 50S ribosomal protein L4 [Desulfovibrio salexigens DSM 2638]
 gi|259491552|sp|C6C186|RL4_DESAD RecName: Full=50S ribosomal protein L4
 gi|242121553|gb|ACS79249.1| ribosomal protein L4/L1e [Desulfovibrio salexigens DSM 2638]
          Length = 206

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 75/207 (36%), Positives = 113/207 (54%), Gaps = 1/207 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +++ +   ++ G + ++ ++F +  +  IL  V+R Q   KR G   +K R      
Sbjct: 1   MATITIYDQTKKEVGSMDLAPEVFEVPVKPEILHLVVRSQLAAKRQGTHATKTRGMKRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G+K + QKGTGRAR  S     +RGGG  FGP P      + KKVR LAL+ AL+ +   
Sbjct: 61  GAKPWRQKGTGRARAGSTRSPLWRGGGTTFGPQPRDYSFKVNKKVRRLALKMALTSRLSE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             +MV+ N+   E KTK  V    AL L  AL++     D    L+ARNIP I L+    
Sbjct: 121 EKMMVVKNIDLPEIKTKLFVEVAEALGLEKALVVV-KDADNKLLLSARNIPGIKLITADQ 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRFK 207
           +NVYDIL+  +LV+ ++A + L++R K
Sbjct: 180 LNVYDILKARQLVMLENAAQDLQERLK 206


>gi|189424411|ref|YP_001951588.1| 50S ribosomal protein L4 [Geobacter lovleyi SZ]
 gi|226730669|sp|B3E7T6|RL4_GEOLS RecName: Full=50S ribosomal protein L4
 gi|189420670|gb|ACD95068.1| ribosomal protein L4/L1e [Geobacter lovleyi SZ]
          Length = 206

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 68/203 (33%), Positives = 111/203 (54%), Gaps = 1/203 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +++ N++ E  G +++ E IFA + ++ ++ + L+ Q   +R G  K+K R+EV+  
Sbjct: 1   MPTIALYNMNREKIGEVALDEQIFAAEVKEPLIHQALKVQLANRRAGTVKTKTRAEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR       Q+ GGG  FGP P      + KK R  ALR  LS +  S
Sbjct: 61  GKKPFKQKGTGNARQGCSRAPQYPGGGTVFGPQPKTYNLGINKKARKAALRSLLSMQLKS 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             I V+D +   +  TK      +  DL  +LII   +   N  L++RN+P + LL   G
Sbjct: 121 EKITVLDQIEFAKISTKDFAGFMKKFDLERSLIIT-EEPSTNLALSSRNVPYVKLLKADG 179

Query: 181 INVYDILRCSKLVLSKSAIEALE 203
           +NV+D+L+   +V+++ A+  +E
Sbjct: 180 LNVFDVLKYQNIVMTEGAVRLVE 202


>gi|255530515|ref|YP_003090887.1| 50S ribosomal protein L4/L1e [Pedobacter heparinus DSM 2366]
 gi|255343499|gb|ACU02825.1| ribosomal protein L4/L1e [Pedobacter heparinus DSM 2366]
          Length = 209

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 71/208 (34%), Positives = 117/208 (56%), Gaps = 4/208 (1%)

Query: 2   IELSVRNLDGEDKGV-ISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           +E+ V N+ G++ G  + + E +F + P    +   ++     +R G  KSK R+E+A +
Sbjct: 1   MEVKVLNISGKETGAKVQLPESVFGITPVDHAIYLDVKQYLANQRQGTHKSKQRNEIAGS 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
             K+Y QKGTG AR  S     F GGG+ FGP P      L KK++SLA + ALS K   
Sbjct: 61  TRKLYKQKGTGGARAGSIKSPLFNGGGRVFGPQPRDYSFKLNKKLKSLARKSALSYKAKD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSN--ALIIDGCQLDRNFQLAARNIPNINLLPV 178
           N+++V+++      KTK  +    AL+L+N   L++   Q + N  L++RNI  + ++  
Sbjct: 121 NNVVVLEDFTFDTIKTKNYINLVSALNLTNEKTLLVLPTQ-NNNIYLSSRNIQKVKVITA 179

Query: 179 QGINVYDILRCSKLVLSKSAIEALEDRF 206
             +N YD+L C KL+L+  +++ LE+ F
Sbjct: 180 DQLNTYDVLNCGKLLLTADSVKTLEEAF 207


>gi|219849886|ref|YP_002464319.1| 50S ribosomal protein L4/L1e [Chloroflexus aggregans DSM 9485]
 gi|219544145|gb|ACL25883.1| ribosomal protein L4/L1e [Chloroflexus aggregans DSM 9485]
          Length = 222

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 69/206 (33%), Positives = 114/206 (55%), Gaps = 4/206 (1%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++ ++ N  GE  G I VS+ IF ++P   ++ + +  Q+   R+G   ++GR EV  + 
Sbjct: 1   MQATLYNQAGEQVGSIEVSDYIFGIEPNVPVMHQYVVMQNANARLGTHNTRGRGEVKGST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTGRAR  S      +GGG A GP P     ++P+K+R L +R ALS KF +N
Sbjct: 61  RKLYRQKGTGRARQGSIRAPHHKGGGVAHGPHPRSYRVSMPRKMRRLGVRSALSVKFAAN 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNA---LIIDG-CQLDRNFQLAARNIPNINLLP 177
            I  ID L   + +TK  V   +A  L++    ++ID     + N + +A N+P +  L 
Sbjct: 121 QIRFIDELTFPQPRTKDFVAFLQAHGLADKKTLVVIDSKSPANENLRRSANNLPKVKTLL 180

Query: 178 VQGINVYDILRCSKLVLSKSAIEALE 203
              +NV D+L    +++ K+A++ +E
Sbjct: 181 AHYLNVRDLLVYDHIIMPKAAVQVVE 206


>gi|320165535|gb|EFW42434.1| ribosomal protein L4/L1e [Capsaspora owczarzaki ATCC 30864]
          Length = 542

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 71/192 (36%), Positives = 108/192 (56%), Gaps = 1/192 (0%)

Query: 13  DKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGTGR 72
            + ++S+S+ +F   P+  ++ R + W    +R G + +K ++EV   G K   QK TGR
Sbjct: 234 QRTLMSLSDYVFGAAPRTDLIHRYVLWHLACQRAGTASTKTKAEVRGGGRKPRPQKHTGR 293

Query: 73  ARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNLVSK 132
           AR  S      RGGG AFGP P    + LPK VR  ALR ALS K+   D+ ++D+L   
Sbjct: 294 ARLGSIRSPMMRGGGVAFGPKPKSFAYVLPKTVRRFALRAALSIKYAQGDLQIVDSLSPI 353

Query: 133 ECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRCSKL 192
             K KY+    R+ +L+NAL++D  +   N    A  +  +  + V  ++VYDI++ SKL
Sbjct: 354 VHKAKYVGHILRSNNLTNALLVDE-KASPNLIRGASTMQTVKAVSVDALSVYDIMKYSKL 412

Query: 193 VLSKSAIEALED 204
           VL+  A+ ALED
Sbjct: 413 VLTTKAVAALED 424


>gi|163791667|ref|ZP_02186062.1| 50S ribosomal protein L4 [Carnobacterium sp. AT7]
 gi|159873046|gb|EDP67155.1| 50S ribosomal protein L4 [Carnobacterium sp. AT7]
          Length = 207

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 72/206 (34%), Positives = 114/206 (55%), Gaps = 4/206 (1%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +++   DG   G +++++ IF ++P + ++   +  Q    R G    K RS V   
Sbjct: 1   MPNVALYKQDGTQNGEVTLNDAIFGIEPNENVVFDAIIMQRASLRQGNHSVKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LPKKVR LA++  LS K  S
Sbjct: 61  GRKPWAQKGTGRARQGSIRSPQWRGGGIVFGPTPRSYSYKLPKKVRRLAIKSVLSTKVIS 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDL-SNALIIDGCQLDRNF-QLAARNIPNINLLPV 178
            D++V+D L     KTK      + L++ S A I+   + D +F  L+ARN+P + ++  
Sbjct: 121 GDLIVVDALNFDAPKTKEFAQVLKNLNVDSKAFIV--VENDNDFATLSARNLPGVKVVAF 178

Query: 179 QGINVYDILRCSKLVLSKSAIEALED 204
             + V D++   KL+L+++A+  LE+
Sbjct: 179 DNVTVLDVVAHEKLILTQTALTKLEE 204


>gi|58617355|ref|YP_196554.1| 50S ribosomal protein L4 [Ehrlichia ruminantium str. Gardel]
 gi|75432695|sp|Q5FFU1|RL4_EHRRG RecName: Full=50S ribosomal protein L4
 gi|58416967|emb|CAI28080.1| 50S ribosomal protein L4 [Ehrlichia ruminantium str. Gardel]
          Length = 205

 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 119/205 (58%), Gaps = 1/205 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +E++V N++ ++ G I ++  IF++  +  IL  V+ WQ  ++R+G  K+K   +V+ T 
Sbjct: 1   MEVNVINIESQNIGKIDLNPLIFSVNYRPDILKMVVEWQLSKRRVGAHKTKTIGDVSGTT 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +K Y QK TGRAR  S    QFRGG   FGPV     ++L KKVR+L L+ ALS K   N
Sbjct: 61  AKPYRQKHTGRARQGSLRSPQFRGGAVIFGPVVRSHAYSLNKKVRNLGLKVALSLKNSCN 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++++D++     KT  ++   +  +  + LII G   ++    + +N+ N+ LL   G 
Sbjct: 121 KLLILDSIDVNFVKTAQVLRFIKNFEHQSFLII-GKDYNKGMMYSCKNLHNVTLLKQIGT 179

Query: 182 NVYDILRCSKLVLSKSAIEALEDRF 206
           NV+DILR   ++L+   ++ LEDR 
Sbjct: 180 NVFDILRHDCVILTVDTVKYLEDRL 204


>gi|116493162|ref|YP_804897.1| 50S ribosomal protein L4P [Pediococcus pentosaceus ATCC 25745]
 gi|122265374|sp|Q03EB7|RL4_PEDPA RecName: Full=50S ribosomal protein L4
 gi|116103312|gb|ABJ68455.1| LSU ribosomal protein L4P [Pediococcus pentosaceus ATCC 25745]
          Length = 207

 Score =  122 bits (305), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 109/204 (53%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +S+   DG   G + ++ DIF ++P   ++   +  Q    R G    K RS V   
Sbjct: 1   MANVSLFKQDGTKNGDVELNADIFGIEPNNDVVFEAVVMQRASMRQGTHAVKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    +++PKK+R LAL+  LS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGIVFGPTPRSYAYSIPKKMRRLALKSVLSQKVLD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             ++V+D    +  KTK        L++    ++   + + +  LAARN+ N+ ++  +G
Sbjct: 121 ESLVVVDEFKFETPKTKDFAQSLGNLNVDKKALLVLEEDNESAVLAARNLSNVKIVEPEG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           INV DI+   KLV+++ A+  +E+
Sbjct: 181 INVLDIMNSDKLVITQKALSQVEE 204


>gi|331004122|ref|ZP_08327602.1| 50S ribosomal protein L4 [Lachnospiraceae oral taxon 107 str.
           F0167]
 gi|330411532|gb|EGG90942.1| 50S ribosomal protein L4 [Lachnospiraceae oral taxon 107 str.
           F0167]
          Length = 206

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 69/206 (33%), Positives = 115/206 (55%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +SV N++G++ G I +++ +F +   + ++   +  Q   KR G  K+K RSEV+  
Sbjct: 1   MANISVFNIEGKEVGSIELNDAVFGVNVNEHLVHMAVVAQLANKRQGTQKAKTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q++GGG  F P P      L KK + +AL+ AL+ +   
Sbjct: 61  GRKPWKQKGTGHARQGSTRSPQWKGGGVVFAPTPRDYTINLNKKEKRIALKSALTSRVLE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N  +V+D+    E KTK +      L++  AL++   + ++N  L+ RNI  +     + 
Sbjct: 121 NKFIVVDDFAMSEIKTKKMQQTLNNLNVKKALVV-CAENEKNTVLSVRNIYGVKAASPKT 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYDIL+ + +V SK A++ +E+ +
Sbjct: 180 INVYDILKYNTVVASKDAVKTIEEVY 205


>gi|291166878|gb|EFE28924.1| 50S ribosomal protein L4/L1 [Filifactor alocis ATCC 35896]
          Length = 207

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 113/206 (54%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + V N++GE    + +SE++F  +  + ++ +V++     KR+G   +K R+EV   
Sbjct: 1   MPTVDVLNINGEKVSEMELSENLFGAEINEHVVYQVVKNHLANKRVGTQSAKTRAEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G+K + QKGTGRAR  S    Q++GGG  F P P    + +PKK+R LAL+  L+DK   
Sbjct: 61  GAKPWRQKGTGRARQGSIRSPQWKGGGVVFAPKPRDYSYTVPKKIRRLALKSVLTDKVNE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            +++V+D++   E KT+       AL +    ++           + RNI N+ +  V  
Sbjct: 121 GNLVVVDDINLTEWKTREFAKMLSALKVGKKALVVTKDNSPEVVRSGRNIKNVKIAFVGT 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVYDIL  + LVL+K A+   E+ +
Sbjct: 181 MNVYDILNANTLVLTKDAVAKAEEVY 206


>gi|313884448|ref|ZP_07818209.1| 50S ribosomal protein L4 [Eremococcus coleocola ACS-139-V-Col8]
 gi|312620232|gb|EFR31660.1| 50S ribosomal protein L4 [Eremococcus coleocola ACS-139-V-Col8]
          Length = 205

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 113/204 (55%), Gaps = 2/204 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++   DG + G I +++ IF ++P Q ++   +  Q   +R G    K RS V   
Sbjct: 1   MAKVTLFKQDGSNAGEIELNDAIFGIEPNQSVVVDAVIMQRASQRQGTHAVKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+ GGG  FGP P    + LPKK+R LA+R ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWVGGGTVFGPTPRSYSYKLPKKMRRLAIRSALSQKVID 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+ +V+D L  +  KTK        LDL+  +++     +     AARNIPN+ ++    
Sbjct: 121 NEFVVVDQL--EATKTKEFKAILSNLDLNRKVLLVLEDNNEAVFRAARNIPNVKVIDQGN 178

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV D++   K++++++A+  +E+
Sbjct: 179 VNVLDVVNYDKVLITQAALATVEE 202


>gi|73667227|ref|YP_303243.1| 50S ribosomal protein L4 [Ehrlichia canis str. Jake]
 gi|109893593|sp|Q3YRL0|RL4_EHRCJ RecName: Full=50S ribosomal protein L4
 gi|72394368|gb|AAZ68645.1| LSU ribosomal protein L4P [Ehrlichia canis str. Jake]
          Length = 205

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 117/205 (57%), Gaps = 1/205 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +E+S+ N++ +  G I ++  IF++  +  IL  V+ WQ  ++R G  K+K   +++ T 
Sbjct: 1   MEVSIINVNSDKIGTIDLNPLIFSVDYRPDILKMVVNWQLSKRRAGTHKAKTIGDISGTT 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +K Y QK TGRAR  S    QFRGG   FGPV     ++L KKVR L L+ ALS K   N
Sbjct: 61  AKPYRQKHTGRARQGSLRSPQFRGGAVIFGPVVRNHAYSLNKKVRKLGLKVALSLKNSCN 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++++D++     KT  ++   R  +  + LIID    ++N   + RN+ N+ LL   G 
Sbjct: 121 KLLILDSIDVNFVKTTQVLQFIRNFEHKSFLIIDK-DYNKNVVCSCRNLHNVTLLKQIGT 179

Query: 182 NVYDILRCSKLVLSKSAIEALEDRF 206
           NV DILR   ++L+  A++ LE+R 
Sbjct: 180 NVLDILRHDCIILTVGAVKYLEERL 204


>gi|160914558|ref|ZP_02076773.1| hypothetical protein EUBDOL_00564 [Eubacterium dolichum DSM 3991]
 gi|158433716|gb|EDP12005.1| hypothetical protein EUBDOL_00564 [Eubacterium dolichum DSM 3991]
          Length = 209

 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 117/207 (56%), Gaps = 4/207 (1%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ V + +G++   I++++ +F ++P Q  +   +  Q    R G   +K R+EV+  
Sbjct: 1   MPKMVVLSQNGKELKEITLADSVFGIEPNQQCIFDAIVMQRASVRQGTHDTKNRTEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S   +Q+RGGG  FGP P    + L KKVR LAL+  LS+K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRATQWRGGGIVFGPTPRSYSYKLNKKVRRLALKSVLSEKVLE 120

Query: 121 NDIMVIDNLVSKECKTK---YLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLP 177
           N + V+D     E KTK    ++    A   +  ++ +    +  F L+ RNIP + +L 
Sbjct: 121 NAMSVVDKFELAEPKTKAFNQIIADINAPKKTLFVVSENEDFENAF-LSMRNIPTMMMLT 179

Query: 178 VQGINVYDILRCSKLVLSKSAIEALED 204
             GINVYDI+  +K+V +++A++ +E+
Sbjct: 180 ADGINVYDIVNANKIVFTEAAVKDVEE 206


>gi|190571547|ref|YP_001975905.1| ribosomal protein L4 [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213018949|ref|ZP_03334756.1| ribosomal protein L4 [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|226731443|sp|B3CN27|RL4_WOLPP RecName: Full=50S ribosomal protein L4
 gi|190357819|emb|CAQ55275.1| ribosomal protein L4 [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212995058|gb|EEB55699.1| ribosomal protein L4 [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 204

 Score =  121 bits (304), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 76/207 (36%), Positives = 119/207 (57%), Gaps = 6/207 (2%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +E  + +L   + G + ++  IF+ K +  IL  ++RWQ  ++R+G  K+KG S+V+ T 
Sbjct: 1   MECELVDLSNNNVGSVELNPLIFSAKQKLSILHDIVRWQLAKRRVGAHKTKGISDVSGTT 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +K Y QK TGRAR  S    QFRGGG  FGPV     ++L KKVR   L+ ALS K+ +N
Sbjct: 61  AKPYGQKRTGRARQGSLRSPQFRGGGIIFGPVVRSHAYSLNKKVRKFGLKIALSLKYLNN 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIID--GCQLDRNFQLAARNIPNINLLPVQ 179
            ++V+D+L     KT  +    +    S+ LI+   G  L R    AA+N+  ++L+   
Sbjct: 121 QVVVLDSLNVDVKKTSKMCEYIKNFKFSSFLIVGDYGDDLLR----AAKNLHYVDLIKPI 176

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRF 206
           G+NV+DIL    ++L+K  ++ LE R 
Sbjct: 177 GLNVFDILNHECVMLTKDTLKHLEGRL 203


>gi|281206127|gb|EFA80316.1| hypothetical protein PPL_07147 [Polysphondylium pallidum PN500]
          Length = 318

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 112/195 (57%), Gaps = 2/195 (1%)

Query: 12  EDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGTG 71
           E+ G I + + IF++  +  IL R++RWQ  +   G   ++   ++  T  K + QKGTG
Sbjct: 120 ENVGEIQLLKSIFSVPLRVDILHRIVRWQRAKAMQGTHYAQNMGDIDRTNKKPFSQKGTG 179

Query: 72  RARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNLVS 131
           RAR  +    Q +GG +AF P P     +LPKKVR L L+ AL+ K   N +++++NL  
Sbjct: 180 RARQGTNHAIQMKGGARAFPPKPRDHSFSLPKKVRRLGLKVALATKLAQNKLVIVENLEL 239

Query: 132 KECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRCSK 191
           +  KTK L T         +L++D  ++  N  LA  NI  I+LLP +G+NVY IL+   
Sbjct: 240 ESHKTKDLDTLLPE-QWGRSLLVDK-EISSNLSLAGFNIKRIDLLPERGLNVYSILQKDT 297

Query: 192 LVLSKSAIEALEDRF 206
           LVL++++++ ++ R 
Sbjct: 298 LVLTRASLDEIQKRL 312


>gi|220928208|ref|YP_002505117.1| 50S ribosomal protein L4 [Clostridium cellulolyticum H10]
 gi|254803726|sp|B8I7Y0|RL4_CLOCE RecName: Full=50S ribosomal protein L4
 gi|219998536|gb|ACL75137.1| ribosomal protein L4/L1e [Clostridium cellulolyticum H10]
          Length = 207

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 76/208 (36%), Positives = 114/208 (54%), Gaps = 4/208 (1%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ + N+ GE  G I +S+++F     +  L  V+  Q   +R G   +K +SEV   
Sbjct: 1   MPKVDLYNMKGEVVGDIQLSDNVFGTDVNKDALHAVVVNQLANRRQGTQSTKTKSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S   +Q+  GG   GP P    + LPKKV+ +A++ AL+ K   
Sbjct: 61  GKKPWRQKGTGRARQGSIRSAQWVKGGIVLGPKPRSYRYTLPKKVKRIAMKSALTSKVSG 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRAL--DLSNALIIDGCQLDRNFQLAARNIPNINLLPV 178
           N+I V+D L     KTK +V     L  D S  L+ID    + N   +ARNIP I    V
Sbjct: 121 NEIFVLDALALDAIKTKSMVGVLNNLKVDSSALLVIDSK--NENIVKSARNIPGIKTAYV 178

Query: 179 QGINVYDILRCSKLVLSKSAIEALEDRF 206
             +NV+DIL+  K +++K A+E +E+ +
Sbjct: 179 NTLNVFDILKYDKFIITKDAVEKVEEVY 206


>gi|78043328|ref|YP_361117.1| 50S ribosomal protein L4 [Carboxydothermus hydrogenoformans Z-2901]
 gi|109893583|sp|Q3A9R7|RL4_CARHZ RecName: Full=50S ribosomal protein L4
 gi|77995443|gb|ABB14342.1| ribosomal protein L4 [Carboxydothermus hydrogenoformans Z-2901]
          Length = 206

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 69/206 (33%), Positives = 112/206 (54%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ V N++G   G I + ++IF     + +L  V       +R G   +K R EV+  
Sbjct: 1   MPKVPVYNMEGAQVGEIELKDEIFGAPVNKAVLYEVSLMYLANQRRGTHDTKTRGEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRARH S     +R GG  FGP P    +++PKKVR  AL+ ALSDK   
Sbjct: 61  GRKPWRQKGTGRARHGSIRSPLWRKGGIVFGPHPRDYSYSVPKKVRRAALKSALSDKVNE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+++V+D+L     KTK ++     L ++   +I     D   + +ARNIP ++++    
Sbjct: 121 NNLIVVDSLTFAAPKTKEMIRVLNNLKVNGKTLIVTAGYDEIVEKSARNIPGVSVMTAPS 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +N   +L   KL++++ A+  +E+ F
Sbjct: 181 LNALSLLNHDKLIMTRDAVLKVEEVF 206


>gi|296449798|ref|ZP_06891567.1| ribosomal protein L4/L1 family protein [Clostridium difficile
           NAP08]
 gi|296877862|ref|ZP_06901884.1| ribosomal protein L4/L1 family protein [Clostridium difficile
           NAP07]
 gi|296261396|gb|EFH08222.1| ribosomal protein L4/L1 family protein [Clostridium difficile
           NAP08]
 gi|296431162|gb|EFH16987.1| ribosomal protein L4/L1 family protein [Clostridium difficile
           NAP07]
          Length = 217

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 71/206 (34%), Positives = 114/206 (55%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +L+V N+ G++ G I +S+ IF ++    +L  V++ Q   KR G   +K R+EV   
Sbjct: 11  MPKLNVLNVSGQNVGEIELSDSIFGVEVNGHVLYEVVKNQLANKRQGTQSAKTRAEVRGG 70

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+ GGG AF P P    + LPKKVR LA++ ALS K  +
Sbjct: 71  GRKPWKQKGTGRARQGSTRSVQWVGGGVAFAPKPRSYKYTLPKKVRRLAMKSALSSKVQN 130

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           ++++V+D L     KTK        ++ +   ++     + N   +ARNI  +    V  
Sbjct: 131 SEVIVLDALNMDAPKTKEFAQILNNINAAKKALVVIADKNDNIIKSARNIEGVQTALVNT 190

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVYDIL+    +++  A++ +E+ +
Sbjct: 191 MNVYDILKYDSFIITTDAVKKVEEVY 216


>gi|255654163|ref|ZP_05399572.1| 50S ribosomal protein L4 [Clostridium difficile QCD-23m63]
          Length = 207

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 71/206 (34%), Positives = 114/206 (55%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +L+V N+ G++ G I +S+ IF ++    +L  V++ Q   KR G   +K R+EV   
Sbjct: 1   MPKLNVLNVSGQNVGEIELSDSIFGVEVNGHVLYEVVKNQLANKRQGTQSAKTRAEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+ GGG AF P P    + LPKKVR LA++ ALS K  +
Sbjct: 61  GRKPWKQKGTGRARQGSTRSVQWVGGGVAFAPKPRSYKYTLPKKVRRLAMKSALSSKVQN 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           ++++V+D L     KTK        ++ +   ++     + N   +ARNI  +    V  
Sbjct: 121 SEVIVLDALNMDAPKTKEFAQILNNINAAKKALVVIADKNDNIIKSARNIEGVQTALVNT 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVYDIL+    +++  A++ +E+ +
Sbjct: 181 MNVYDILKYDSFIITTDAVKKVEEVY 206


>gi|110800870|ref|YP_697093.1| 50S ribosomal protein L4 [Clostridium perfringens ATCC 13124]
 gi|168211904|ref|ZP_02637529.1| ribosomal protein L4 [Clostridium perfringens B str. ATCC 3626]
 gi|168215177|ref|ZP_02640802.1| ribosomal protein L4 [Clostridium perfringens CPE str. F4969]
 gi|168216632|ref|ZP_02642257.1| ribosomal protein L4 [Clostridium perfringens NCTC 8239]
 gi|169347046|ref|ZP_02865988.1| ribosomal protein L4 [Clostridium perfringens C str. JGS1495]
 gi|182626931|ref|ZP_02954664.1| ribosomal protein L4 [Clostridium perfringens D str. JGS1721]
 gi|123148513|sp|Q0TMP7|RL4_CLOP1 RecName: Full=50S ribosomal protein L4
 gi|110675517|gb|ABG84504.1| 50S ribosomal protein L4 [Clostridium perfringens ATCC 13124]
 gi|169296729|gb|EDS78858.1| ribosomal protein L4 [Clostridium perfringens C str. JGS1495]
 gi|170710168|gb|EDT22350.1| ribosomal protein L4 [Clostridium perfringens B str. ATCC 3626]
 gi|170713383|gb|EDT25565.1| ribosomal protein L4 [Clostridium perfringens CPE str. F4969]
 gi|177907721|gb|EDT70336.1| ribosomal protein L4 [Clostridium perfringens D str. JGS1721]
 gi|182381262|gb|EDT78741.1| ribosomal protein L4 [Clostridium perfringens NCTC 8239]
          Length = 204

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 71/206 (34%), Positives = 115/206 (55%), Gaps = 3/206 (1%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ + N +G+  G I ++E +F ++  +  L +V+  Q   KR G   +K RSEV   
Sbjct: 1   MPKVGLFNKEGQQVGDIQLNEQVFGVEVNKYALHQVVVAQLANKRQGTQSAKTRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+  GG  F P P     ++PK +R +A+  AL+ K   
Sbjct: 61  GIKPWRQKGTGRARQGSIRAPQWIKGGVVFAPKPRDYRMSIPKSMRKVAMTSALTSKVA- 119

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            D++V+++L  +  KTK  V    A +    LII   +++ N   +ARNI  + ++PV  
Sbjct: 120 -DMVVLEDLTFEAPKTKEAVKMLNAFEAKKTLIIT-AEVNENVYKSARNIEGVTVMPVNN 177

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYD+L C  L+++K A+  +E+ +
Sbjct: 178 INVYDLLNCKTLMITKEAVNKIEEVY 203


>gi|293402502|ref|ZP_06646637.1| ribosomal protein L4/L1 family protein [Erysipelotrichaceae
           bacterium 5_2_54FAA]
 gi|291304016|gb|EFE45270.1| ribosomal protein L4/L1 family protein [Erysipelotrichaceae
           bacterium 5_2_54FAA]
          Length = 209

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 70/207 (33%), Positives = 117/207 (56%), Gaps = 4/207 (1%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ V +  G++   I++++ +F ++P Q  +   +  Q    R G   +K R+EV   
Sbjct: 1   MPKMVVLSQAGKELHEITLADTVFGIEPNQQCIFDAIVMQRASMRQGTHDTKNRTEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S   +Q+RGGG  FGP P    + L KKVR LAL+  LS+K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRATQWRGGGTVFGPTPRSYAYKLNKKVRRLALKSVLSEKVAE 120

Query: 121 NDIMVIDNLVSKECKTKY---LVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLP 177
           N + V+D    +  KTK    ++    A   +  ++ +G   +  F L+ RNIP++ +L 
Sbjct: 121 NAMSVVDKFELEAPKTKAFNEIIANLNAPRKTLFVVSEGEDFENAF-LSMRNIPSMMMLT 179

Query: 178 VQGINVYDILRCSKLVLSKSAIEALED 204
             G+NVYDI+  +K+V +++A++ +E+
Sbjct: 180 ADGLNVYDIVNANKIVFTEAAVKDVEE 206


>gi|317485821|ref|ZP_07944685.1| ribosomal protein L4/L1 family protein [Bilophila wadsworthia
           3_1_6]
 gi|316922927|gb|EFV44149.1| ribosomal protein L4/L1 family protein [Bilophila wadsworthia
           3_1_6]
          Length = 206

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 76/207 (36%), Positives = 114/207 (55%), Gaps = 1/207 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + V + D  ++G ++++ ++F +  +  IL  V+R Q   KR G   +K R+ V+  
Sbjct: 1   MAVVKVYDQDKTEQGELTLTPEVFEVAVRPEILHLVVRAQLAAKRAGTHSTKTRAMVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     +RGG   FGP P      + KK+R LALR ALS +   
Sbjct: 61  GVKPWRQKGTGRARAGSNRSPVWRGGAILFGPQPRKYDFKVNKKIRKLALRMALSSRLAG 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           ++++V+      E KTK        L LS ALII   +  RN  L++RN+P I L     
Sbjct: 121 DNLLVVKGFDLPEAKTKVFAKIAGNLGLSKALII-APEESRNLVLSSRNLPGITLTTPDQ 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRFK 207
           ++VY+IL+  +LVL + A+E +E R K
Sbjct: 180 LSVYEILKHKQLVLLEGAVEPVETRLK 206


>gi|239636232|ref|ZP_04677236.1| ribosomal protein L4/L1 family protein [Staphylococcus warneri
           L37603]
 gi|239598248|gb|EEQ80741.1| ribosomal protein L4/L1 family protein [Staphylococcus warneri
           L37603]
 gi|330685172|gb|EGG96836.1| 50S ribosomal protein L4 [Staphylococcus epidermidis VCU121]
          Length = 207

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 105/204 (51%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M    V  +DG   G + +S+ +FA++P   +L   +  Q    R G    K RS V   
Sbjct: 1   MANYDVLKVDGSKSGSVELSDAVFAIEPNNSVLFEAINLQRASLRQGTHSVKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  +    Q+RGGG  FGP P    + +PKK+R LALR ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGTIRAPQWRGGGVVFGPTPRSYGYKMPKKMRRLALRSALSFKVKE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N   V+D       KTK        L+    +++     D N +L+ARNIP + +   QG
Sbjct: 121 NGFTVVDAFGFDAPKTKEFKNVLTTLEQPKKVLVVVENEDVNVELSARNIPGVQVTTAQG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV DI     +V++++A + +E+
Sbjct: 181 LNVLDITSADSVVITEAAAKKVEE 204


>gi|254973732|ref|ZP_05270204.1| 50S ribosomal protein L4 [Clostridium difficile QCD-66c26]
 gi|255091121|ref|ZP_05320599.1| 50S ribosomal protein L4 [Clostridium difficile CIP 107932]
 gi|255099233|ref|ZP_05328210.1| 50S ribosomal protein L4 [Clostridium difficile QCD-63q42]
 gi|255305016|ref|ZP_05349188.1| 50S ribosomal protein L4 [Clostridium difficile ATCC 43255]
 gi|255312776|ref|ZP_05354359.1| 50S ribosomal protein L4 [Clostridium difficile QCD-76w55]
 gi|255515535|ref|ZP_05383211.1| 50S ribosomal protein L4 [Clostridium difficile QCD-97b34]
 gi|255648630|ref|ZP_05395532.1| 50S ribosomal protein L4 [Clostridium difficile QCD-37x79]
 gi|306518753|ref|ZP_07405100.1| 50S ribosomal protein L4 [Clostridium difficile QCD-32g58]
 gi|328887509|emb|CAJ66889.2| 50S ribosomal protein L4 [Clostridium difficile]
          Length = 207

 Score =  121 bits (304), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 71/206 (34%), Positives = 114/206 (55%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +L+V N+ G++ G I +S+ IF ++    +L  V++ Q   KR G   +K R+EV   
Sbjct: 1   MPKLNVLNVSGQNVGEIELSDSIFGVEVNGHVLYEVVKNQLANKRQGTQSAKTRAEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+ GGG AF P P    + LPKKVR LA++ ALS K  +
Sbjct: 61  GRKPWKQKGTGRARQGSTRSVQWVGGGVAFAPKPRSYKYTLPKKVRRLAMKSALSSKVQN 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           ++++V+D L     KTK        ++ +   ++     + N   +ARNI  +    V  
Sbjct: 121 SEVIVLDALNMDAPKTKEFAQILNNINAAKKALVVIADKNDNVIKSARNIEGVQTALVNT 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVYDIL+    +++  A++ +E+ +
Sbjct: 181 MNVYDILKYDSFIITTDAVKKVEEVY 206


>gi|291549415|emb|CBL25677.1| LSU ribosomal protein L4P [Ruminococcus torques L2-14]
          Length = 206

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 68/208 (32%), Positives = 118/208 (56%), Gaps = 5/208 (2%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++SV N++G++   I +++ +F ++  + ++   +  Q    R G  K+K RSEV+  
Sbjct: 1   MAKVSVYNIEGKEVDTIELNDAVFGVEVNEHLVHMAVVNQLANNRQGTQKAKTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+ GGG  F PVP      + KK +  AL+ AL+ +   
Sbjct: 61  GRKPWRQKGTGHARQGSTRSPQWTGGGVVFAPVPRDYSFKMNKKEKRAALKSALTSRVEE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALII--DGCQLDRNFQLAARNIPNINLLPV 178
           N  +V+D L   E KTK        L+++ AL++  DG   ++N +++A+NIP++     
Sbjct: 121 NKFIVVDELNFDEIKTKKFQAVLNNLNVNKALVVLEDG---NKNVEISAKNIPDVKTAHT 177

Query: 179 QGINVYDILRCSKLVLSKSAIEALEDRF 206
             INVYDIL+ + ++ +K+ + A+E+ +
Sbjct: 178 NTINVYDILKYNTVIATKAVVAAIEEVY 205


>gi|237736171|ref|ZP_04566652.1| LSU ribosomal protein L1E [Fusobacterium mortiferum ATCC 9817]
 gi|229421724|gb|EEO36771.1| LSU ribosomal protein L1E [Fusobacterium mortiferum ATCC 9817]
          Length = 210

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 73/208 (35%), Positives = 114/208 (54%), Gaps = 5/208 (2%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  L++ NL G   G + V + +F ++P Q +L  VL  +    R G + +K R+ V   
Sbjct: 1   MAVLNIYNLTGTQTGTVEVKDTVFGIEPNQAVLHEVLTAELAAARQGTAATKTRAMVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S       GGG  FGP P      + KKVR+LALR ALS K  +
Sbjct: 61  GRKPFKQKGTGRARQGSIRAPHMVGGGVTFGPQPRSYEKKVNKKVRNLALRSALSAKVAN 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNA---LIIDGCQL-DRNFQLAARNIPNINLL 176
            D++V+D  + +  KTK +V    A++ +N    ++ D  ++ D N  L+ RN+ N  +L
Sbjct: 121 GDVLVLDGTI-ETPKTKTIVALTNAINATNKQLFVVNDLAEMNDYNLYLSVRNLENAVVL 179

Query: 177 PVQGINVYDILRCSKLVLSKSAIEALED 204
               I VY +L+  K++++K A+  +E+
Sbjct: 180 QPNEIGVYWLLKQEKVIITKEALTTIEE 207


>gi|126697641|ref|YP_001086538.1| 50S ribosomal protein L4 [Clostridium difficile 630]
 gi|260681847|ref|YP_003213132.1| 50S ribosomal protein L4 [Clostridium difficile CD196]
 gi|260685445|ref|YP_003216578.1| 50S ribosomal protein L4 [Clostridium difficile R20291]
 gi|260208010|emb|CBA60188.1| 50S ribosomal protein L4 [Clostridium difficile CD196]
 gi|260211461|emb|CBE01581.1| 50S ribosomal protein L4 [Clostridium difficile R20291]
          Length = 217

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 71/206 (34%), Positives = 114/206 (55%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +L+V N+ G++ G I +S+ IF ++    +L  V++ Q   KR G   +K R+EV   
Sbjct: 11  MPKLNVLNVSGQNVGEIELSDSIFGVEVNGHVLYEVVKNQLANKRQGTQSAKTRAEVRGG 70

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+ GGG AF P P    + LPKKVR LA++ ALS K  +
Sbjct: 71  GRKPWKQKGTGRARQGSTRSVQWVGGGVAFAPKPRSYKYTLPKKVRRLAMKSALSSKVQN 130

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           ++++V+D L     KTK        ++ +   ++     + N   +ARNI  +    V  
Sbjct: 131 SEVIVLDALNMDAPKTKEFAQILNNINAAKKALVVIADKNDNVIKSARNIEGVQTALVNT 190

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVYDIL+    +++  A++ +E+ +
Sbjct: 191 MNVYDILKYDSFIITTDAVKKVEEVY 216


>gi|320451299|ref|YP_004203395.1| 50S ribosomal protein L4/L1 family [Thermus scotoductus SA-01]
 gi|320151468|gb|ADW22846.1| 50S ribosomal protein L4/L1 family [Thermus scotoductus SA-01]
          Length = 205

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 67/178 (37%), Positives = 99/178 (55%), Gaps = 6/178 (3%)

Query: 32  ILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGTGRARHSSKSVSQFRGGGKAFG 91
           +L  V+RWQ  ++R G + +K R EVAY+  K+Y QK TGRARH       F GGG  FG
Sbjct: 27  LLWEVVRWQLAKRRRGTASTKTRGEVAYSSRKIYPQKHTGRARHGDIGAPIFVGGGTVFG 86

Query: 92  PVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNLVSKECKTKYLVTRFRALDLSNA 151
           P P    + LPKKVR   L  A++D+     ++++++      KTK  +   +   L  +
Sbjct: 87  PKPRDYSYTLPKKVRQAGLAMAVADRAKEGKLLLVEDFAGVNGKTKEFLAWAKGAGLDGS 146

Query: 152 ---LIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRCSKLVLSKSAIEALEDRF 206
              L++   +L R    AARN+P +  L  +G+NVYDILR  +LV+  +A EA + R 
Sbjct: 147 ESVLLVTASELVRR---AARNLPWVVTLAPEGLNVYDILRTERLVMDLAAWEAFQARM 201


>gi|328958727|ref|YP_004376113.1| 50S ribosomal protein L4 [Carnobacterium sp. 17-4]
 gi|328675051|gb|AEB31097.1| 50S ribosomal protein L4 [Carnobacterium sp. 17-4]
          Length = 207

 Score =  121 bits (304), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 71/206 (34%), Positives = 113/206 (54%), Gaps = 4/206 (1%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +++   DG   G +++++ IF ++P + ++   +  Q    R G    K RS V   
Sbjct: 1   MPNVALYKQDGTQNGEVTLNDAIFGIEPNENVVFDAIIMQRASLRQGNHSVKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LPKKVR LA++  LS K  S
Sbjct: 61  GRKPWAQKGTGRARQGSIRSPQWRGGGIVFGPTPRSYSYKLPKKVRRLAIKSVLSTKVVS 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDL-SNALIIDGCQLDRNF-QLAARNIPNINLLPV 178
            D++V+D L     KTK      + L++ S A I+   + D +F  L+ARN+P + ++  
Sbjct: 121 GDLIVVDALNFDAPKTKEFAQVLKNLNVDSKAFIV--VENDNDFATLSARNLPGVKVVAF 178

Query: 179 QGINVYDILRCSKLVLSKSAIEALED 204
             + V D++   KL+ +++A+  LE+
Sbjct: 179 DNVTVLDVVAHEKLIFTQTALTKLEE 204


>gi|291544461|emb|CBL17570.1| LSU ribosomal protein L4P [Ruminococcus sp. 18P13]
          Length = 207

 Score =  121 bits (303), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 114/207 (55%), Gaps = 2/207 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGIL-ARVLRWQSWRKRIGCSKSKGRSEVAY 59
           M ++SV ++ G       +S+ +F + P + ++ A V+ + +  +R G   +  R+EV+ 
Sbjct: 1   MAKVSVFDMTGNQVSETELSDAVFGITPNEAVMHAMVVNYLA-NQRQGTQSTLTRTEVSG 59

Query: 60  TGSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFC 119
            G K + QKGTG AR  S    Q+  GG A GP P    +AL KKVR LA++ ALS K  
Sbjct: 60  GGRKPWRQKGTGHARQGSIRAPQWYHGGVALGPKPRDYRYALNKKVRRLAMKSALSSKVL 119

Query: 120 SNDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
            N+I+V+D L     KTK +V   +AL++    +I   + D+    +A NIP +    V 
Sbjct: 120 ENNIIVLDALTVDSYKTKTIVAMLKALNVEGKALIVTAEADKKVIKSAANIPGVKTAAVN 179

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRF 206
            +NVYDIL   K ++ K+A+  +E+ +
Sbjct: 180 TLNVYDILNYDKFIVVKNAVGQIEEVY 206


>gi|225387236|ref|ZP_03757000.1| hypothetical protein CLOSTASPAR_00988 [Clostridium asparagiforme
           DSM 15981]
 gi|225046654|gb|EEG56900.1| hypothetical protein CLOSTASPAR_00988 [Clostridium asparagiforme
           DSM 15981]
          Length = 206

 Score =  121 bits (303), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 71/206 (34%), Positives = 115/206 (55%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +SV N++G++ G + +++ +F ++  + ++   +  Q   KR G  K+K RSEV+  
Sbjct: 1   MANVSVYNMEGKEVGSMELNDAVFGVEVNEHLVHLAVVAQLANKRQGTQKAKTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q++GGG  F PVP      L KK +  AL+ AL+ +   
Sbjct: 61  GRKPWRQKGTGHARQGSTRSPQWKGGGVVFAPVPRDYTITLNKKEKRAALKSALTSRVQG 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
              +V+D L   E KTK        L ++ AL++     D+N  L+ARNI ++    V  
Sbjct: 121 GKFIVVDELKFDEIKTKKFQNVMDNLKVNKALVVLADN-DQNAVLSARNIADVKTTQVNT 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVYDIL+ S +V +K+A+  +E+ +
Sbjct: 180 MNVYDILKYSTVVATKAAVATIEEVY 205


>gi|195952644|ref|YP_002120934.1| 50S ribosomal protein L4 [Hydrogenobaculum sp. Y04AAS1]
 gi|226730675|sp|B4U745|RL4_HYDS0 RecName: Full=50S ribosomal protein L4
 gi|195932256|gb|ACG56956.1| ribosomal protein L4/L1e [Hydrogenobaculum sp. Y04AAS1]
          Length = 200

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 69/196 (35%), Positives = 114/196 (58%), Gaps = 11/196 (5%)

Query: 17  ISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGTGRARHS 76
           + + +D+F ++P++ IL  V+RWQ  ++R G   +K R+EV  +  K+  QKGTG ARH 
Sbjct: 6   VELRDDVFNVEPKKHILWDVVRWQLAKRRQGTHSTKTRAEVNCSKKKIMPQKGTGNARHG 65

Query: 77  SKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNLVSK---- 132
           ++S + F GGG   GP P    + L KK R +AL  ALS K  +N + V+++L+S     
Sbjct: 66  ARSANIFVGGGVVHGPTPRDYEYKLSKKYRKIALAMALSTKAKNNSVYVLESLLSSLGKP 125

Query: 133 ECKTKYLVTRFRALDLSNALIIDGCQLD---RNFQLAARNIPNINLLPVQGINVYDILRC 189
           + K  + + + + +     L++   Q D   ++F    +NIPN  +LPV G+NVYDIL  
Sbjct: 126 KTKVAFELLKEKGISDKKVLVVTKDQNDIVSKSF----KNIPNTKVLPVVGLNVYDILWA 181

Query: 190 SKLVLSKSAIEALEDR 205
             L++ + A+E + +R
Sbjct: 182 DALLIEQGALEKIYER 197


>gi|119508437|ref|NP_075656.2| 39S ribosomal protein L4, mitochondrial [Mus musculus]
 gi|81881827|sp|Q9DCU6|RM04_MOUSE RecName: Full=39S ribosomal protein L4, mitochondrial; Short=L4mt;
           Short=MRP-L4
 gi|12832465|dbj|BAB22118.1| unnamed protein product [Mus musculus]
 gi|13559359|dbj|BAB40839.1| mitochondrial ribosomal protein L4 (L4mt) [Mus musculus]
 gi|37572295|gb|AAH39983.2| Mitochondrial ribosomal protein L4 [Mus musculus]
 gi|38511681|gb|AAH61095.1| Mitochondrial ribosomal protein L4 [Mus musculus]
 gi|148693202|gb|EDL25149.1| mitochondrial ribosomal protein L4, isoform CRA_c [Mus musculus]
          Length = 294

 Score =  121 bits (303), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 72/207 (34%), Positives = 117/207 (56%), Gaps = 6/207 (2%)

Query: 5   SVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKM 64
           S+R  + E  G+  +  D+FA  P+  I+ +V  WQ   +RI  + +K R+EV+  G K 
Sbjct: 68  SLRGFEQERIGLAELHPDVFATAPRLDIVHQVAIWQRNFRRISYANTKTRAEVSGGGRKP 127

Query: 65  YVQKGTGRARHSSKSVSQFRGGGKAFGPV-PIIGVHALPKKVRSLALRHALSDKFCSNDI 123
           + QKG+GRARH S     +RGGG A GP  P    + LP KVR+L L+ AL+ K   +D+
Sbjct: 128 WQQKGSGRARHGSIRSPLWRGGGVAHGPRGPTSYYYMLPMKVRALGLKVALTVKLMQDDL 187

Query: 124 MVIDNLVSKECKTKYL--VTRFRALDLSNALIIDGC--QLDRNFQLAARNIPNINLLPVQ 179
            ++D+L       +YL  + ++R    S+ L++D    ++ +N   A   + + NL+P  
Sbjct: 188 HIVDSLELPTADPQYLTELAQYRHWG-SSVLLVDLTHEEMPKNVVAATSGLNSFNLIPAV 246

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRF 206
           G+NVY +L+   LVL+  ++  LED+ 
Sbjct: 247 GLNVYSMLKHQTLVLTLPSVAFLEDKL 273


>gi|116334268|ref|YP_795795.1| 50S ribosomal protein L4 [Lactobacillus brevis ATCC 367]
 gi|122269050|sp|Q03PV8|RL4_LACBA RecName: Full=50S ribosomal protein L4
 gi|116099615|gb|ABJ64764.1| LSU ribosomal protein L4P [Lactobacillus brevis ATCC 367]
          Length = 207

 Score =  120 bits (302), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 105/204 (51%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +++   DG   G + ++ DIF ++P + ++   +  Q    R G    K RS V   
Sbjct: 1   MTSVALYKQDGSQNGNVELNADIFGVEPNENVVFDTILMQRASLRQGTHAVKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+ GGG  FGP P    + LPKKV  LAL+  LS K   
Sbjct: 61  GKKPWRQKGTGRARQGSIRSPQWVGGGVVFGPTPRSYSYRLPKKVSRLALKSVLSQKVLD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
              +V+D L     KTK        L+++   ++     +    LAARN+ N+ ++P +G
Sbjct: 121 ESFVVVDGLAFDAPKTKEFAAVLAGLNVTTKTLVVLEDDNVTAALAARNLTNVKVIPAKG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV DI    KLV+++ A+  +E+
Sbjct: 181 LNVLDIADADKLVITQPALSQVEE 204


>gi|326203895|ref|ZP_08193757.1| ribosomal protein L4/L1e [Clostridium papyrosolvens DSM 2782]
 gi|325985993|gb|EGD46827.1| ribosomal protein L4/L1e [Clostridium papyrosolvens DSM 2782]
          Length = 207

 Score =  120 bits (302), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 74/207 (35%), Positives = 117/207 (56%), Gaps = 2/207 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ + N+ GE  G I + +++F  +    +L  V+  Q   KR G   +K +SEV   
Sbjct: 1   MPKVDLYNMKGEVVGDIQLCDNVFGAEVNNEVLHAVVVNQLANKRQGTQSTKTKSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S   +Q+  GG   GP P    + +PKKV+ +A++ AL+ K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSAQWIKGGIVLGPKPRSYRYTMPKKVKRIAMKSALTSKVSG 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDL-SNALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
           N+I V+D L  +  KTK +V     L + S+ALI+   + + N   +ARNIP I    V 
Sbjct: 121 NEIFVLDALTLEAIKTKSMVGVLSNLKVDSSALIVIDSK-NENIVKSARNIPGIKTAYVN 179

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRF 206
            +NV+DIL+  K +++K A+E +E+ +
Sbjct: 180 TLNVFDILKYDKFIITKDAVEKVEEVY 206


>gi|46396649|sp|Q8XHS4|RL4_CLOPE RecName: Full=50S ribosomal protein L4
          Length = 204

 Score =  120 bits (302), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 71/206 (34%), Positives = 115/206 (55%), Gaps = 3/206 (1%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ + N +G+  G I ++E +F ++  +  L +V+  Q   KR G   +K RSEV   
Sbjct: 1   MPKVGLFNKEGQQVGDIQLNEQVFGVEVNKYALHQVVVAQLANKRQGTQSAKTRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+  GG  F P P     ++PK +R +A+  AL+ K   
Sbjct: 61  GIKPWRQKGTGRARQGSIRAPQWIKGGVVFAPKPRDYRMSIPKSMRKVAMTSALTSKVA- 119

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            D++V+++L  +  KTK  V    A +    LII   +++ N   +ARNI  + ++PV  
Sbjct: 120 -DMVVLEDLTFEAPKTKEAVKMLNAFEAKKTLIIT-AEVNENVYKSARNIRGVTVMPVNN 177

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYD+L C  L+++K A+  +E+ +
Sbjct: 178 INVYDLLNCKTLMITKEAVNKIEEVY 203


>gi|315652353|ref|ZP_07905345.1| 50S ribosomal protein L4 [Eubacterium saburreum DSM 3986]
 gi|315485476|gb|EFU75866.1| 50S ribosomal protein L4 [Eubacterium saburreum DSM 3986]
          Length = 206

 Score =  120 bits (302), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 69/206 (33%), Positives = 115/206 (55%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +SV N++G++ G I +++ +F +   + ++   +  Q   KR G  K+K RSEV+  
Sbjct: 1   MANISVFNIEGKEVGSIELNDAVFGVNVNEHLVHMAVVAQLANKRQGTQKAKTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q++GGG  F P P      L KK + +AL+ AL+ +   
Sbjct: 61  GRKPWKQKGTGHARQGSTRSPQWKGGGVVFAPTPRDYTINLNKKEKRIALKSALTSRVLE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N  +V+D+    E KTK +      L++  AL++   + ++N  L+ RNI  +     + 
Sbjct: 121 NKFIVVDDFSMGEIKTKKMQQTLNNLNVKKALVV-CAENEKNTVLSVRNIYGVKAASPKT 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYDIL+ + +V SK A++ +E+ +
Sbjct: 180 INVYDILKYNTVVASKDAVKTIEEVY 205


>gi|313897239|ref|ZP_07830783.1| 50S ribosomal protein L4 [Clostridium sp. HGF2]
 gi|312957960|gb|EFR39584.1| 50S ribosomal protein L4 [Clostridium sp. HGF2]
          Length = 209

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 117/207 (56%), Gaps = 4/207 (1%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ V +  G++   I++++ +F ++P Q  +   +  Q    R G   +K R+EV   
Sbjct: 1   MPKMVVLSQTGKELNEITLADTVFGIEPNQQCIFDAVIMQRASMRQGTHDTKNRTEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S   +Q+RGGG  FGP P    + L KKVR LAL+ ALS+K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRATQWRGGGIVFGPTPRNYGYKLNKKVRRLALKSALSEKVLE 120

Query: 121 NDIMVIDNLVSKECKTK---YLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLP 177
           N + V+D    +  KTK    ++    A   +  ++ +G   +  F L+ RNIP + +L 
Sbjct: 121 NAMSVVDKFELEAPKTKAFNQIIADINAPKKTLFVVSEGEDFENAF-LSMRNIPTMMMLT 179

Query: 178 VQGINVYDILRCSKLVLSKSAIEALED 204
             G+NVYDI+  +K+V +++A++ +E+
Sbjct: 180 ADGLNVYDIVNANKIVFTEAAVKDVEE 206


>gi|28377833|ref|NP_784725.1| 50S ribosomal protein L4 [Lactobacillus plantarum WCFS1]
 gi|254556018|ref|YP_003062435.1| 50S ribosomal protein L4 [Lactobacillus plantarum JDM1]
 gi|300767822|ref|ZP_07077732.1| ribosomal protein L4/L1 family protein [Lactobacillus plantarum
           subsp. plantarum ATCC 14917]
 gi|308180012|ref|YP_003924140.1| 50S ribosomal protein L4 [Lactobacillus plantarum subsp. plantarum
           ST-III]
 gi|46577245|sp|Q88XY5|RL4_LACPL RecName: Full=50S ribosomal protein L4
 gi|28270666|emb|CAD63572.1| ribosomal protein L4 [Lactobacillus plantarum WCFS1]
 gi|254044945|gb|ACT61738.1| 50S ribosomal protein L4 [Lactobacillus plantarum JDM1]
 gi|300494807|gb|EFK29965.1| ribosomal protein L4/L1 family protein [Lactobacillus plantarum
           subsp. plantarum ATCC 14917]
 gi|308045503|gb|ADN98046.1| 50S ribosomal protein L4 [Lactobacillus plantarum subsp. plantarum
           ST-III]
          Length = 207

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 108/204 (52%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +++   DG   G +++++ +F ++P + ++   +  Q    R G    K RS     
Sbjct: 1   MTSVALFKQDGTQNGDVTLNDAVFGVEPNENVVFDAILMQRASMRQGTHAVKNRSARRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+R GG  FGP P    + LPKKV  LAL+  LS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRKGGIVFGPTPRSYSYKLPKKVMRLALKSVLSQKVLD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N ++ +D+L     KTK  V     L++    ++   + +    LA RN+PN+ +L  +G
Sbjct: 121 NSLVAVDSLAFDAPKTKDFVNVLNNLNVDTKTLVLVEEDNEKAALAGRNLPNVKILKAKG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NV D+    KLV+++ A++ LE+
Sbjct: 181 VNVLDVANSDKLVVTQKALDQLEE 204


>gi|269925832|ref|YP_003322455.1| ribosomal protein L4/L1e [Thermobaculum terrenum ATCC BAA-798]
 gi|269789492|gb|ACZ41633.1| ribosomal protein L4/L1e [Thermobaculum terrenum ATCC BAA-798]
          Length = 223

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 111/204 (54%), Gaps = 1/204 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L V NL+G+    + VS+ +F ++P   ++ + L  Q    R G   ++ R+EV+  G
Sbjct: 1   MQLPVYNLNGDIVSQLEVSDLVFGIQPNLAVMHQALVRQLANARTGTHDTRTRAEVSGGG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K + QKGTGRAR  S    Q+RGGG  FGP P      +P+K+R LALR ALS K    
Sbjct: 61  RKPWRQKGTGRARQGSIRAPQWRGGGVVFGPHPRSYEQRMPRKMRRLALRSALSQKVAEE 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLS-NALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            ++V+  L   E +TK ++     L L+   ++I     + + Q A  N+PN+ ++    
Sbjct: 121 RLLVVTGLSEIEPRTKAMIAALEKLGLAGQKVLIATNGRNESVQKAGSNLPNVKVIHASN 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +N+ D+L+   L L   A+ +L++
Sbjct: 181 LNIADLLKYDYLFLEDGAVNSLQE 204


>gi|260584417|ref|ZP_05852164.1| 50S ribosomal protein L4/L1 [Granulicatella elegans ATCC 700633]
 gi|260157935|gb|EEW93004.1| 50S ribosomal protein L4/L1 [Granulicatella elegans ATCC 700633]
          Length = 207

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 109/204 (53%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++   DG   G I ++ DIF ++P + ++   +  Q    R G    K RS V+  
Sbjct: 1   MTKVTLYKQDGTKNGEIELNSDIFGIEPNENVVFDAVIMQRASLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LP+KVR LA++  LS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGIVFGPTPRSYSYKLPRKVRRLAIKSVLSQKVLD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             ++V++ L     KTK        L +   +++     +   QLAARNIPN+ ++    
Sbjct: 121 QKLVVVEALQFDAPKTKEFAQVLANLKVDTKVLVVVESSNEFAQLAARNIPNVTVVDETQ 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           + V D++   KLVL+++A+  +E+
Sbjct: 181 VTVLDVVNNDKLVLTQAALSKVEE 204


>gi|297703540|ref|XP_002828694.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Pongo
           abelii]
          Length = 311

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 113/206 (54%), Gaps = 4/206 (1%)

Query: 5   SVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKM 64
           S+R  + E  G+  +  D+FA+ P+  IL +V  WQ   KRI  +K+K R+EV   G K 
Sbjct: 68  SLRGFEQERVGLADLHPDVFAIAPRLDILHQVAMWQKNFKRISYAKTKTRAEVRGGGRKP 127

Query: 65  YVQKGTGRARHSSKSVSQFRGGGKAFGPV-PIIGVHALPKKVRSLALRHALSDKFCSNDI 123
           + QKGTGRARH S     +RGGG A GP  P    + LP KVR+L L+ AL+ K   +D+
Sbjct: 128 WPQKGTGRARHGSIRSPLWRGGGVAHGPRGPTSYYYMLPMKVRALGLKMALTVKLAQDDL 187

Query: 124 MVIDNLVSKECKTKYL--VTRFRALDLSNALI-IDGCQLDRNFQLAARNIPNINLLPVQG 180
            ++D+L       +YL  +  +R    S  L+ +   ++ ++   A   +   NL+P  G
Sbjct: 188 HIMDSLELPTGDPQYLTELAHYRRWGDSVLLVDLTHEEMPQSIVEATSRLKTFNLIPAVG 247

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NV+ +L+   LVL+   +  LED+ 
Sbjct: 248 LNVHSMLKHQTLVLTLPTVAFLEDKL 273


>gi|158319544|ref|YP_001512051.1| ribosomal protein L4/L1e [Alkaliphilus oremlandii OhILAs]
 gi|166990945|sp|A8MLE1|RL4_ALKOO RecName: Full=50S ribosomal protein L4
 gi|158139743|gb|ABW18055.1| ribosomal protein L4/L1e [Alkaliphilus oremlandii OhILAs]
          Length = 207

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 120/207 (57%), Gaps = 2/207 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N+ G+    I +SE++F ++  +  +  V++ Q   +R G   +K R+EV   
Sbjct: 1   MPKVAIYNVSGQQVSEIELSENVFGVEVNEHAMYEVVKNQLANRRQGTQSAKTRAEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     + GGG  F P P    + +PKKVR LAL+ AL+ K  S
Sbjct: 61  GRKPWKQKGTGRARVGSIRSPLWVGGGIVFAPKPRDYSYTIPKKVRRLALKSALTSKVNS 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLS-NALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
           N+++V+D L     KTK +V   + L++   ALI+ G + +   + +A NI  +    V 
Sbjct: 121 NELIVLDELKLDAPKTKEMVNILKNLNVDKKALIVMGEKSEAVIK-SANNIQGVQTALVN 179

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRF 206
            INVYDIL+  KL+++K A++ +E+ +
Sbjct: 180 TINVYDILKYDKLIITKDAVQKVEEVY 206


>gi|169823853|ref|YP_001691464.1| 50S ribosomal protein L4 [Finegoldia magna ATCC 29328]
 gi|302379795|ref|ZP_07268279.1| 50S ribosomal protein L4 [Finegoldia magna ACS-171-V-Col3]
 gi|303234753|ref|ZP_07321379.1| 50S ribosomal protein L4 [Finegoldia magna BVS033A4]
 gi|226730666|sp|B0RZU1|RL4_FINM2 RecName: Full=50S ribosomal protein L4
 gi|167830658|dbj|BAG07574.1| 50S ribosomal protein L4 [Finegoldia magna ATCC 29328]
 gi|302312383|gb|EFK94380.1| 50S ribosomal protein L4 [Finegoldia magna ACS-171-V-Col3]
 gi|302494094|gb|EFL53874.1| 50S ribosomal protein L4 [Finegoldia magna BVS033A4]
          Length = 207

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 114/207 (55%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ + N  GE+ G + ++E IF +   + ++  V++ Q   KR G   +K RSEV   
Sbjct: 1   MPKVQILNQQGENVGELELNEAIFGVDVNEHVVYEVVKNQLANKRQGTQSAKTRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  F P P    +A+PKKVR LA++  L++K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGVVFAPKPRDYSYAVPKKVRRLAIKSVLTEKVND 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+++V+D L      TK  V   + +      ++   + D     + RNI N+ +   + 
Sbjct: 121 NEMIVLDKLNLDAISTKKAVEVLKNIKADKKALVVIDKNDDTLYRSFRNIENVAICEAKL 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRFK 207
           INVYD L+ + LV++  A++ LE+ F+
Sbjct: 181 INVYDCLKYNSLVITTDAVKILEEVFQ 207


>gi|325282641|ref|YP_004255182.1| ribosomal protein L4/L1e [Deinococcus proteolyticus MRP]
 gi|324314450|gb|ADY25565.1| ribosomal protein L4/L1e [Deinococcus proteolyticus MRP]
          Length = 204

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 100/175 (57%), Gaps = 5/175 (2%)

Query: 32  ILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGTGRARHSSKSVSQFRGGGKAFG 91
           +L  V+ WQ   +R G + +K R++VA TG KM+ QKGTG ARH  ++V  F GGG AFG
Sbjct: 26  VLHEVVTWQLAGRRRGTASTKTRAQVARTGRKMFSQKGTGNARHGDRTVPTFVGGGVAFG 85

Query: 92  PVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNLVSKECKTKYLV--TRFRALDLS 149
           P P    + LP+KVR L L  AL+D+  +  +  +D     + KTK  V   +   +D S
Sbjct: 86  PKPRDYSYTLPRKVRQLGLAMALADRQAAGMLTAVDGY-DLDGKTKSFVQWAKDNGMDGS 144

Query: 150 NALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRCSKLVLSKSAIEALED 204
             ++I     D N   +ARN+    +LPV G+N YDILR  +LV+   A+E  ++
Sbjct: 145 EKVLI--VTDDANVLRSARNVSWATVLPVAGLNTYDILRHDRLVIDAVALEPAQE 197


>gi|218885188|ref|YP_002434509.1| 50S ribosomal protein L4 [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|226730654|sp|B8DN97|RL4_DESVM RecName: Full=50S ribosomal protein L4
 gi|218756142|gb|ACL07041.1| ribosomal protein L4/L1e [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 206

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 115/207 (55%), Gaps = 1/207 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + V + + ++ G ++++ ++F ++ +  IL  V+R      R G   +K R+ V+  
Sbjct: 1   MAVVKVYDQNKKEAGELTLAPEVFEVEVKPEILNLVVRAHRAGLRSGTHATKTRAFVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G+K + QKGTGRAR  S     +RGG   FGP P      + KKVR LAL+ ALS +   
Sbjct: 61  GAKPWRQKGTGRARSGSNRSPIWRGGAVIFGPQPREYGFKVNKKVRQLALKMALSSRLAG 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            ++MV+  +   E KTK       AL L  AL+I   + D    L+ARNIP I L+    
Sbjct: 121 ENLMVVKGIELPEIKTKLFAKVAGALGLEKALVIT-AEADTTLALSARNIPGITLITADQ 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRFK 207
           ++VY+IL+  KLV+ + A+E+++ R K
Sbjct: 180 LSVYEILKHPKLVMFEGAVESVQARLK 206


>gi|22478084|gb|AAH37064.1| Mrpl4 protein [Mus musculus]
          Length = 306

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 72/207 (34%), Positives = 117/207 (56%), Gaps = 6/207 (2%)

Query: 5   SVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKM 64
           S+R  + E  G+  +  D+FA  P+  I+ +V  WQ   +RI  + +K R+EV+  G K 
Sbjct: 80  SLRGFEQERIGLAELHPDVFATAPRLDIVHQVAIWQRNFRRISYANTKTRAEVSGGGRKP 139

Query: 65  YVQKGTGRARHSSKSVSQFRGGGKAFGPV-PIIGVHALPKKVRSLALRHALSDKFCSNDI 123
           + QKG+GRARH S     +RGGG A GP  P    + LP KVR+L L+ AL+ K   +D+
Sbjct: 140 WQQKGSGRARHGSIRSPLWRGGGVAHGPRGPTSYYYMLPMKVRALGLKVALTVKLMQDDL 199

Query: 124 MVIDNLVSKECKTKYL--VTRFRALDLSNALIIDGC--QLDRNFQLAARNIPNINLLPVQ 179
            ++D+L       +YL  + ++R    S+ L++D    ++ +N   A   + + NL+P  
Sbjct: 200 HIVDSLELPTADPQYLTELAQYRHWG-SSVLLVDLTHEEMPKNVVAATSGLNSFNLIPAV 258

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRF 206
           G+NVY +L+   LVL+  ++  LED+ 
Sbjct: 259 GLNVYSMLKHQTLVLTLPSVAFLEDKL 285


>gi|118579120|ref|YP_900370.1| 50S ribosomal protein L4 [Pelobacter propionicus DSM 2379]
 gi|166199839|sp|A1ALU2|RL4_PELPD RecName: Full=50S ribosomal protein L4
 gi|118501830|gb|ABK98312.1| LSU ribosomal protein L4P [Pelobacter propionicus DSM 2379]
          Length = 207

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 68/203 (33%), Positives = 113/203 (55%), Gaps = 1/203 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  ++V N++ +  G + +++D+F    ++ ++   LR Q   +R G  K+K RSEVA +
Sbjct: 1   MPSIAVYNMNRQQVGELQLADDVFNADVKEHLMHLALRIQLANRRAGTVKTKTRSEVAGS 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR       Q+ GGG AFGP P     ++ KK R  A+  ALS +  +
Sbjct: 61  GKKPFKQKGTGNARQGCVRAPQYPGGGVAFGPQPKEYHLSMNKKARKSAICSALSLQCKN 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N I V+D L      TK  V   +  ++  +LII       N QL+ RN+P++ LL    
Sbjct: 121 NRITVMDKLDFSSISTKAFVDFMKRFEIERSLIITD-DFSNNLQLSCRNVPHVKLLKHDA 179

Query: 181 INVYDILRCSKLVLSKSAIEALE 203
           +N++DIL+   ++ ++ A++++E
Sbjct: 180 LNIHDILKYKNIIFTQGAVQSVE 202


>gi|110803426|ref|YP_699662.1| 50S ribosomal protein L4 [Clostridium perfringens SM101]
 gi|122956495|sp|Q0SQE5|RL4_CLOPS RecName: Full=50S ribosomal protein L4
 gi|110683927|gb|ABG87297.1| 50S ribosomal protein L4 [Clostridium perfringens SM101]
          Length = 204

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 71/206 (34%), Positives = 115/206 (55%), Gaps = 3/206 (1%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ + N +G+  G I ++E +F ++  +  L +V+  Q   KR G   +K RSEV   
Sbjct: 1   MPKVGLFNKEGQQVGDIQLNEQVFGVEVNKYALHQVVVAQLANKRQGTQSAKTRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+  GG  F P P     ++PK +R +A+  AL+ K   
Sbjct: 61  GIKPWRQKGTGRARQGSIRAPQWIKGGVVFAPKPRDYRMSIPKSMRKVAMTSALTSKVA- 119

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            D++V+++L  +  KTK  V    A +    LII   +++ N   +ARNI  + ++PV  
Sbjct: 120 -DMVVLEDLNFEAPKTKEAVKMLNAFEAKKTLIIT-AEVNENVYKSARNIEGVTVMPVNN 177

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYD+L C  L+++K A+  +E+ +
Sbjct: 178 INVYDLLNCKTLMITKEAVNKIEEVY 203


>gi|256847764|ref|ZP_05553209.1| ribosomal protein L4/L1 [Lactobacillus coleohominis 101-4-CHN]
 gi|256715453|gb|EEU30429.1| ribosomal protein L4/L1 [Lactobacillus coleohominis 101-4-CHN]
          Length = 207

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 111/204 (54%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +++ N DG   G I +++ IF ++  +      +  Q    R G    K RS V   
Sbjct: 1   MTSVALFNQDGSQNGNIDLNDAIFGVEVNENAEYESIIRQRASLRQGTHAVKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    QFRGGG  FGP P    + LP+KVR LA++ ALS K   
Sbjct: 61  GKKPWRQKGTGRARQGSIRSPQFRGGGIVFGPTPRSYNYRLPRKVRQLAIKSALSQKVAD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           +  +V+D++     KTK   +    L ++  ++I     D+N  L+ARN+  +N++   G
Sbjct: 121 DKFVVVDSINFDAPKTKEFASVLDNLKVNEKVLIVVTDDDKNAGLSARNLSKVNVVTPAG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +N+ +++   K+V++KSA+  +E+
Sbjct: 181 VNILNVVDAQKIVITKSALSQVEE 204


>gi|309777134|ref|ZP_07672097.1| ribosomal protein L4/L1 family protein [Erysipelotrichaceae
           bacterium 3_1_53]
 gi|308915004|gb|EFP60781.1| ribosomal protein L4/L1 family protein [Erysipelotrichaceae
           bacterium 3_1_53]
          Length = 209

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 72/207 (34%), Positives = 117/207 (56%), Gaps = 4/207 (1%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ V +  G++   I++++ +F ++P Q  +   +  Q    R G   +K R+EV   
Sbjct: 1   MPKMVVLSQTGKELKEITLADTVFGIEPNQQCIFDAVIMQRASMRQGTHDTKNRTEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S   +Q+RGGG  FGP P    + L KKVR LAL+ ALS+K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRATQWRGGGIVFGPTPRNYGYKLNKKVRRLALKSALSEKVLE 120

Query: 121 NDIMVIDNLVSKECKTK---YLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLP 177
           N + V+D    +  KTK    +V    A   +  ++ +G   +  F L+ RNIP + +L 
Sbjct: 121 NAMGVVDKFELEAPKTKAFNQIVADINAPKKTLFVVSEGEDFENAF-LSMRNIPTMMMLT 179

Query: 178 VQGINVYDILRCSKLVLSKSAIEALED 204
             G+NVYDI+  +K+V +++A++ +E+
Sbjct: 180 ADGLNVYDIVNANKIVFTEAAVKDVEE 206


>gi|320526870|ref|ZP_08028060.1| ribosomal protein L4/L1 family protein [Solobacterium moorei F0204]
 gi|320132838|gb|EFW25378.1| ribosomal protein L4/L1 family protein [Solobacterium moorei F0204]
          Length = 209

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 116/209 (55%), Gaps = 16/209 (7%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKP-QQGILARVLRWQSWRKRIGCSKSKGRSEVAY 59
           M ++ V N + +    I +S+ +F ++P QQ +   +L +Q+   R G   +  R+EV+ 
Sbjct: 1   MAKIDVFNQEAKAVKSIELSDAVFGIEPNQQAMYDAILVYQAGL-RQGTHATLTRAEVSG 59

Query: 60  TGSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFC 119
           TG K + QKGTGRAR  S   +Q+R GG AFGP P      L +KVR LALR ALS+K  
Sbjct: 60  TGKKPFRQKGTGRARQGSTRATQWRHGGIAFGPQPRKYDFKLNRKVRQLALRSALSEKLQ 119

Query: 120 SNDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDG-----CQLDRNFQ---LAARNIP 171
            + + V++NL   E KTK      +A+ L NA   D       + D +F    ++ RNIP
Sbjct: 120 ESSLTVLENLSFDEIKTK------KAVALMNAFGFDRKTLFVAEADEDFDNAYVSMRNIP 173

Query: 172 NINLLPVQGINVYDILRCSKLVLSKSAIE 200
           N  ++ V  +NVYDI+   K+V ++ A E
Sbjct: 174 NALVVTVSSLNVYDIVNADKVVFTEKAAE 202


>gi|237786394|ref|YP_002907099.1| 50S ribosomal protein L4 [Corynebacterium kroppenstedtii DSM 44385]
 gi|259491550|sp|C4LL51|RL4_CORK4 RecName: Full=50S ribosomal protein L4
 gi|237759306|gb|ACR18556.1| 50S ribosomal protein L4 [Corynebacterium kroppenstedtii DSM 44385]
          Length = 219

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 72/206 (34%), Positives = 107/206 (51%), Gaps = 3/206 (1%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           + L V   DG   G + +   +F ++    +L +V+  Q   +R G   +K R +V   G
Sbjct: 4   LTLDVHTADGSTNGTVDLPSSVFDVEVSTPLLHQVVTAQLAARRQGTHATKTRGQVRGGG 63

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K Y QKGTGRAR  S    QF GGG   GP P       PKK+++ ALR ALSD+   +
Sbjct: 64  RKPYRQKGTGRARQGSIRAPQFTGGGTVHGPQPRDYDQRTPKKMKAAALRGALSDRARHD 123

Query: 122 DIMVIDNLVSKECKTKYLVTRF--RALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
            I V+++LV  +  +      F  R  D  + L++ G + D N   +ARN+PN+++LP  
Sbjct: 124 RIHVVEDLVPGQTPSTKAARTFIGRLTDRKSVLVVLGRE-DVNSIKSARNLPNVHILPSD 182

Query: 180 GINVYDILRCSKLVLSKSAIEALEDR 205
            +N YD+L    LV S  A+ A  +R
Sbjct: 183 QLNTYDVLNSDDLVFSVEALNAFIER 208


>gi|167748431|ref|ZP_02420558.1| hypothetical protein ANACAC_03175 [Anaerostipes caccae DSM 14662]
 gi|317472036|ref|ZP_07931368.1| ribosomal protein L4/L1 family protein [Anaerostipes sp. 3_2_56FAA]
 gi|167652423|gb|EDR96552.1| hypothetical protein ANACAC_03175 [Anaerostipes caccae DSM 14662]
 gi|316900440|gb|EFV22422.1| ribosomal protein L4/L1 family protein [Anaerostipes sp. 3_2_56FAA]
          Length = 206

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 111/206 (53%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M E+SV N++G +   +++++ IF ++  + ++   +  Q    R G   +K RSEV   
Sbjct: 1   MAEVSVLNMEGNEVEKLNLNDGIFGVEINEHLVHLAVVSQLANNRQGTQSAKTRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+ GGG  F P P      L KK R LAL+ AL+ +   
Sbjct: 61  GRKPWRQKGTGHARQGSIRAPQWTGGGVVFAPKPREYSKKLNKKERRLALKSALTSRVNE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N  +V+D     + KTK +      L++  AL+I G + D N  L+ARNIP +       
Sbjct: 121 NKFIVVDEFKFDDVKTKNVANMLNNLNVKKALVIMGDKND-NLILSARNIPGVKTALTST 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYDIL+   +V+SK A+  +E+ +
Sbjct: 180 INVYDILKYDTVVVSKEAVANIEEVY 205


>gi|169830437|ref|YP_001716419.1| ribosomal protein L4/L1e [Candidatus Desulforudis audaxviator
           MP104C]
 gi|226730652|sp|B1I1I9|RL4_DESAP RecName: Full=50S ribosomal protein L4
 gi|169637281|gb|ACA58787.1| ribosomal protein L4/L1e [Candidatus Desulforudis audaxviator
           MP104C]
          Length = 207

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 110/204 (53%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M   +V N++G+  G I +SE +F       +L  V+  Q   +R G   +K RSEV   
Sbjct: 1   MPTAAVFNIEGQQVGEIELSEAVFGQPVNDAVLHEVVVMQLANRRQGTHDTKTRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRARH +     +RGGG  FGP P    + +PKKV+ LAL+ AL+ K  +
Sbjct: 61  GRKPWRQKGTGRARHGTIRSPIWRGGGIVFGPHPRDYSYRVPKKVKRLALKSALATKVDA 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             I+V+D L     KTK +      L      ++   + + N + +ARN+P +  L  + 
Sbjct: 121 GRILVLDALELPGPKTKEMARILANLKAGEGALVVTAERNVNVEKSARNLPGVKSLEARQ 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NVYD+L    L++++ A+  +E+
Sbjct: 181 LNVYDLLNHPHLIITRDAVARVEE 204


>gi|328875550|gb|EGG23914.1| hypothetical protein DFA_06052 [Dictyostelium fasciculatum]
          Length = 333

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 73/192 (38%), Positives = 107/192 (55%), Gaps = 2/192 (1%)

Query: 15  GVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGTGRAR 74
           G I++   +F +  +  +L R++RWQ  + R G   ++   +V  T  K   QKG GRAR
Sbjct: 121 GEINLLNSVFKVPLRIDLLHRMIRWQRAKARQGTHYAQNMGDVERTNKKPMAQKGNGRAR 180

Query: 75  HSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNLVSKEC 134
             +    Q  GG +AF P P    H+L KKVR  AL  ALS K     ++++D+L  +  
Sbjct: 181 QGTNHAIQMVGGARAFPPKPRDHSHSLQKKVRKQALCVALSTKLAQGKLIIVDDLQVETH 240

Query: 135 KTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRCSKLVL 194
           KTK LV +        +L+++  +   NF LAA NI NI+L+P +GINVY IL+   LV+
Sbjct: 241 KTKELV-QLLPEAWGRSLLVNN-EFSNNFNLAAYNIINIDLVPDRGINVYSILQKDTLVI 298

Query: 195 SKSAIEALEDRF 206
           SK +IE L+ R 
Sbjct: 299 SKKSIEILQARL 310


>gi|153812866|ref|ZP_01965534.1| hypothetical protein RUMOBE_03273 [Ruminococcus obeum ATCC 29174]
 gi|149831078|gb|EDM86167.1| hypothetical protein RUMOBE_03273 [Ruminococcus obeum ATCC 29174]
          Length = 206

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 114/206 (55%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  ++V N++G + G + +++ +F ++  + ++   +  Q    R G  K+K RSEV+  
Sbjct: 1   MANVTVYNMEGNEVGTMELNDAVFGVEINEHLVHLAVVRQLANNRQGTQKAKTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+ GGG  F PVP      + KK R  AL+ AL+ K   
Sbjct: 61  GRKPWRQKGTGHARQGSIRAPQWTGGGVVFAPVPRDYEVKMNKKERRAALKSALTSKVQE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N ++V+D+L   E KTK +      L    AL++     D+   L+ARNI ++    V  
Sbjct: 121 NKLVVVDSLALAEAKTKEMQKVLTNLKADKALVVTADD-DQKVVLSARNIADVQTATVNT 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYD+++ + +V++K A+ ++E+ +
Sbjct: 180 INVYDVMKHNTVVVTKDAVASIEEVY 205


>gi|294630894|ref|ZP_06709454.1| 50S ribosomal protein L4/L1 [Streptomyces sp. e14]
 gi|292834227|gb|EFF92576.1| 50S ribosomal protein L4/L1 [Streptomyces sp. e14]
          Length = 218

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 72/203 (35%), Positives = 106/203 (52%), Gaps = 1/203 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFAL-KPQQGILARVLRWQSWRKRIGCSKSKGRSEVAY 59
           M  + + +  GE  G + +  +IF + K    ++ +V+  Q    R G  K+K R EV  
Sbjct: 1   MSTVDILSPAGEKAGTVELPAEIFGVEKVSVPLIHQVVVAQLAAARQGTHKTKTRGEVRG 60

Query: 60  TGSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFC 119
            G K Y QKGTGRAR  S    QF GGG   GPVP       PKK+++ ALRHAL+D+  
Sbjct: 61  GGKKPYRQKGTGRARQGSTRAPQFAGGGVVHGPVPRDYSQRTPKKMKAAALRHALTDRAR 120

Query: 120 SNDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
            N I V+  +V  E  TK   T F  +     L++   + D    L+ARN+P +++L   
Sbjct: 121 HNRIHVVSGVVEGEISTKAAKTLFGKISERKNLLLVADRSDEAAWLSARNLPQVHILEPG 180

Query: 180 GINVYDILRCSKLVLSKSAIEAL 202
            +N YD+L    +V +K+A E+ 
Sbjct: 181 QLNTYDVLVSDDVVFTKAAFESF 203


>gi|261264937|gb|ACX55827.1| 50S ribosomal protein L4 [Staphylococcus epidermidis]
          Length = 208

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 67/205 (32%), Positives = 105/205 (51%), Gaps = 1/205 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M    V  +DG   G + +++ +FA++P   +L   +  Q    R G    K RS V   
Sbjct: 1   MANYDVLKVDGSKSGSVELNDAVFAIEPNNSVLFEAINLQRASLRQGTHAVKNRSAVRGG 60

Query: 61  GSKMYVQKGTG-RARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFC 119
           G K + QKGTG RAR  +    Q+RGGG  FGP P    + +PKK+R  ALR ALS K  
Sbjct: 61  GRKPWRQKGTGGRARQGTIRAPQWRGGGVVFGPTPRSYAYKMPKKMRRSALRSALSFKVQ 120

Query: 120 SNDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
            N   ++D    +  KTK        L+    +++     D N +L+ARNIP + +   Q
Sbjct: 121 ENSFTIVDTFGFEAPKTKEFKNVLTTLEQPKKVLVVTESEDVNVELSARNIPGVQVTTAQ 180

Query: 180 GINVYDILRCSKLVLSKSAIEALED 204
           G+NV D+     ++++++A + +E+
Sbjct: 181 GLNVLDLTSADSVIITEAAAKKVEE 205


>gi|238916266|ref|YP_002929783.1| large subunit ribosomal protein L4 [Eubacterium eligens ATCC 27750]
 gi|259491557|sp|C4Z2T1|RL4_EUBE2 RecName: Full=50S ribosomal protein L4
 gi|238871626|gb|ACR71336.1| large subunit ribosomal protein L4 [Eubacterium eligens ATCC 27750]
          Length = 206

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 70/206 (33%), Positives = 111/206 (53%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +SV N++G++ G I +++ +F ++  + ++   +  Q    R G   +K RSEV+  
Sbjct: 1   MANVSVYNIEGKEVGSIELNDAVFGVEVNEHLVHMAVVNQLANNRQGTQSAKTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+ GGG  F P P      + KK + +AL  ALS K   
Sbjct: 61  GRKPWRQKGTGHARQGSTRSPQWTGGGVVFAPKPRDYSFKMNKKEKRIALLSALSSKVAD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N I+V+D     E KTK        L +  AL++   + ++N  L+ RNIP + +     
Sbjct: 121 NKIVVLDAFNLDEIKTKKFAEVMSNLKVDKALVVIEGE-NKNVVLSGRNIPTVKVSATNE 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           IN YD+L+   LV++K+A+E LE+ +
Sbjct: 180 INTYDVLKYETLVVTKAAVEKLEEVY 205


>gi|90962405|ref|YP_536321.1| 50S ribosomal protein L4 [Lactobacillus salivarius UCC118]
 gi|227891545|ref|ZP_04009350.1| 50S ribosomal protein L4 [Lactobacillus salivarius ATCC 11741]
 gi|301300211|ref|ZP_07206423.1| 50S ribosomal protein L4 [Lactobacillus salivarius ACS-116-V-Col5a]
 gi|122448605|sp|Q1WS91|RL4_LACS1 RecName: Full=50S ribosomal protein L4
 gi|90821599|gb|ABE00238.1| LSU ribosomal protein L1E [Lactobacillus salivarius UCC118]
 gi|227866692|gb|EEJ74113.1| 50S ribosomal protein L4 [Lactobacillus salivarius ATCC 11741]
 gi|300215030|gb|ADJ79446.1| 50S ribosomal protein L4 [Lactobacillus salivarius CECT 5713]
 gi|300852152|gb|EFK79824.1| 50S ribosomal protein L4 [Lactobacillus salivarius ACS-116-V-Col5a]
          Length = 207

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 66/195 (33%), Positives = 105/195 (53%)

Query: 10  DGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKG 69
           DG   G + ++E IF ++P   ++   +  Q    R G    K RS V   G K + QKG
Sbjct: 10  DGNQNGEVQLNEAIFGIEPNNNVVFDAVIMQRASLRQGTHAVKNRSAVRGGGKKPWRQKG 69

Query: 70  TGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNL 129
           TGRAR  S    Q+ GGG  FGP P    + LP+KVR LA++  LS K     ++V+D L
Sbjct: 70  TGRARQGSIRSPQWVGGGTVFGPTPRSYSYKLPRKVRRLAIKSVLSQKVADESLVVVDAL 129

Query: 130 VSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRC 189
                KTK        L++++ +++     +    LAARN+ N+ ++P +G+NV D++  
Sbjct: 130 NFDAPKTKAFAEVLSNLNVNSKVLVVLEDDNTTAALAARNLKNVTVIPAKGLNVLDVINN 189

Query: 190 SKLVLSKSAIEALED 204
            KLV+++ A+  +E+
Sbjct: 190 DKLVITQGALSQVEE 204


>gi|219666491|ref|YP_002456926.1| 50S ribosomal protein L4 [Desulfitobacterium hafniense DCB-2]
 gi|254803731|sp|B8G1W7|RL4_DESHD RecName: Full=50S ribosomal protein L4
 gi|219536751|gb|ACL18490.1| ribosomal protein L4/L1e [Desulfitobacterium hafniense DCB-2]
          Length = 207

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 110/204 (53%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ V N+ G   G + + E +F ++P   ++ + +  Q   +R G   +  R EV   
Sbjct: 1   MPKVQVVNMQGSPVGELELDEYVFGIEPNTHVMHQAVVGQLASQRRGTHSTLLRGEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     +RGG   FGP P     +LPKKVR LALR ALS K   
Sbjct: 61  GRKPWRQKGTGRARAGSIRSPLWRGGAVLFGPKPRKYGFSLPKKVRRLALRSALSSKVNE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             ++V+++L   E KT+ +V   +AL++    +I   +       +ARNI  I    V+G
Sbjct: 121 QKLIVLEDLSLNEAKTREMVKVLQALNVGKKALIVTDEFMETIDRSARNIAGIKTTAVEG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +N+YD+L    +V++K+A+   E+
Sbjct: 181 MNIYDLLNSDVIVMTKAAVTKTEE 204


>gi|327287992|ref|XP_003228712.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Anolis
           carolinensis]
          Length = 314

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 112/205 (54%), Gaps = 4/205 (1%)

Query: 5   SVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKM 64
           S+++ D    G+  +  D+FA+ P+  IL  V  WQ   KRI  +K+K R+EV   G K 
Sbjct: 90  SLKHYDARHMGLADLHPDVFAVMPRIDILHTVATWQRNFKRISYAKTKTRAEVRGGGRKP 149

Query: 65  YVQKGTGRARHSSKSVSQFRGGGKAFGPV-PIIGVHALPKKVRSLALRHALSDKFCSNDI 123
           + QKG+GRARH S     +RGGG A GP  P    + LP KVR   L+ AL+ K   +++
Sbjct: 150 WRQKGSGRARHGSIRSPIWRGGGVAHGPRGPTSYFYMLPMKVRVQGLKVALTVKLAQDNL 209

Query: 124 MVIDNLVSKECKTKYLV--TRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            V+D+L       +YL+   R+R    S  L +   ++  N + AA ++  I +LP+ G+
Sbjct: 210 HVVDSLEIPTSDPQYLMDLARYRHWGTS-VLFVHVNEIPENIKSAANDLKTITILPITGL 268

Query: 182 NVYDILRCSKLVLSKSAIEALEDRF 206
           NV+ +L+   LVL+   +  LE + 
Sbjct: 269 NVHSMLKYETLVLTLDTVSFLEKKL 293


>gi|57234685|ref|YP_181219.1| 50S ribosomal protein L4 [Dehalococcoides ethenogenes 195]
 gi|109893590|sp|Q3Z980|RL4_DEHE1 RecName: Full=50S ribosomal protein L4
 gi|57225133|gb|AAW40190.1| ribosomal protein L4 [Dehalococcoides ethenogenes 195]
          Length = 210

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 72/203 (35%), Positives = 107/203 (52%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +E+ V N  GE    IS+SED+F +   + ++ +    Q    R G   +K R EV  + 
Sbjct: 1   MEIPVYNASGEIIKNISISEDVFGVPFNEALVHQAFVAQQANARQGTQSTKTRGEVQGSS 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG AR  +      R GG AFGP P      LPKK+R  A+R  LS K  S 
Sbjct: 61  RKIYRQKGTGNARMGTNRSPVRRHGGVAFGPRPRDFSKDLPKKMRRQAIRCVLSFKLESG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           ++ V+D L   E KT+ +     AL + +  +I     D NF  +ARNIP +   P   +
Sbjct: 121 ELKVVDQLSFDEPKTRDMAKILAALQVMSPTLIAVDNPDTNFIKSARNIPAVKTTPANLL 180

Query: 182 NVYDILRCSKLVLSKSAIEALED 204
           N+ D+LR  +LV+++ A+  +E+
Sbjct: 181 NISDMLRNKQLVMTEEAVRQVEE 203


>gi|121534760|ref|ZP_01666581.1| ribosomal protein L4/L1e [Thermosinus carboxydivorans Nor1]
 gi|121306780|gb|EAX47701.1| ribosomal protein L4/L1e [Thermosinus carboxydivorans Nor1]
          Length = 208

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 72/206 (34%), Positives = 117/206 (56%), Gaps = 3/206 (1%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +++V ++ G   G I +S+ +F ++  + +L + +  Q   +R+G   +K R  V   
Sbjct: 1   MPKVAVYDITGAQTGEIELSDSVFGVEVNKAVLHQAVVMQLANQRLGTHATKTRGMVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     + GGG  FGP P     ++P+K R LAL+ ALS K  S
Sbjct: 61  GKKPWRQKGTGRARAGSIRSPLWVGGGTVFGPQPRSYAISMPRKARRLALKSALSAKVQS 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSN--ALIIDGCQLDRNFQLAARNIPNINLLPV 178
            +++V+++    E KTK +V     L +++  ALII   + D N   +ARNIP +  +  
Sbjct: 121 GEMVVLEDFTFAEPKTKNVVKMLDNLKVADDKALIIL-SEADENVIKSARNIPGVKAIAS 179

Query: 179 QGINVYDILRCSKLVLSKSAIEALED 204
            GINVYD+L   K++++K A+  +E+
Sbjct: 180 TGINVYDLLYHDKVLVTKGAVARIEE 205


>gi|206901882|ref|YP_002250702.1| ribosomal protein L4/L1 family [Dictyoglomus thermophilum H-6-12]
 gi|206740985|gb|ACI20043.1| ribosomal protein L4/L1 family [Dictyoglomus thermophilum H-6-12]
          Length = 209

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 68/207 (32%), Positives = 110/207 (53%), Gaps = 1/207 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           MI++ V N   E  G I + E++F ++ +  +    +       R G   +K R EV  +
Sbjct: 1   MIQVPVYNQKAEKVGEIELKEELFGVEKRPDLFYTCVVMHLANGRQGTHSTKRRGEVNRS 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K++ QKGTG AR   +    + GGG+ FGP P    + +PKK+R LA+R ALS K   
Sbjct: 61  GRKVWPQKGTGHARQGDRKAPHWVGGGRPFGPKPRDYSYKIPKKMRRLAIRSALSTKLQE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQL-DRNFQLAARNIPNINLLPVQ 179
           N ++++D +   + KTK LV       L+++ ++ G    D N + AA N+  +  +   
Sbjct: 121 NALIILDKIELSQPKTKELVNILNNFGLADSKVLIGVPAKDENLKRAAMNLEKVKTMIAS 180

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRF 206
            +NVYD+L+   L+L+  AI  LE+ F
Sbjct: 181 VLNVYDLLKYDYLILTVDAIPVLEEAF 207


>gi|270307843|ref|YP_003329901.1| ribosomal protein L4 [Dehalococcoides sp. VS]
 gi|270153735|gb|ACZ61573.1| ribosomal protein L4 [Dehalococcoides sp. VS]
          Length = 210

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 72/203 (35%), Positives = 109/203 (53%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +E+ V N  GE    IS+SED+F +   + ++ +    Q    R G   +K R EV  + 
Sbjct: 1   MEIPVYNASGEIIKNISISEDVFGVPFNEALVHQAFVAQQANARQGTQSTKTRGEVQGSS 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG AR  +      R GG AFGP P      LPKK+R  A+R  LS K  S 
Sbjct: 61  RKIYRQKGTGNARMGTNRSPVRRHGGVAFGPRPRDFSKDLPKKMRRQAIRCVLSFKLESG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           ++ VID L  +E KT+ +     AL + +  +I     D NF  +ARNIP++   P   +
Sbjct: 121 ELKVIDQLSFEEPKTRDMAKILAALQVISPALIAVDNPDTNFIKSARNIPSVKTTPANLL 180

Query: 182 NVYDILRCSKLVLSKSAIEALED 204
           N+ D+L+  +LV+++ A+  +E+
Sbjct: 181 NISDMLKNKQLVMTEEAVRQVEE 203


>gi|269837067|ref|YP_003319295.1| 50S ribosomal protein L4/L1e [Sphaerobacter thermophilus DSM 20745]
 gi|269786330|gb|ACZ38473.1| ribosomal protein L4/L1e [Sphaerobacter thermophilus DSM 20745]
          Length = 209

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 62/206 (30%), Positives = 116/206 (56%), Gaps = 6/206 (2%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +++ V ++ G++ G I +++ +F ++P   ++ +    Q    R+G   +K R EV   G
Sbjct: 1   MQVPVYDVTGQETGQIELADSVFGIEPNVPVMHQAYVRQMANARLGTHDTKTRGEVRGGG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K + QKGTGRARH S     +RGGG  FGP P      +P+K+R LA+R  LS K  ++
Sbjct: 61  RKPWRQKGTGRARHGSIRSPLWRGGGVVFGPHPRKYTQRMPRKMRRLAIRSVLSAKMKAD 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNA----LIIDGCQLDRNFQLAARNIPNINLLP 177
            ++V++ L   E +TK ++     L   +A    +++D  +   N +  A N+ ++ +LP
Sbjct: 121 QVVVVEGLTELEPRTKAMIQTLARLPKGDARSTLILVD--EPRENLRRGANNLEHVRVLP 178

Query: 178 VQGINVYDILRCSKLVLSKSAIEALE 203
            Q +N+ D+L+  +L+L++ A++ + 
Sbjct: 179 AQYVNMRDVLKYERLLLTREAVDVIH 204


>gi|149020530|gb|EDL78335.1| mitochondrial ribosomal protein L4 (predicted), isoform CRA_a
           [Rattus norvegicus]
          Length = 302

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 75/215 (34%), Positives = 118/215 (54%), Gaps = 14/215 (6%)

Query: 5   SVRNLDGEDKGVISVSEDIFALKPQQG--------ILARVLRWQSWRKRIGCSKSKGRSE 56
           S+R  + E  G+  +  D+FA  P+          IL +V  WQ   KRI  +K+K R+E
Sbjct: 68  SLRGFEQERIGLAELHPDVFATTPRWSLTMKYKLDILHQVAVWQRNFKRISYAKTKTRAE 127

Query: 57  VAYTGSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPV-PIIGVHALPKKVRSLALRHALS 115
           V+  G K + QKG+GRARH S     +RGGG A GP  P    + LP KVR+L L+ AL+
Sbjct: 128 VSGGGRKPWQQKGSGRARHGSIRSPIWRGGGVAHGPRGPTSYYYMLPMKVRALGLKVALT 187

Query: 116 DKFCSNDIMVIDNLVSKECKTKYL--VTRFRALDLSNALIIDGC--QLDRNFQLAARNIP 171
            K   +D+ ++D+L       +YL  + ++R    S+ L++D    ++ +N   A   + 
Sbjct: 188 VKLMQDDLHIVDSLELPTADPQYLTELAQYRHWG-SSVLLVDLTHEEMPKNVMAATSRLN 246

Query: 172 NINLLPVQGINVYDILRCSKLVLSKSAIEALEDRF 206
           + NL+P  G+NVY +L+   LVL+  ++  LED+ 
Sbjct: 247 SFNLIPAVGLNVYSMLKHQTLVLTLPSVAFLEDKL 281


>gi|110004230|emb|CAK98568.1| 50s ribosomal protein l4 [Spiroplasma citri]
          Length = 208

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 74/208 (35%), Positives = 119/208 (57%), Gaps = 4/208 (1%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L V +  G     ISV++ I+ ++P Q  +   +  Q    R G  K+K R+EV+  G
Sbjct: 1   MKLQVLDAKGTSVKEISVNDAIWGIEPHQQAMFDAVIAQQAAMRQGTHKTKTRTEVSGGG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIG-VHALPKKVRSLALRHALSDKFCS 120
            K + QKGTGRAR  S    Q++GGG  FGP P    +  + KKVR LA++ ALS K   
Sbjct: 61  KKPWRQKGTGRARQGSIRAPQWKGGGIVFGPTPEKNYLKHVNKKVRKLAIKSALSLKVQD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNA--LIIDGCQLDRNFQLAARNIPNINLLPV 178
            +IM+ID     +  TK +V     L ++    LII     + NF+ ++RNI  +N++  
Sbjct: 121 KNIMIIDQFGIDKPSTKAMVEVLNNLKVNGEKLLIITTEGDEVNFK-SSRNIEKVNIITS 179

Query: 179 QGINVYDILRCSKLVLSKSAIEALEDRF 206
            GIN+YD+L  +KL++++ A++A+E+ +
Sbjct: 180 TGINIYDLLNANKLLVTEQAVKAIEEVY 207


>gi|150392159|ref|YP_001322208.1| ribosomal protein L4/L1e [Alkaliphilus metalliredigens QYMF]
 gi|166990944|sp|A6TWI1|RL4_ALKMQ RecName: Full=50S ribosomal protein L4
 gi|149952021|gb|ABR50549.1| ribosomal protein L4/L1e [Alkaliphilus metalliredigens QYMF]
          Length = 207

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 114/206 (55%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +++V N+ G+    + +SE+IF ++  + +L   ++ Q   KR G   +K R+EV   
Sbjct: 1   MPKVAVYNVSGQKVSEMELSENIFGVEVNEHVLYEAVKNQLANKRQGTQSAKTRAEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  +     + GGG  F P P    + LP+KV+ LAL+ AL+ K  +
Sbjct: 61  GRKPWKQKGTGRARAGTIRSPLWIGGGTVFAPKPRDHSYTLPRKVKRLALKSALTSKVNN 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            +++V+D L     KTK +V   + L+    +++   + +     +A NIP +    V  
Sbjct: 121 EELLVLDELSLDTPKTKDMVNILKNLNADKKVLLVVGEKNEAIIKSASNIPGVTTALVNT 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYDIL   K +++K A+E +E+ +
Sbjct: 181 INVYDILNHDKFIITKDAVEKVEEVY 206


>gi|325261495|ref|ZP_08128233.1| ribosomal protein L4/L1 family protein [Clostridium sp. D5]
 gi|324032949|gb|EGB94226.1| ribosomal protein L4/L1 family protein [Clostridium sp. D5]
          Length = 206

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 68/208 (32%), Positives = 116/208 (55%), Gaps = 5/208 (2%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +SV N++G++ G I +++ +F +   + ++   +  Q    R G  K+K R+EV+  
Sbjct: 1   MANVSVYNIEGKEVGTIDLNDAVFGVDVNEHLVHMAVVSQLANNRQGTQKAKTRAEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+ GGG  F PVP      + KK +  AL+ AL+ +   
Sbjct: 61  GRKPWRQKGTGHARQGSTRSPQWTGGGVVFAPVPRDYSFKMNKKEKRAALKSALTSRVEE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALII--DGCQLDRNFQLAARNIPNINLLPV 178
           N  +VID L   E KTK        L+++ AL++  DG   ++N +++ARNI  +     
Sbjct: 121 NKFIVIDELNFDEIKTKKFQEVLNNLNVNKALVVLEDG---NKNVEISARNIKEVKTAHT 177

Query: 179 QGINVYDILRCSKLVLSKSAIEALEDRF 206
             INV+DIL+ + ++++K+A+  +E+ +
Sbjct: 178 NTINVFDILKYNTVIVTKAAVATIEEVY 205


>gi|328884427|emb|CCA57666.1| LSU ribosomal protein L4p [Streptomyces venezuelae ATCC 10712]
          Length = 216

 Score =  119 bits (298), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 70/202 (34%), Positives = 105/202 (51%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + + +  G+  G + + E+IF  K    ++ +V+  Q    R G  K+K R EV   
Sbjct: 1   MSTIDILSPAGDKTGTVELPEEIFGAKVSVPLIHQVVVAQLAAARQGTHKTKTRGEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K Y QKGTGRAR  S    QF GGG   GPVP       PKK++  ALR ALSD+   
Sbjct: 61  GKKPYRQKGTGRARQGSTRAPQFAGGGVVHGPVPRDYSQRTPKKMKVAALRGALSDRATH 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           + I V+  +V  E  TK   T F  +     L++   + D    L+ARN+P +++L    
Sbjct: 121 SRIHVVTGVVEGEISTKAAKTLFGKISERKNLLLVAERSDEAAWLSARNLPQVHILEPGQ 180

Query: 181 INVYDILRCSKLVLSKSAIEAL 202
           +N YD++    +V +K+A+E+ 
Sbjct: 181 LNTYDVIVSDDVVFTKAALESF 202


>gi|290581288|ref|YP_003485680.1| 50S ribosomal protein L4 [Streptococcus mutans NN2025]
 gi|254998187|dbj|BAH88788.1| 50S ribosomal protein L4 [Streptococcus mutans NN2025]
          Length = 207

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 113/204 (55%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + + +  G++ G +++++ IF ++P + ++  V+  Q    R G    K RS V+  
Sbjct: 1   MANVKLFDQTGKEAGEVTLNDAIFGIEPNESVVFDVIISQRANLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LP+KVR LAL+   S K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRAPQWRGGGVVFGPTPRSYGYKLPQKVRRLALKSVYSAKVAD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
              + +D L  +  KTK   T   AL++ + +++   + ++  +L+ARN+PN+ +     
Sbjct: 121 EKFVAVDALSFEAPKTKEFATVLAALNVDSKVLVILEEGNQAAELSARNLPNVKVATAAT 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
            +V DI+   KL+++K AI  +E+
Sbjct: 181 ASVLDIVNSDKLLVTKEAISNIEE 204


>gi|297567283|ref|YP_003686255.1| 50S ribosomal protein L4/L1e [Meiothermus silvanus DSM 9946]
 gi|296851732|gb|ADH64747.1| ribosomal protein L4/L1e [Meiothermus silvanus DSM 9946]
          Length = 211

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 76/211 (36%), Positives = 107/211 (50%), Gaps = 14/211 (6%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQ--QGILARVLRWQSWRKRIGCSKSKGRSEVA 58
           M+ LSV +  G+       + D+ A  P+    +L  V++WQ  ++R G + +K R  V 
Sbjct: 1   MVTLSVLSAKGQK------ARDLEATLPEVNPHVLYEVVKWQMAKRRAGTAATKTRGMVN 54

Query: 59  YTGSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKF 118
           +T  KMY QK TGRARH       F GGG  FGP P    + LPKKVR L L  AL+D+ 
Sbjct: 55  FTTKKMYSQKHTGRARHGDYGAPIFVGGGTVFGPQPRDYSYTLPKKVRKLGLAMALADRA 114

Query: 119 CSNDIMVIDNLVSKECKTKYLVTRFRALDLSNA---LIIDGCQLDRNFQLAARNIPNINL 175
               +++ +       KTK  +       L  +   L++   +L R    AARN+P +  
Sbjct: 115 KDGKLLIAEGFEGVNGKTKEFLAWATGAGLDGSQTVLLVTANELVRR---AARNLPWVRT 171

Query: 176 LPVQGINVYDILRCSKLVLSKSAIEALEDRF 206
           L  +G+NVYDILR   LVL   A EA + R 
Sbjct: 172 LAPEGLNVYDILRQEWLVLDMPAWEAAQARL 202


>gi|227485524|ref|ZP_03915840.1| ribosomal protein L4 [Anaerococcus lactolyticus ATCC 51172]
 gi|227236523|gb|EEI86538.1| ribosomal protein L4 [Anaerococcus lactolyticus ATCC 51172]
          Length = 207

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 71/206 (34%), Positives = 110/206 (53%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N+ GE+ G + ++E IFA K  +  +  V++ Q   KR G   +K R+EV   
Sbjct: 1   MPKVNILNIKGENVGELELNETIFATKVSEHAVYEVIKNQLANKRQGTQSAKTRAEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     + GGG  F P P    + L KK+R  AL   L+ K   
Sbjct: 61  GRKPFRQKGTGRARQGSIRAPHYTGGGVVFAPKPRDYSYRLAKKLRRKALYSVLTSKLND 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+++V+D+L  +  KTK       AL+      +   + D     + RNI  + +   + 
Sbjct: 121 NELIVVDSLALENAKTKEAKAALVALNADRKAYVVTAEKDELVYRSFRNIEGVEVAEARL 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYD++R  KLV++K AI  L++ F
Sbjct: 181 INVYDLVRHDKLVITKDAIAKLQEVF 206


>gi|222056704|ref|YP_002539066.1| ribosomal protein L4/L1e [Geobacter sp. FRC-32]
 gi|254803736|sp|B9M6U4|RL4_GEOSF RecName: Full=50S ribosomal protein L4
 gi|221565993|gb|ACM21965.1| ribosomal protein L4/L1e [Geobacter sp. FRC-32]
          Length = 207

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 64/203 (31%), Positives = 115/203 (56%), Gaps = 1/203 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +L V N   +  G I +S+ +F  + ++ ++   ++ Q   +R G    K R+ V+ +
Sbjct: 1   MAKLDVYNTSHKKVGEIELSDAVFNDEVREYLIHEAVKIQLANRRAGTVAVKNRAAVSGS 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG+AR   K   Q+ GGG AFGP P     ++ KK R  ALR ALS  F +
Sbjct: 61  GKKPFKQKGTGQARQGCKRAPQYPGGGVAFGPQPKTYNLSMNKKARRAALRSALSLLFKN 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           + + V+D +      TK  V   +   L  AL++   + +RN +L+ARNI N+ +L  +G
Sbjct: 121 DKLTVLDAINLDTVSTKNFVGVLKGFSLDKALVVTDAE-NRNLELSARNIKNVKVLKTEG 179

Query: 181 INVYDILRCSKLVLSKSAIEALE 203
           +N++D+++  +++ +++++  +E
Sbjct: 180 LNIFDLMKYQRVIFTENSVRKVE 202


>gi|227501135|ref|ZP_03931184.1| ribosomal protein L4 [Anaerococcus tetradius ATCC 35098]
 gi|227216720|gb|EEI82121.1| ribosomal protein L4 [Anaerococcus tetradius ATCC 35098]
          Length = 207

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 70/206 (33%), Positives = 111/206 (53%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ + N+ GE+ G + ++E +F  +  +  +  V++ Q   KR G   +K RSEV   
Sbjct: 1   MPKVDILNIKGENVGSLELNETLFNTEISEHAVYEVVKNQLANKRQGTQSAKTRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     + GGG  F P P    + +PKK+R  AL   L+ K   
Sbjct: 61  GRKPFRQKGTGRARQGSIRAPHYTGGGVVFAPKPRDYSYKVPKKLRRKALYSVLTSKLND 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+++V+D+L  +  KTK  V    A++      +   + D     + RNI  +++     
Sbjct: 121 NELVVLDSLSLENAKTKEAVKVLEAVNAGKKAYVVTAENDTLVYRSFRNIEGVDVAAASL 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYD++R +KLV++K AI  LE+ F
Sbjct: 181 INVYDLVRHNKLVITKDAIAKLEEVF 206


>gi|291518044|emb|CBK73265.1| LSU ribosomal protein L4P [Butyrivibrio fibrisolvens 16/4]
          Length = 206

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 114/206 (55%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++SV N++G++ G + +++ IFA++  + ++   +  Q    R G  K+K RSEV+  
Sbjct: 1   MAKVSVFNMEGKEVGSMDLNDSIFAVEINEHLVHMAVVQQLANNRQGTQKAKTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+ GGG  F P P      L KK +  AL+ AL+     
Sbjct: 61  GRKPWRQKGTGHARQGSTRSPQWTGGGVVFAPTPRDYSFKLNKKEKRAALKSALTSVVNE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N  +V+D L     KTK        L++  AL++     D+N  ++A+NIP +       
Sbjct: 121 NKFIVVDELKLDSIKTKDFAKVLTNLNVEKALVVLDTN-DQNVVMSAKNIPTVKTALTNT 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYDIL+ + +V++K+A++ +++ +
Sbjct: 180 INVYDILKYNTVVVTKAAVDQIQEVY 205


>gi|22547136|ref|NP_057040.2| 39S ribosomal protein L4, mitochondrial isoform a [Homo sapiens]
 gi|22547138|ref|NP_666499.1| 39S ribosomal protein L4, mitochondrial isoform a [Homo sapiens]
 gi|74733471|sp|Q9BYD3|RM04_HUMAN RecName: Full=39S ribosomal protein L4, mitochondrial; Short=L4mt;
           Short=MRP-L4
 gi|13559361|dbj|BAB40840.1| mitochondrial ribosomal protein L4 (L4mt) [Homo sapiens]
 gi|14602670|gb|AAH09858.1| Mitochondrial ribosomal protein L4 [Homo sapiens]
 gi|119604489|gb|EAW84083.1| mitochondrial ribosomal protein L4, isoform CRA_a [Homo sapiens]
 gi|119604490|gb|EAW84084.1| mitochondrial ribosomal protein L4, isoform CRA_a [Homo sapiens]
          Length = 311

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 112/206 (54%), Gaps = 4/206 (1%)

Query: 5   SVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKM 64
           S+R  + E  G+  +  D+FA  P+  IL +V  WQ   KRI  +K+K R+EV   G K 
Sbjct: 68  SLRGFEQERVGLADLHPDVFATAPRLDILHQVAMWQKNFKRISYAKTKTRAEVRGGGRKP 127

Query: 65  YVQKGTGRARHSSKSVSQFRGGGKAFGPV-PIIGVHALPKKVRSLALRHALSDKFCSNDI 123
           + QKGTGRARH S     +RGGG A GP  P    + LP KVR+L L+ AL+ K   +D+
Sbjct: 128 WPQKGTGRARHGSIRSPLWRGGGVAHGPRGPTSYYYMLPMKVRALGLKVALTVKLAQDDL 187

Query: 124 MVIDNLVSKECKTKYL--VTRFRALDLSNALI-IDGCQLDRNFQLAARNIPNINLLPVQG 180
            ++D+L       +YL  +  +R    S  L+ +   ++ ++   A   +   NL+P  G
Sbjct: 188 HIMDSLELPTGDPQYLTELAHYRRWGDSVLLVDLTHEEMPQSIVEATSRLKTFNLIPAVG 247

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NV+ +L+   LVL+   +  LED+ 
Sbjct: 248 LNVHSMLKHQTLVLTLPTVAFLEDKL 273


>gi|282882504|ref|ZP_06291125.1| ribosomal protein, L4/L1 family [Peptoniphilus lacrimalis 315-B]
 gi|281297646|gb|EFA90121.1| ribosomal protein, L4/L1 family [Peptoniphilus lacrimalis 315-B]
          Length = 207

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 112/206 (54%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ + N++G     I V+++IF     + ++  V++     +R G   +K RSEV   
Sbjct: 1   MAKIQMINIEGNPVSEIEVNDNIFNCDVNEHVVYLVVKNILANRRQGTHSAKTRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    QFRGGG  F   P    +  PKKVR LAL+  L+ K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQFRGGGVVFAKKPRDYSYTTPKKVRRLALKSVLTSKLQD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           ++I+V+D L   E KTK +V   + +      +I     + N   +ARNI  +    V+ 
Sbjct: 121 SEIIVLDKLELNEIKTKTVVNILKDIKADKKALIVINDKNENIIRSARNIEGVKTEFVKN 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYD+L+ + LV++K A++ LE+ F
Sbjct: 181 INVYDLLKYNSLVITKDALDTLEEVF 206


>gi|308809341|ref|XP_003081980.1| 50S ribosomal protein L4 (ISS) [Ostreococcus tauri]
 gi|116060447|emb|CAL55783.1| 50S ribosomal protein L4 (ISS) [Ostreococcus tauri]
          Length = 275

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 74/217 (34%), Positives = 107/217 (49%), Gaps = 24/217 (11%)

Query: 14  KGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGTGRA 73
           +G  ++   IF    +  +  RV+RWQ  + R G  K+K R EV+ T  K   QKG GRA
Sbjct: 53  RGEATLPGRIFDQPLRVDVAHRVVRWQRAKARAGTHKTKTRGEVSGTTRKARPQKGQGRA 112

Query: 74  RHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNLVSKE 133
           R       Q RGGG A GPVP    +ALPKKVR + L+ ALS +     I+++D+    E
Sbjct: 113 RVGMLRAPQMRGGGVAHGPVPRSHAYALPKKVRRMGLKVALSARAAEGKIVIVDSFAGME 172

Query: 134 CKTKYLVTRFRALD----------LSNALIIDGCQL--------------DRNFQLAARN 169
            KT+ +      L             + LI+DG                 +   ++++RN
Sbjct: 173 PKTRVMKETLERLTGDMGLAAGGKFHSTLIVDGEFEETSEEDDDEETYSPNEIVRISSRN 232

Query: 170 IPNINLLPVQGINVYDILRCSKLVLSKSAIEALEDRF 206
           +P++ +LP  G NVY ILR   LV++KS +E L  R 
Sbjct: 233 LPHVEVLPQIGANVYSILRRRTLVMTKSGLEQLIRRL 269


>gi|259047554|ref|ZP_05737955.1| 50S ribosomal protein L4 [Granulicatella adiacens ATCC 49175]
 gi|259035745|gb|EEW37000.1| 50S ribosomal protein L4 [Granulicatella adiacens ATCC 49175]
          Length = 207

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 109/204 (53%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++   DG   G I ++ DIF ++P + ++   +  Q    R G    K RS V+  
Sbjct: 1   MTKVTLFKQDGTTNGEIELNSDIFGIEPNENVVFDAVIMQRASLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LPKKVR LA++  LS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGIVFGPTPRSYSYKLPKKVRRLAIKSVLSQKVLD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N ++V++ L     KTK        L++   +++     +    L+ARNIPN+ ++    
Sbjct: 121 NKLVVVEALQFDAPKTKEFAQVLSNLNVDTKVLVVVESSNDFALLSARNIPNVTIVDETD 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           + V D++   KL+ +K+A+  +E+
Sbjct: 181 VTVLDVVNNDKLLFTKAALSKVEE 204


>gi|269122980|ref|YP_003305557.1| 50S ribosomal protein L4/L1e [Streptobacillus moniliformis DSM
           12112]
 gi|268314306|gb|ACZ00680.1| ribosomal protein L4/L1e [Streptobacillus moniliformis DSM 12112]
          Length = 214

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 114/206 (55%), Gaps = 5/206 (2%)

Query: 4   LSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSK 63
           L V NL+GE+KGV +VS +IF L+P + ++  VL  +    R G + +K R EV+  G K
Sbjct: 6   LKVYNLNGEEKGVTTVSSEIFGLEPNKYVMHEVLTAELAASRAGTASTKTRGEVSGGGRK 65

Query: 64  MYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDI 123
            + QKGTGRAR  S       GGG   GP P      + KKVR LAL+ AL+ +  + D+
Sbjct: 66  PFRQKGTGRARQGSTRAPHMVGGGVVHGPKPRNYDKKVNKKVRKLALKSALAVRIQNGDV 125

Query: 124 MVIDNLVSKECKTKYLVTRFRALDL--SNALIIDGCQL---DRNFQLAARNIPNINLLPV 178
           +V+++ +    KTK  V     +++     L I    L   D N  L+ RNI    +L  
Sbjct: 126 IVLEDYMLDTPKTKAFVNFTEKVNMVEDKKLFIVNDYLEDADWNLYLSVRNIEKTEILDP 185

Query: 179 QGINVYDILRCSKLVLSKSAIEALED 204
           + ++VY +L+ +K+V++K A+  +E+
Sbjct: 186 RELSVYALLKFNKVVITKEALATIEE 211


>gi|167767802|ref|ZP_02439855.1| hypothetical protein CLOSS21_02337 [Clostridium sp. SS2/1]
 gi|317497094|ref|ZP_07955421.1| ribosomal protein L4/L1 family protein [Lachnospiraceae bacterium
           5_1_63FAA]
 gi|167710541|gb|EDS21120.1| hypothetical protein CLOSS21_02337 [Clostridium sp. SS2/1]
 gi|291558861|emb|CBL37661.1| LSU ribosomal protein L4P [butyrate-producing bacterium SSC/2]
 gi|316895639|gb|EFV17794.1| ribosomal protein L4/L1 family protein [Lachnospiraceae bacterium
           5_1_63FAA]
          Length = 206

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 70/206 (33%), Positives = 113/206 (54%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +SV N++G++   + ++++IF ++  + ++   +  Q    R G  K+K RSEV   
Sbjct: 1   MATVSVLNMEGKEVEKLELNDNIFGVEINEHLVHLAVVSQLANNRQGTQKAKTRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q++GGG  F P P      L KK R +AL+ AL+ +  +
Sbjct: 61  GRKPWRQKGTGHARQGSIRAPQWKGGGVVFAPTPREYTKKLNKKERRIALKSALTSRVQA 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           +  +VID     E KTK +     ++    AL++ G + D N  L+ARN+P +       
Sbjct: 121 DKFVVIDEFKFDEIKTKNVKAMLDSVGAKKALVVMGSKND-NLVLSARNLPGVKTALTST 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYDIL+   +V+SK A+  +E+ +
Sbjct: 180 INVYDILKYDTVVVSKEAVANIEEVY 205


>gi|257870518|ref|ZP_05650171.1| ribosomal protein L4 [Enterococcus gallinarum EG2]
 gi|257804682|gb|EEV33504.1| ribosomal protein L4 [Enterococcus gallinarum EG2]
          Length = 207

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 64/196 (32%), Positives = 113/196 (57%), Gaps = 2/196 (1%)

Query: 10  DGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKG 69
           DG   G I+++E+IF ++P + ++   +  Q    R G    K RS V   G K + QKG
Sbjct: 10  DGSQNGEITLNEEIFGIEPNETVVYDAIIMQRASLRQGTHAVKNRSAVRGGGRKPWRQKG 69

Query: 70  TGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNL 129
           TGRAR  S    Q+RGGG  FGP P    + LPKKVR LA++  LS+K  SN+++ ++ L
Sbjct: 70  TGRARQGSIRSPQWRGGGVVFGPTPRSYSYKLPKKVRRLAMKSVLSEKVASNNLVAVEGL 129

Query: 130 VSKECKTKYLVTRFRALDLSNALIIDGCQLDRNF-QLAARNIPNINLLPVQGINVYDILR 188
                KTK        L + + +++   + + +F  L+ARN+P+++++    ++V D++ 
Sbjct: 130 SFDAPKTKEFKQVLANLTIDSKVLVV-LETENDFAALSARNLPSVSVVTADNVSVLDVVS 188

Query: 189 CSKLVLSKSAIEALED 204
             K++++++A+  +E+
Sbjct: 189 ADKMLVTQTALTQIEE 204


>gi|254303419|ref|ZP_04970777.1| ribosomal protein L4 [Fusobacterium nucleatum subsp. polymorphum
           ATCC 10953]
 gi|148323611|gb|EDK88861.1| ribosomal protein L4 [Fusobacterium nucleatum subsp. polymorphum
           ATCC 10953]
          Length = 209

 Score =  119 bits (297), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 111/206 (53%), Gaps = 2/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  L+V NL G+  G + V++ +F ++P + +L  VL  +    R G + +K R+ V   
Sbjct: 1   MAVLNVYNLAGDQTGTLEVNDAVFGIEPNKVVLHEVLTAELAAARQGTASTKTRAMVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S       GGG  FGP P      + KKVR+LALR ALS K  +
Sbjct: 61  GRKPFKQKGTGRARQGSIRAPHMVGGGVTFGPHPRSYEKKVNKKVRNLALRSALSAKVAA 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNA--LIIDGCQLDRNFQLAARNIPNINLLPV 178
            +++V+D  V +  KTK +V     +D       ++     D N  L+ARN+ N  +L  
Sbjct: 121 GNVLVLDYDVIETPKTKVIVNLVNKVDAKQKQLFVVGDLIKDYNLYLSARNLENAVILQP 180

Query: 179 QGINVYDILRCSKLVLSKSAIEALED 204
             I VY +L+  K++L+K A+  +E+
Sbjct: 181 NEIGVYWLLKQEKVILTKEALATVEE 206


>gi|229829428|ref|ZP_04455497.1| hypothetical protein GCWU000342_01518 [Shuttleworthia satelles DSM
           14600]
 gi|229791859|gb|EEP27973.1| hypothetical protein GCWU000342_01518 [Shuttleworthia satelles DSM
           14600]
          Length = 206

 Score =  118 bits (296), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 70/206 (33%), Positives = 113/206 (54%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++SV N++G++   + +++ +F ++    ++   +  Q   KR G  K+K RSEV   
Sbjct: 1   MAKVSVFNMEGKEVEQMELADSVFGVEVNDHLVHMAVLQQLANKRQGTQKAKTRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+ GG   F P P      L +K +  AL  ALS +   
Sbjct: 61  GRKPWRQKGTGHARQGSTRSPQWTGGVVVFAPTPRDYSFKLNRKEKRAALLSALSSRVQE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N ++V+D L   E KTK      + L +  AL++ G Q D    ++ARNIP++       
Sbjct: 121 NKLIVVDQLAFDEIKTKKFAEVLKNLKVEKALVVLG-QDDEKAIISARNIPDVKTAQTNS 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYDIL+ + LV++K A++++E+ +
Sbjct: 180 INVYDILKYNTLVVTKEAVKSIEEVY 205


>gi|227431340|ref|ZP_03913393.1| ribosomal protein L4 [Leuconostoc mesenteroides subsp. cremoris
           ATCC 19254]
 gi|227352933|gb|EEJ43106.1| ribosomal protein L4 [Leuconostoc mesenteroides subsp. cremoris
           ATCC 19254]
          Length = 207

 Score =  118 bits (296), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 69/203 (33%), Positives = 108/203 (53%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +++V   DG     I +++ +FA++P   ++   +  Q    R G    K RS V+  
Sbjct: 1   MTKVAVLKQDGSQAAEIELNDAVFAIEPNNAVITDAVLMQRASLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    QFRGGG  FGP P    + + +K   LAL+  LS K   
Sbjct: 61  GRKPWKQKGTGRARAGSIREPQFRGGGIVFGPSPRSYAYRINRKAYQLALKSVLSQKVAD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N ++V+D L  K  KT+ L      L      ++   + + N  L+ARN+ N+ ++  +G
Sbjct: 121 NKLVVVDALSFKAPKTQDLKKVLANLSADKKTLVVVDEDNENAILSARNLANVQVMTTKG 180

Query: 181 INVYDILRCSKLVLSKSAIEALE 203
           INV D++   KLV+ +S+IE ++
Sbjct: 181 INVLDVVNADKLVIVQSSIEEIQ 203


>gi|269958585|ref|YP_003328372.1| 50S ribosomal protein L4 [Anaplasma centrale str. Israel]
 gi|269848414|gb|ACZ49058.1| 50S ribosomal protein L4 [Anaplasma centrale str. Israel]
          Length = 208

 Score =  118 bits (295), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 74/208 (35%), Positives = 117/208 (56%), Gaps = 6/208 (2%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +E++V N+  E  G + ++  +F ++P++ +L  V+ WQ  ++R G  K++  S+V  T 
Sbjct: 1   MEVNVVNIKNEVVGQLELNASVFGVQPRRDVLRDVVDWQLAKRRAGTHKTRCISDVRGTT 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +K Y QK TGRAR  S    QFRGG   FGPV     ++L KKVR L L+ ALS K   +
Sbjct: 61  AKPYRQKHTGRARQGSLRSPQFRGGAVVFGPVNRSHAYSLNKKVRRLGLKVALSMKVSDS 120

Query: 122 DIMVIDN---LVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPV 178
            ++V+D+   ++ K    +     F A   S  ++ +G   +     A RN+PN++LL  
Sbjct: 121 KLVVLDDSGLVLEKTADARAAFGNFGAYG-SYLVVAEG--YEDKVACACRNLPNVDLLKY 177

Query: 179 QGINVYDILRCSKLVLSKSAIEALEDRF 206
            GINV DILR   ++L+  A++ LE R 
Sbjct: 178 AGINVLDILRHDCVILTVGAVKCLESRL 205


>gi|331268414|ref|YP_004394906.1| 50S ribosomal protein L4/L1e [Clostridium botulinum BKT015925]
 gi|329124964|gb|AEB74909.1| ribosomal protein L4/L1e [Clostridium botulinum BKT015925]
          Length = 206

 Score =  118 bits (295), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 115/206 (55%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + + N +G+  G + ++E +FA++    +L +V+  Q   KR G   +K R+EV+  
Sbjct: 1   MPTVDLYNREGQKVGDLQLAEAVFAVEVNADVLHQVVVAQLANKRQGTQSAKTRAEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+  GG  F P P     A+PK +R +A++ AL+ K   
Sbjct: 61  GKKPWRQKGTGRARQGSIRAPQWIHGGIVFAPKPREYRMAIPKSMRRVAMKSALTSKVNE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            +++V++NL  +  KTK +V    A +    LI+     +  ++ + RNI    ++PV  
Sbjct: 121 QELVVLENLELEAPKTKEMVKMINAFEAKKPLIVVAESNEVVYK-SIRNIEGATIVPVNN 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYDIL+  K +++K A+  +E+ +
Sbjct: 180 INVYDILKHDKFIITKDAVAKIEEVY 205


>gi|62287203|sp|Q5SHN9|RL4_THET8 RecName: Full=50S ribosomal protein L4; AltName: Full=L1e
 gi|116668237|pdb|2J01|F Chain F, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Mrna, Trna And Paromomycin (Part 2 Of 4).
           This File Contains The 50s Subunit From Molecule I.
 gi|116668298|pdb|2J03|F Chain F, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Mrna, Trna And Paromomycin (Part 4 Of 4).
           This File Contains The 50s Subunit From Molecule Ii.
 gi|119389738|pdb|2HGJ|F Chain F, Crystal Structure Of The 70s Thermus Thermophilus Ribosome
           Showing How The 16s 3'-End Mimicks Mrna E And P Codons.
           This Entry 2hgj Contains 50s Ribosomal Subunit. The 30s
           Ribosomal Subunit Can Be Found In Pdb Entry 2hgi.
 gi|119389795|pdb|2HGQ|F Chain F, Crystal Structure Of The 70s Thermus Thermophilus Ribosome
           With Translocated And Rotated Shine-Dalgarno Duplex.
           This Entry 2hgq Contains 50s Ribosomal Subunit. The 30s
           Ribosomal Subunit Can Be Found In Pdb Entry 2hgp.
 gi|119389851|pdb|2HGU|F Chain F, 70s T.Th. Ribosome Functional Complex With Mrna And E- And
           P-Site Trnas At 4.5a. This Entry 2hgu Contains 50s
           Ribosomal Subunit. The 30s Ribosomal Subunit Can Be
           Found In Pdb Entry 2hgr.
 gi|157836524|pdb|2V47|F Chain F, Structure Of The Ribosome Recycling Factor Bound To The
           Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe And
           Trna-Fmet (Part 2 Of 4). This File Contains The 50s
           Subunit For Molecule 1.
 gi|157836580|pdb|2V49|F Chain F, Structure Of The Ribosome Recycling Factor Bound To The
           Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe And
           Trna-Fmet (Part 4 Of 4). This File Contains The 50s
           Subunit Of Molecule 2.
 gi|211938858|pdb|2JL6|F Chain F, Insights Into Translational Termination From The Structure
           Of Rf2 Bound To The Ribosome (Part 2 Of 4). This File
           Contains The 50s Subunit.
 gi|211938916|pdb|2JL8|F Chain F, Insights Into Translational Termination From The Structure
           Of Rf2 Bound To The Ribosome (Part 4 Of 4). This File
           Contains The 50s Subunit.
 gi|226887439|pdb|2WDI|F Chain F, Structure Of The Thermus Thermophilus 70s Ribosome In
           Complex With Mrna, Paromomycin, Acylated A-Site Trna,
           Deacylated P-Site Trna, And E-Site Trna. This File
           Contains The 50s Subunit For Molecule I.
 gi|226887471|pdb|2WDJ|F Chain F, Structure Of The Thermus Thermophilus 70s Ribosome In
           Complex With Mrna, Paromomycin, Acylated A-Site Trna,
           Deacylated P-Site Trna, And E-Site Trna. This File
           Contains The 50s Subunit For Molecule Ii.
 gi|226887528|pdb|2WDL|F Chain F, Structure Of The Thermus Thermophilus 70s Ribosome In
           Complex With Mrna, Paromomycin, Acylated A- And P-Site
           Trnas, And E-Site Trna.  This File Contains The 50s
           Subunit For Molecule I.
 gi|226887585|pdb|2WDN|F Chain F, Structure Of The Thermus Thermophilus 70s Ribosome In
           Complex With Mrna, Paromomycin, Acylated A- And P-Site
           Trnas, And E-Site Trna.  This File Contains The 50s
           Subunit For Molecule Ii.
 gi|237823569|pdb|2WH2|F Chain F, Insights Into Translational Termination From The Structure
           Of Rf2 Bound To The Ribosome
 gi|237823628|pdb|2WH4|F Chain F, Insights Into Translational Termination From The Structure
           Of Rf2 Bound To The Ribosome
 gi|260100015|pdb|3HUX|F Chain F, Structure Of Ef-P Bound To The 70s Ribosome; This File
           Contains The 50s Subunit For Molecule I.
 gi|260100071|pdb|3HUZ|F Chain F, Structure Of Ef-P Bound To The 70s Ribosome; This File
           Contains The 50s Subunit For Molecule Ii.
 gi|261824524|pdb|2WRJ|F Chain F, The Structure Of The Ribosome With Elongation Factor G
           Trapped In The Post-Translocational State (Part 2 Of 4).
 gi|261824586|pdb|2WRL|F Chain F, The Structure Of The Ribosome With Elongation Factor G
           Trapped In The Post-Translocational State. (Part 4 Of
           4).
 gi|261824649|pdb|2WRO|F Chain F, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu
           And Trna (Part 2 Of 4).
 gi|261824708|pdb|2WRR|F Chain F, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu
           And Trna (Part 4 Of 4).
 gi|281307196|pdb|3KIR|F Chain F, Structure Of Rele Nuclease Bound To The 70s Ribosome
           (Precleavage State; Part 2 Of 4)
 gi|281307254|pdb|3KIT|F Chain F, Structure Of Rele Nuclease Bound To The 70s Ribosome
           (Precleavage State; Part 4 Of 4)
 gi|281307312|pdb|3KIW|F Chain F, Structure Of Rele Nuclease Bound To The 70s Ribosome
           (Postcleavage State; Part 2 Of 4)
 gi|281307370|pdb|3KIY|F Chain F, Structure Of Rele Nuclease Bound To The 70s Ribosome
           (Postcleavage State; Part 4 Of 4)
 gi|288965634|pdb|3KNI|F Chain F, The Structures Of Viomycin Bound To The 70s Ribosome. This
           File Contains The 50s Subunit For Molecule I
 gi|288965666|pdb|3KNK|F Chain F, The Structures Of Viomycin Bound To The 70s Ribosome. This
           File Contains The 50s Subunit For Molecule Ii.
 gi|288965698|pdb|3KNM|F Chain F, The Structures Of Capreomycin Bound To The 70s Ribosome.
           Thi Contains The 50s Subunit For Molecule I.
 gi|288965730|pdb|3KNO|F Chain F, The Structures Of Capreomycin Bound To The 70s Ribosome.
           Thi Contains The 50s Subunit For Molecule Ii
 gi|294979478|pdb|3I8F|F Chain F, Elongation Complex Of The 70s Ribosome With Three Trnas
           And Entry 3i8f Contains 50s Ribosomal Subunit. The 30s
           Ribosoma Can Be Found In Pdb Entry 3i8g. Molecule B In
           The Same Asym Unit Is Deposited As 3i8g (30s) And 3i8f
           (50s).
 gi|294979558|pdb|3I8I|F Chain F, Elongation Complex Of The 70s Ribosome With Three Trnas
           And Entry 3i8i Contains 50s Ribosomal Subnit. The 30s
           Ribosomal Can Be Found In Pdb Entry 3i8h. Molecule A In
           The Same Asym Unit Is Deposited As 3i8f (50s) And 3i8g
           (30s).
 gi|294979616|pdb|3I9C|F Chain F, Initiation Complex Of 70s Ribosome With Two Trnas And
           Mrna. 3i9c Contains 50s Ribosomal Subunit Of Molecule B.
           The 30s Subunit Can Be Found In Pdb Entry 3i9b. Molecule
           A In The S Asymmetric Unit Is Deposited As 3i9d (30s)
           And 3i9e (50s)
 gi|294979670|pdb|3I9E|F Chain F, Initiation Complex Of 70s Ribosome With Two Trnas And
           Mrna. 3i9e Contains 50s Ribosomal Subunit Of Molecule A.
           The 30s Subunit Can Be Found In Pdb Entry 3i9d. Molecule
           B In The S Asymmetric Unit Is Deposited As 3i9b (30s)
           And 3i9c (50s)
 gi|295982115|pdb|2X9S|F Chain F, Structure Of The 70s Ribosome Bound To Release Factor 2
           And A Substrate Analog Provides Insights Into Catalysis
           Of Peptide Release
 gi|295982174|pdb|2X9U|F Chain F, Structure Of The 70s Ribosome Bound To Release Factor 2
           And A Substrate Analog Provides Insights Into Catalysis
           Of Peptide Release
 gi|307568002|pdb|2XG0|F Chain F, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The
           70s Ribosome (Part 2 Of 4)
 gi|307568060|pdb|2XG2|F Chain F, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The
           70s Ribosome (Part 4 Of 4)
 gi|309320290|pdb|3OH5|F Chain F, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Chloramphenicol. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 gi|309320320|pdb|3OH7|F Chain F, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Chloramphenicol. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 gi|309320392|pdb|3OHJ|F Chain F, Structure Of The Thermus Thermophilus Ribosome Complexed
           With Erythromycin. This File Contains The 50s Subunit Of
           One 70s Ribosome. The Entire Crystal Structure Contains
           Two 70s Ribosomes.
 gi|309320422|pdb|3OHK|F Chain F, Structure Of The Thermus Thermophilus Ribosome Complexed
           With Erythromycin. This File Contains The 50s Subunit Of
           One 70s Ribosome. The Entire Crystal Structure Contains
           Two 70s Ribosomes.
 gi|309320473|pdb|3OHZ|F Chain F, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Azithromycin. This File Contains The 50s
           Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 gi|309320524|pdb|3OI1|F Chain F, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Azithromycin. This File Contains The 50s
           Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 gi|309320575|pdb|3OI3|F Chain F, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Telithromycin. This File Contains The 50s
           Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 gi|309320626|pdb|3OI5|F Chain F, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Telithromycin. This File Contains The 50s
           Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 gi|312207714|pdb|2XQE|F Chain F, The Structure Of Ef-Tu And Aminoacyl-Trna Bound To The 70s
           Ribosome With A Gtp Analog
 gi|313754038|pdb|2XTG|F Chain F, Trna Tranlocation On The 70s Ribosome: The        Pre-
           Translocational Translocation Intermediate Ti(Pre)
 gi|313754096|pdb|2XUX|F Chain F, Trna Tranlocation On The 70s Ribosome: The Post-
           Translocational Translocation Intermediate Ti(Post)
 gi|325533443|pdb|2Y0V|F Chain F, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To A
           Near-Cognate Codon On The 70s Ribosome
 gi|325533502|pdb|2Y0X|F Chain F, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To A
           Near-Cognate Codon On The 70s Ribosome
 gi|325533561|pdb|2Y0Z|F Chain F, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To
           A Near-Cognate Codon On The 70s Ribosome
 gi|325533620|pdb|2Y11|F Chain F, The Crystal Structure Of Ef-Tu And Trp-Trna-Trp Bound To A
           Cognate Codon On The 70s Ribosome.
 gi|325533679|pdb|2Y13|F Chain F, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To
           A Near-Cognate Codon On The 70s Ribosome
 gi|325533738|pdb|2Y15|F Chain F, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To
           A Cognate Codon On The 70s Ribosome.
 gi|325533797|pdb|2Y17|F Chain F, Ef-Tu Complex 3
 gi|325533856|pdb|2Y19|F Chain F, The Crystal Structure Of Ef-Tu And Trp-Trna-Trp Bound To A
           Cognate Codon On The 70s Ribosome.
 gi|55773073|dbj|BAD71514.1| 50S ribosomal protein L4 [Thermus thermophilus HB8]
          Length = 210

 Score =  118 bits (295), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 99/178 (55%), Gaps = 6/178 (3%)

Query: 32  ILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGTGRARHSSKSVSQFRGGGKAFG 91
           +L  V+RWQ  ++R G + +K R EVAY+G K++ QK TGRARH       F GGG  FG
Sbjct: 32  LLWEVVRWQLAKRRRGTASTKTRGEVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFG 91

Query: 92  PVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNLVSKECKTKYLVTRFRALDLSNA 151
           P P    + LPKKVR   L  A++D+     +++++       KTK  +   +   L  +
Sbjct: 92  PKPRDYSYTLPKKVRKKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDGS 151

Query: 152 ---LIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRCSKLVLSKSAIEALEDRF 206
              L++ G +L R    AARN+P +  L  +G+NVYDI+R  +LV+   A E  ++R 
Sbjct: 152 ESVLLVTGNELVRR---AARNLPWVVTLAPEGLNVYDIVRTERLVMDLDAWEVFQNRI 206


>gi|126322913|ref|XP_001367717.1| PREDICTED: hypothetical protein [Monodelphis domestica]
          Length = 426

 Score =  118 bits (295), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 76/211 (36%), Positives = 115/211 (54%), Gaps = 6/211 (2%)

Query: 2   IELSVRNLDGEDK---GVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVA 58
           ++  V +L G +K   G+  +  D+FA+ P+  IL  V  WQ   KRI  +K+K R+EV 
Sbjct: 195 VQAWVESLQGYEKTRVGLADLHPDVFAVAPRLDILHDVAMWQKNFKRISYAKTKTRAEVR 254

Query: 59  YTGSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPV-PIIGVHALPKKVRSLALRHALSDK 117
             G K + QKG+GRARH S     +RGGG A GP  P    + LP KVR L L+ AL+ K
Sbjct: 255 GGGRKPWRQKGSGRARHGSIRSPIWRGGGVAHGPRGPTSYYYMLPMKVRVLGLKVALTVK 314

Query: 118 FCSNDIMVIDNLVSKECKTKYL--VTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINL 175
              +D+ ++D+L       +YL  + R R    S  L+    ++ +N   A  N+  INL
Sbjct: 315 LMQDDLHIVDSLELPTSDPRYLLDLVRHRYWGDSVLLVDVDEEMPQNIVSAVSNLKTINL 374

Query: 176 LPVQGINVYDILRCSKLVLSKSAIEALEDRF 206
           +P  G+NV+ +L+   LVL+ + +  LE + 
Sbjct: 375 VPAVGLNVHSMLKHQTLVLTLNTVAFLEKKL 405


>gi|323706451|ref|ZP_08118012.1| ribosomal protein L4/L1e [Thermoanaerobacterium xylanolyticum
           LX-11]
 gi|323534171|gb|EGB23961.1| ribosomal protein L4/L1e [Thermoanaerobacterium xylanolyticum
           LX-11]
          Length = 206

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 73/208 (35%), Positives = 119/208 (57%), Gaps = 5/208 (2%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +++V N++ E  G I +S+++F ++    ++   +      +R G   +K R EV   
Sbjct: 1   MPKVAVYNINAEQIGEIELSDNVFGVEVNVPVMHEAVLNYLANQRQGTHSTKRRGEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+  GG  FGP P    + +PKKV+ LAL+ ALS K   
Sbjct: 61  GIKPWRQKGTGRARQGSIRAPQWVKGGVVFGPKPRDYSYNIPKKVKRLALKSALSSKVRD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALII--DGCQLDRNFQLAARNIPNINLLPV 178
           N+I+VID++   E KTK +    +  D+ NALI+  DG +   N  L++RNIPN+  +  
Sbjct: 121 NEIIVIDDINIDEPKTKKIAEMLKKFDVKNALIVIPDGKE---NVILSSRNIPNVKAVFA 177

Query: 179 QGINVYDILRCSKLVLSKSAIEALEDRF 206
             +N YD+L+  + +++K A+  +E+ +
Sbjct: 178 NSLNTYDVLKYDRFIITKDAVNKVEEVY 205


>gi|253580620|ref|ZP_04857884.1| 50S ribosomal protein L4/L1 [Ruminococcus sp. 5_1_39B_FAA]
 gi|251847991|gb|EES75957.1| 50S ribosomal protein L4/L1 [Ruminococcus sp. 5_1_39BFAA]
          Length = 206

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 67/206 (32%), Positives = 112/206 (54%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  ++V N++G + G + +++ +F ++  + ++   +  Q    R G  K+K RSEV+  
Sbjct: 1   MANVTVYNMEGNEVGTMELNDAVFGVEVNEHLVHLAVVRQLANNRQGTQKAKTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+ GGG  F PVP      + KK R  AL+ AL+ K   
Sbjct: 61  GRKPWRQKGTGHARQGSIRAPQWTGGGVVFAPVPRDYEVKMNKKERRAALKSALTSKVQD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N ++V+D L   + KTK +      L    AL+I     D+N  L+ARNI ++       
Sbjct: 121 NKLVVVDALTLADVKTKEMQKVLTNLKAEKALVITATD-DKNVILSARNITDVQTATPST 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYD++  + ++++K A+ ++E+ +
Sbjct: 180 INVYDVMNHNTVIVTKDAVASIEEVY 205


>gi|227519993|ref|ZP_03950042.1| 50S ribosomal protein L4 [Enterococcus faecalis TX0104]
 gi|227555854|ref|ZP_03985901.1| 50S ribosomal protein L4 [Enterococcus faecalis HH22]
 gi|229546963|ref|ZP_04435688.1| 50S ribosomal protein L4 [Enterococcus faecalis TX1322]
 gi|229550552|ref|ZP_04439277.1| 50S ribosomal protein L4 [Enterococcus faecalis ATCC 29200]
 gi|255971710|ref|ZP_05422296.1| 50S ribosomal protein L4 [Enterococcus faecalis T1]
 gi|255974710|ref|ZP_05425296.1| 50S ribosomal protein L4 [Enterococcus faecalis T2]
 gi|256855164|ref|ZP_05560525.1| ribosomal protein L4 [Enterococcus faecalis T8]
 gi|256956861|ref|ZP_05561032.1| 50S ribosomal protein L4 [Enterococcus faecalis DS5]
 gi|256960668|ref|ZP_05564839.1| 50S ribosomal protein L4 [Enterococcus faecalis Merz96]
 gi|256964133|ref|ZP_05568304.1| 50S ribosomal protein L4 [Enterococcus faecalis HIP11704]
 gi|257078531|ref|ZP_05572892.1| 50S ribosomal protein L4 [Enterococcus faecalis JH1]
 gi|257081498|ref|ZP_05575859.1| 50S ribosomal protein L4 [Enterococcus faecalis E1Sol]
 gi|257084146|ref|ZP_05578507.1| 50S ribosomal protein L4 [Enterococcus faecalis Fly1]
 gi|257087973|ref|ZP_05582334.1| 50S ribosomal protein L4 [Enterococcus faecalis D6]
 gi|257088650|ref|ZP_05583011.1| 50S ribosomal protein L4 [Enterococcus faecalis CH188]
 gi|257417577|ref|ZP_05594571.1| 50S ribosomal protein L4 [Enterococcus faecalis AR01/DG]
 gi|257418698|ref|ZP_05595692.1| 50S ribosomal protein L4 [Enterococcus faecalis T11]
 gi|257421501|ref|ZP_05598491.1| 50S ribosomal protein L4 [Enterococcus faecalis X98]
 gi|293382757|ref|ZP_06628682.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis R712]
 gi|293388060|ref|ZP_06632588.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis S613]
 gi|294781052|ref|ZP_06746403.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis
           PC1.1]
 gi|300861819|ref|ZP_07107899.1| 50S ribosomal protein L4 [Enterococcus faecalis TUSoD Ef11]
 gi|307269088|ref|ZP_07550449.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis
           TX4248]
 gi|307274172|ref|ZP_07555380.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis
           TX0855]
 gi|307276397|ref|ZP_07557520.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis
           TX2134]
 gi|307278607|ref|ZP_07559677.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis
           TX0860]
 gi|307287013|ref|ZP_07567088.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis
           TX0109]
 gi|307291646|ref|ZP_07571521.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis
           TX0411]
 gi|312901121|ref|ZP_07760409.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis
           TX0470]
 gi|312904683|ref|ZP_07763838.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis
           TX0635]
 gi|312908652|ref|ZP_07767594.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis DAPTO
           512]
 gi|312909200|ref|ZP_07768057.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis DAPTO
           516]
 gi|312952608|ref|ZP_07771472.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis
           TX0102]
 gi|227072541|gb|EEI10504.1| 50S ribosomal protein L4 [Enterococcus faecalis TX0104]
 gi|227175021|gb|EEI55993.1| 50S ribosomal protein L4 [Enterococcus faecalis HH22]
 gi|229304271|gb|EEN70267.1| 50S ribosomal protein L4 [Enterococcus faecalis ATCC 29200]
 gi|229307891|gb|EEN73878.1| 50S ribosomal protein L4 [Enterococcus faecalis TX1322]
 gi|255962728|gb|EET95204.1| 50S ribosomal protein L4 [Enterococcus faecalis T1]
 gi|255967582|gb|EET98204.1| 50S ribosomal protein L4 [Enterococcus faecalis T2]
 gi|256709677|gb|EEU24724.1| ribosomal protein L4 [Enterococcus faecalis T8]
 gi|256947357|gb|EEU63989.1| 50S ribosomal protein L4 [Enterococcus faecalis DS5]
 gi|256951164|gb|EEU67796.1| 50S ribosomal protein L4 [Enterococcus faecalis Merz96]
 gi|256954629|gb|EEU71261.1| 50S ribosomal protein L4 [Enterococcus faecalis HIP11704]
 gi|256986561|gb|EEU73863.1| 50S ribosomal protein L4 [Enterococcus faecalis JH1]
 gi|256989528|gb|EEU76830.1| 50S ribosomal protein L4 [Enterococcus faecalis E1Sol]
 gi|256992176|gb|EEU79478.1| 50S ribosomal protein L4 [Enterococcus faecalis Fly1]
 gi|256996003|gb|EEU83305.1| 50S ribosomal protein L4 [Enterococcus faecalis D6]
 gi|256997462|gb|EEU83982.1| 50S ribosomal protein L4 [Enterococcus faecalis CH188]
 gi|257159405|gb|EEU89365.1| 50S ribosomal protein L4 [Enterococcus faecalis ARO1/DG]
 gi|257160526|gb|EEU90486.1| 50S ribosomal protein L4 [Enterococcus faecalis T11]
 gi|257163325|gb|EEU93285.1| 50S ribosomal protein L4 [Enterococcus faecalis X98]
 gi|291079917|gb|EFE17281.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis R712]
 gi|291082511|gb|EFE19474.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis S613]
 gi|294451855|gb|EFG20306.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis
           PC1.1]
 gi|295112507|emb|CBL31144.1| Ribosomal protein L4 [Enterococcus sp. 7L76]
 gi|300848344|gb|EFK76101.1| 50S ribosomal protein L4 [Enterococcus faecalis TUSoD Ef11]
 gi|306497265|gb|EFM66807.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis
           TX0411]
 gi|306501959|gb|EFM71248.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis
           TX0109]
 gi|306504667|gb|EFM73867.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis
           TX0860]
 gi|306506877|gb|EFM76024.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis
           TX2134]
 gi|306509134|gb|EFM78196.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis
           TX0855]
 gi|306514568|gb|EFM83122.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis
           TX4248]
 gi|310625439|gb|EFQ08722.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis DAPTO
           512]
 gi|310629396|gb|EFQ12679.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis
           TX0102]
 gi|310632035|gb|EFQ15318.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis
           TX0635]
 gi|311290442|gb|EFQ68998.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis DAPTO
           516]
 gi|311291793|gb|EFQ70349.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis
           TX0470]
 gi|315026834|gb|EFT38766.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis
           TX2137]
 gi|315028874|gb|EFT40806.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis
           TX4000]
 gi|315031140|gb|EFT43072.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis
           TX0017]
 gi|315036014|gb|EFT47946.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis
           TX0027]
 gi|315145337|gb|EFT89353.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis
           TX2141]
 gi|315147170|gb|EFT91186.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis
           TX4244]
 gi|315151072|gb|EFT95088.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis
           TX0012]
 gi|315153608|gb|EFT97624.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis
           TX0031]
 gi|315156212|gb|EFU00229.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis
           TX0043]
 gi|315158643|gb|EFU02660.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis
           TX0312]
 gi|315160729|gb|EFU04746.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis
           TX0645]
 gi|315165900|gb|EFU09917.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis
           TX1302]
 gi|315168101|gb|EFU12118.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis
           TX1341]
 gi|315171459|gb|EFU15476.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis
           TX1342]
 gi|315172693|gb|EFU16710.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis
           TX1346]
 gi|315573515|gb|EFU85706.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis
           TX0309B]
 gi|315579327|gb|EFU91518.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis
           TX0630]
 gi|315582137|gb|EFU94328.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis
           TX0309A]
 gi|323479423|gb|ADX78862.1| 50S ribosomal protein L4 [Enterococcus faecalis 62]
 gi|327534005|gb|AEA92839.1| ribosomal protein L4/L1 family protein [Enterococcus faecalis
           OG1RF]
          Length = 207

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 64/195 (32%), Positives = 108/195 (55%)

Query: 10  DGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKG 69
           DG   G I+++E+IF ++P + ++   +  Q    R G    K RS V   G K + QKG
Sbjct: 10  DGTQNGEITLNEEIFGIEPNESVVYDAIIMQRASLRQGTHAVKNRSAVRGGGRKPWRQKG 69

Query: 70  TGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNL 129
           TGRAR  S    Q+RGGG  FGP P    + LPKKVR LA++  LSDK   N+++ ++ L
Sbjct: 70  TGRARQGSIRSPQWRGGGVVFGPTPRSYSYKLPKKVRRLAMKSVLSDKVAENNLVAVEGL 129

Query: 130 VSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRC 189
                KTK        L +   +++     +    L+ARN+PN++++    ++V D++  
Sbjct: 130 SFDAPKTKEFKQVLANLSIDTKVLVVLENGNDFAALSARNLPNVSVVTSDNVSVLDVVSA 189

Query: 190 SKLVLSKSAIEALED 204
           +K++ +++A+  +E+
Sbjct: 190 NKVLATQTALTQIEE 204


>gi|257067059|ref|YP_003153315.1| 50S ribosomal protein L4/L1e [Anaerococcus prevotii DSM 20548]
 gi|256798939|gb|ACV29594.1| ribosomal protein L4/L1e [Anaerococcus prevotii DSM 20548]
          Length = 207

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 69/206 (33%), Positives = 110/206 (53%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ + N+ GE+ G + ++E +F  +  +  +  V++ Q   KR G   +K RSEV   
Sbjct: 1   MPKVDILNIKGENVGSLELNETLFNTEISEHSVYEVVKNQLANKRQGTQSAKTRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     + GGG  F P P    + +PKK+R  AL   L+ K   
Sbjct: 61  GRKPFRQKGTGRARQGSIRAPHYTGGGVVFAPKPRDYSYKVPKKLRRKALYSVLTSKVVD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            +++V+D+L  +  KTK       A++      +   + D N   + RNI  +++     
Sbjct: 121 GELIVLDDLKLENNKTKEAAAVLNAVEAGKKAYVVTAENDNNVYRSFRNIEGVDVASASL 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYD++R +KLV++K AI  LE+ F
Sbjct: 181 INVYDLVRHNKLVITKDAIAKLEEVF 206


>gi|209156522|pdb|3D5B|F Chain F, Structural Basis For Translation Termination On The 70s
           Ribosome. This File Contains The 50s Subunit Of One 70s
           Ribosome. The Entire Crystal Structure Contains Two 70s
           Ribosomes As Described In Remark 400.
 gi|209156576|pdb|3D5D|F Chain F, Structural Basis For Translation Termination On The 70s
           Ribosome. This File Contains The 50s Subunit Of The
           Second 70s Ribosome. The Entire Crystal Structure
           Contains Two 70s Ribosomes As Described In Remark 400.
 gi|218766799|pdb|3F1F|F Chain F, Crystal Structure Of A Translation Termination Complex
           Formed With Release Factor Rf2. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes As Described In
           Remark 400.
 gi|218766855|pdb|3F1H|F Chain F, Crystal Structure Of A Translation Termination Complex
           Formed With Release Factor Rf2. This File Contains The
           50s Subunit Of The Second 70s Ribosome. The Entire
           Crystal Structure Contains Two 70s Ribosomes As
           Described In Remark 400
          Length = 210

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 99/178 (55%), Gaps = 6/178 (3%)

Query: 32  ILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGTGRARHSSKSVSQFRGGGKAFG 91
           +L  V+RWQ  ++R G + +K R EVAY+G K++ QK TGRARH       F GGG  FG
Sbjct: 32  LLWEVVRWQLAKRRRGTASTKTRGEVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFG 91

Query: 92  PVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNLVSKECKTKYLVTRFRALDLSNA 151
           P P    + LPKKVR   L  A++D+     +++++       KTK  +   +   L  +
Sbjct: 92  PKPRDYSYTLPKKVRKKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDGS 151

Query: 152 ---LIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRCSKLVLSKSAIEALEDRF 206
              L++ G +L R    AARN+P +  L  +G+NVYDI+R  +LV+   A E  ++R 
Sbjct: 152 ESVLLVTGNELVRR---AARNLPWVVTLAPEGLNVYDIVRTERLVMDLDAWEVFQNRI 206


>gi|1033073|gb|AAA97862.1| ribosomal protein L4 [Thermus thermophilus]
 gi|1586538|prf||2204237A ribosomal protein L4
          Length = 210

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 99/178 (55%), Gaps = 6/178 (3%)

Query: 32  ILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGTGRARHSSKSVSQFRGGGKAFG 91
           +L  V+RWQ  ++R G + +K R EVAY+G K++ QK TGRARH       F GGG  FG
Sbjct: 32  LLWEVVRWQLAKRRRGTASTKTRGEVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFG 91

Query: 92  PVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNLVSKECKTKYLVTRFRALDLSNA 151
           P P    + LPKKVR   L  A++D+     +++++       KTK  +   +   L  +
Sbjct: 92  PKPRDYSYTLPKKVRKKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDGS 151

Query: 152 ---LIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRCSKLVLSKSAIEALEDRF 206
              L++ G +L R    AARN+P +  L  +G+NVYDI+R  +LV+   A E  ++R 
Sbjct: 152 ESVLLVTGNELVRR---AARNLPWVVTLAPEGLNVYDIVRTERLVMDLDAWEVFQNRI 206


>gi|304315941|ref|YP_003851086.1| ribosomal protein L4/L1e [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302777443|gb|ADL68002.1| ribosomal protein L4/L1e [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 206

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 71/206 (34%), Positives = 120/206 (58%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +++V N++GE  G + +S+++F ++    ++  V+      +R G   +K R EV   
Sbjct: 1   MPKVAVYNINGEQIGEMELSDNVFGVEVNVPVMHEVVLNYLASQRQGTHSTKRRGEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+  GG  FGP P    + +PKKV+ LAL+ ALS K   
Sbjct: 61  GIKPWRQKGTGRARQGSIRAPQWIKGGVVFGPKPRDYSYNIPKKVKRLALKSALSSKVRD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+I+VID++   E KTK +    +  ++ NALI+   +  +N  L++RNIPN+  +    
Sbjct: 121 NEIIVIDDINIDEPKTKKVADMLKKFNVKNALIVI-PEDKKNVVLSSRNIPNVKAVYANS 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +N YD+L+  + +++K A+  +E+ +
Sbjct: 180 LNTYDVLKYDRFIITKDAVNKVEEVY 205


>gi|224510784|pdb|3FIN|F Chain F, T. Thermophilus 70s Ribosome In Complex With Mrna, Trnas
           And Ef-Tu.Gdp.Kirromycin Ternary Complex, Fitted To A
           6.4 A Cryo-Em Map. This File Contains The 50s Subunit
          Length = 208

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 99/178 (55%), Gaps = 6/178 (3%)

Query: 32  ILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGTGRARHSSKSVSQFRGGGKAFG 91
           +L  V+RWQ  ++R G + +K R EVAY+G K++ QK TGRARH       F GGG  FG
Sbjct: 32  LLWEVVRWQLAKRRRGTASTKTRGEVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFG 91

Query: 92  PVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNLVSKECKTKYLVTRFRALDLSNA 151
           P P    + LPKKVR   L  A++D+     +++++       KTK  +   +   L  +
Sbjct: 92  PKPRDYSYTLPKKVRKKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDGS 151

Query: 152 ---LIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRCSKLVLSKSAIEALEDRF 206
              L++ G +L R    AARN+P +  L  +G+NVYDI+R  +LV+   A E  ++R 
Sbjct: 152 ESVLLVTGNELVRR---AARNLPWVVTLAPEGLNVYDIVRTERLVMDLDAWEVFQNRI 206


>gi|150015044|ref|YP_001307298.1| 50S ribosomal protein L4 [Clostridium beijerinckii NCIMB 8052]
 gi|189029495|sp|A6LPR2|RL4_CLOB8 RecName: Full=50S ribosomal protein L4
 gi|149901509|gb|ABR32342.1| ribosomal protein L4/L1e [Clostridium beijerinckii NCIMB 8052]
          Length = 206

 Score =  118 bits (295), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 71/206 (34%), Positives = 118/206 (57%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + V N +G     + ++E++FA +  +  L +V+      KR G   +K RSEV   
Sbjct: 1   MPTVGVFNKEGNKVADMELNENVFAAEINEYALHQVVVALLANKRQGTQSTKTRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+  GG  F P P     ++PK +R +A++ AL+ K   
Sbjct: 61  GIKPWRQKGTGRARQGSIRSPQWIKGGIVFAPKPRDYRVSVPKSMRKVAMKSALTSKVQD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N ++V+D+L  +  KTK ++   +AL+ + ALII     +  ++ +ARNI  I+++P   
Sbjct: 121 NQMIVLDSLNFEAPKTKSMIEMLKALEANKALIITAESNEVVYK-SARNIQGISVIPANN 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYD+L+  KL+++K A+  +E+ +
Sbjct: 180 INVYDLLKYEKLIITKDAVSKIEEVY 205


>gi|46199629|ref|YP_005296.1| 50S ribosomal protein L4 [Thermus thermophilus HB27]
 gi|161986604|ref|YP_144957.2| 50S ribosomal protein L4 [Thermus thermophilus HB8]
 gi|81567621|sp|Q72I05|RL4_THET2 RecName: Full=50S ribosomal protein L4
 gi|149240889|pdb|1VSA|D Chain D, Crystal Structure Of A 70s Ribosome-Trna Complex Reveals
           Functional Interactions And Rearrangements. This File,
           1vsa, Contains The 50s Ribosome Subunit. 30s Ribosome
           Subunit Is In The File 2ow8
 gi|160285431|pdb|1VSP|D Chain D, Interactions And Dynamics Of The Shine-Dalgarno Helix In
           The 70s Ribosome. This File, 1vsp, Contains The 50s
           Ribosome Subunit. 30s Ribosome Subunit Is In The File
           2qnh
 gi|300508633|pdb|3MRZ|E Chain E, Recognition Of The Amber Stop Codon By Release Factor Rf1.
           This Entry 3mrz Contains 50s Ribosomal Subunit. The 30s
           Ribosomal Subunit Can Be Found In Pdb Entry 3ms0.
           Molecule A In The Same Asymmetric Unit Is Deposited As
           3mr8 (50s) And 3ms1 (30s).
 gi|300508688|pdb|3MS1|E Chain E, Recognition Of The Amber Stop Codon By Release Factor Rf1.
           This Entry 3ms1 Contains 50s Ribosomal Subunit. The 30s
           Ribosomal Subunit Can Be Found In Pdb Entry 3mr8.
           Molecule B In The Same Asymmetric Unit Is Deposited As
           3mrz (50s) And 3ms0 (30s).
 gi|46197255|gb|AAS81669.1| LSU ribosomal protein L1E [Thermus thermophilus HB27]
          Length = 205

 Score =  117 bits (294), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 99/178 (55%), Gaps = 6/178 (3%)

Query: 32  ILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGTGRARHSSKSVSQFRGGGKAFG 91
           +L  V+RWQ  ++R G + +K R EVAY+G K++ QK TGRARH       F GGG  FG
Sbjct: 27  LLWEVVRWQLAKRRRGTASTKTRGEVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFG 86

Query: 92  PVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNLVSKECKTKYLVTRFRALDLSNA 151
           P P    + LPKKVR   L  A++D+     +++++       KTK  +   +   L  +
Sbjct: 87  PKPRDYSYTLPKKVRKKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDGS 146

Query: 152 ---LIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRCSKLVLSKSAIEALEDRF 206
              L++ G +L R    AARN+P +  L  +G+NVYDI+R  +LV+   A E  ++R 
Sbjct: 147 ESVLLVTGNELVRR---AARNLPWVVTLAPEGLNVYDIVRTERLVMDLDAWEVFQNRI 201


>gi|257866530|ref|ZP_05646183.1| ribosomal protein L4 [Enterococcus casseliflavus EC30]
 gi|257872955|ref|ZP_05652608.1| ribosomal protein L4 [Enterococcus casseliflavus EC10]
 gi|257876134|ref|ZP_05655787.1| ribosomal protein L4 [Enterococcus casseliflavus EC20]
 gi|325567375|ref|ZP_08144042.1| 50S ribosomal protein L4 [Enterococcus casseliflavus ATCC 12755]
 gi|257800488|gb|EEV29516.1| ribosomal protein L4 [Enterococcus casseliflavus EC30]
 gi|257807119|gb|EEV35941.1| ribosomal protein L4 [Enterococcus casseliflavus EC10]
 gi|257810300|gb|EEV39120.1| ribosomal protein L4 [Enterococcus casseliflavus EC20]
 gi|325158808|gb|EGC70954.1| 50S ribosomal protein L4 [Enterococcus casseliflavus ATCC 12755]
          Length = 207

 Score =  117 bits (294), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 66/196 (33%), Positives = 112/196 (57%), Gaps = 2/196 (1%)

Query: 10  DGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKG 69
           DG   G I+++E+IF ++P + ++   +  Q    R G    K RS V   G K + QKG
Sbjct: 10  DGSQNGEITLNEEIFGIEPNESVVYDAIIMQRASLRQGTHAVKNRSAVRGGGRKPWRQKG 69

Query: 70  TGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNL 129
           TGRAR  S    Q+RGGG  FGP P    + LPKKVR LA++  LS+K  SN+++ ++ L
Sbjct: 70  TGRARQGSIRSPQWRGGGVVFGPTPRSYSYKLPKKVRRLAMKSVLSEKVASNNLVAVEGL 129

Query: 130 VSKECKTKYLVTRFRALDLSNALIIDGCQLDRNF-QLAARNIPNINLLPVQGINVYDILR 188
                KTK        L + + +++   + + +F  L+ARN+P ++++    I+V DI+ 
Sbjct: 130 SFDAPKTKEFKQVLANLTIDSKVLVV-LESENDFAALSARNLPKVSVVTADNISVLDIVS 188

Query: 189 CSKLVLSKSAIEALED 204
             K++++++A+  +E+
Sbjct: 189 NDKMLVTQTALTQIEE 204


>gi|226356896|ref|YP_002786636.1| 50S ribosomal protein L4 [Deinococcus deserti VCD115]
 gi|259491551|sp|C1CXG5|RL4_DEIDV RecName: Full=50S ribosomal protein L4
 gi|226318886|gb|ACO46882.1| putative 50S ribosomal protein L4 [Deinococcus deserti VCD115]
          Length = 201

 Score =  117 bits (294), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 69/178 (38%), Positives = 100/178 (56%), Gaps = 5/178 (2%)

Query: 32  ILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGTGRARHSSKSVSQFRGGGKAFG 91
           IL  V+ WQ   +R G + +K R++V+ +G KMY QKGTG ARH  + V  F GGG AFG
Sbjct: 26  ILHDVVTWQLASRRRGTASTKTRAQVSKSGKKMYSQKGTGNARHGDRGVPTFVGGGVAFG 85

Query: 92  PVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNLVSKECKTKYLVTRF--RALDLS 149
           P P    + LP+KVR L L  AL+D+     ++ +D     + KTK  V+      LD S
Sbjct: 86  PKPRSYGYTLPRKVRQLGLAMALADRQDGGKLIAVDGF-DLDGKTKSFVSWAAQNGLDGS 144

Query: 150 NALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRCSKLVLSKSAIEALEDRFK 207
             ++I     D   + +ARN+    +LPV G+N YDILR  +LV+   A+E  ++  +
Sbjct: 145 ERVLI--VTDDAQTRQSARNVAWATVLPVAGLNAYDILRHDRLVIDAVALEPAQEEVE 200


>gi|118444236|ref|YP_877199.1| 50S ribosomal protein L4 [Clostridium novyi NT]
 gi|166234658|sp|A0PXU7|RL4_CLONN RecName: Full=50S ribosomal protein L4
 gi|118134692|gb|ABK61736.1| ribosomal protein L4/L1 family [Clostridium novyi NT]
          Length = 206

 Score =  117 bits (294), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 67/206 (32%), Positives = 116/206 (56%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + + N++G+  G + ++E +FA++  + +L +V+  Q   KR G   +K R+EV+  
Sbjct: 1   MPTVDLYNIEGQKVGDLQLAETVFAVEVNEDVLHQVVVAQLANKRQGNQSAKTRAEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+  GG  F P P     ++PK +R +A++ AL+ K   
Sbjct: 61  GKKPWRQKGTGRARQGSIRAPQWIHGGVVFAPKPRDYKMSIPKSMRRVAMKSALTSKVNE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+++V+++L     KTK +V    A +    LI+   + +     + RNI    ++PV  
Sbjct: 121 NELVVLESLELDAPKTKEMVKMINAFEGKKPLIV-VPESNEVIYKSVRNIEGATVVPVNN 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYDIL+  K +++K A+  +E+ +
Sbjct: 180 INVYDILKHDKFIITKEAVSKIEEVY 205


>gi|283853154|ref|ZP_06370407.1| ribosomal protein L4/L1e [Desulfovibrio sp. FW1012B]
 gi|283571412|gb|EFC19419.1| ribosomal protein L4/L1e [Desulfovibrio sp. FW1012B]
          Length = 210

 Score =  117 bits (294), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 108/206 (52%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + + +   ++ G + +  ++F ++ Q  +L  V+R Q   KR G    K R+ V+  
Sbjct: 1   MANIKLYDQGNQEIGTVELDPEVFEVEVQPELLHLVVRAQLAAKRAGTHSVKTRAFVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     +RGG    GP P      + +KVR LALR ALS K   
Sbjct: 61  GKKPWRQKGTGRARAGSTRSPLWRGGAVVHGPEPRDYTFKVNRKVRQLALRMALSAKLGD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             ++++D L   E KTK +V       L  ALI+     D N +L+ARNIP I ++    
Sbjct: 121 ASLVLVDTLAVPEVKTKLMVKVTSDFGLKKALIVLPAS-DNNLELSARNIPGIKVVREDM 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVYDILR   LV+ K A   +++R 
Sbjct: 180 LNVYDILRHDHLVMVKDAALKVQERL 205


>gi|322812576|pdb|3PYO|E Chain E, Crystal Structure Of A Complex Containing Domain 3 From
           The Psiv Igr Ires Rna Bound To The 70s Ribosome. This
           File Contains The 50s Subunit Of The First 70s Ribosome.
 gi|322812629|pdb|3PYR|E Chain E, Crystal Structure Of A Complex Containing Domain 3 From
           The Psiv Igr Ires Rna Bound To The 70s Ribosome. This
           File Contains The 50s Subunit Of The Second 70s
           Ribosome.
 gi|322812682|pdb|3PYT|E Chain E, Crystal Structure Of A Complex Containing Domain 3 Of Crpv
           Igr Ires Rna Bound To The 70s Ribosome. This File
           Contains The 50s Subunit Of The First 70s Ribosome.
 gi|322812735|pdb|3PYV|E Chain E, Crystal Structure Of A Complex Containing Domain 3 Of Crpv
           Igr Ires Rna Bound To The 70s Ribosome. This File
           Contains The 50s Subunit Of The Second 70s Ribosome
          Length = 202

 Score =  117 bits (294), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 99/178 (55%), Gaps = 6/178 (3%)

Query: 32  ILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGTGRARHSSKSVSQFRGGGKAFG 91
           +L  V+RWQ  ++R G + +K R EVAY+G K++ QK TGRARH       F GGG  FG
Sbjct: 27  LLWEVVRWQLAKRRRGTASTKTRGEVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFG 86

Query: 92  PVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNLVSKECKTKYLVTRFRALDLSNA 151
           P P    + LPKKVR   L  A++D+     +++++       KTK  +   +   L  +
Sbjct: 87  PKPRDYSYTLPKKVRKKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDGS 146

Query: 152 ---LIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRCSKLVLSKSAIEALEDRF 206
              L++ G +L R    AARN+P +  L  +G+NVYDI+R  +LV+   A E  ++R 
Sbjct: 147 ESVLLVTGNELVRR---AARNLPWVVTLAPEGLNVYDIVRTERLVMDLDAWEVFQNRI 201


>gi|315640160|ref|ZP_07895282.1| 50S ribosomal protein L4 [Enterococcus italicus DSM 15952]
 gi|315484137|gb|EFU74611.1| 50S ribosomal protein L4 [Enterococcus italicus DSM 15952]
          Length = 207

 Score =  117 bits (294), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 64/195 (32%), Positives = 110/195 (56%)

Query: 10  DGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKG 69
           DG   G I+++E+IF ++P + ++   +  Q    R G    K RS V   G K + QKG
Sbjct: 10  DGSQNGEITLNEEIFGIEPNESVVFDAIIMQRASLRQGTHAVKNRSAVRGGGRKPWRQKG 69

Query: 70  TGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNL 129
           TGRAR  S    Q+RGGG  FGP P    + LPKKVR LA++  LS+K  SN+++ ++ L
Sbjct: 70  TGRARQGSIRSPQWRGGGVVFGPTPRSYSYKLPKKVRRLAMKSVLSEKVASNNLVAVEAL 129

Query: 130 VSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRC 189
                KTK        L +   +++   + +    L+ARN+PN++++    ++V D++  
Sbjct: 130 SFDAPKTKEFKQVLANLSIDAKVLVVLEEGNDFVALSARNLPNVSVVSADNVSVLDVVSN 189

Query: 190 SKLVLSKSAIEALED 204
           +K++ +++A+  +E+
Sbjct: 190 NKVLATQTALTQIEE 204


>gi|39938687|ref|NP_950453.1| 50S ribosomal protein L4 [Onion yellows phytoplasma OY-M]
 gi|46577157|sp|P61067|RL4_ONYPE RecName: Full=50S ribosomal protein L4
 gi|39721796|dbj|BAD04286.1| ribosomal protein L4 [Onion yellows phytoplasma OY-M]
          Length = 207

 Score =  117 bits (294), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 112/207 (54%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N  G+      ++  +F +KP Q +L  V+  Q    R G   +K R+ VA  
Sbjct: 1   MPKINILNQQGDFVSEKVLATTVFDIKPNQQVLYDVVNAQRAAMRQGTHATKTRALVAGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRARH S     +RGGG  FGP P      + +KVRSLAL+ ALS +  +
Sbjct: 61  GKKPWRQKGTGRARHGSIRSPLWRGGGVTFGPSPRDYSVKVNQKVRSLALKSALSLQAKN 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N ++V+DN+     KTK      + L++++  +I   Q+     LA+RN+  I L     
Sbjct: 121 NQLVVVDNINLATHKTKDFQQMLQKLNITSKSLIVVTQMTEQLALASRNLSYITLETASH 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRFK 207
            +VY IL C +LVL+ +A+   E+  K
Sbjct: 181 ASVYQILNCKQLVLTAAAVNYFEEVLK 207


>gi|291547983|emb|CBL21091.1| LSU ribosomal protein L4P [Ruminococcus sp. SR1/5]
          Length = 206

 Score =  117 bits (294), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 112/206 (54%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  ++V N++G + G + +++ +F ++  + ++   +  Q    R G  K+K RSEV   
Sbjct: 1   MANVTVYNMEGNEVGTMELNDAVFGVEINEHLVHLAVVRQLANNRQGTQKAKTRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+ GGG  F PVP      + KK R  AL+ AL+ K   
Sbjct: 61  GRKPWRQKGTGHARQGSIRAPQWTGGGVVFAPVPRDYEVKMNKKERRAALKSALTSKVQD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N ++V+D+L   E KTK +      L    AL+I     D+N  L+ARNI ++       
Sbjct: 121 NKLVVVDSLALAEVKTKEMQKVLTNLKAEKALVITADN-DQNVVLSARNIADVETATPAT 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           IN YD+++ + +V++K A+ ++E+ +
Sbjct: 180 INTYDVMKHNTVVVTKDAVASIEEVY 205


>gi|300814627|ref|ZP_07094878.1| 50S ribosomal protein L4 [Peptoniphilus sp. oral taxon 836 str.
           F0141]
 gi|300511246|gb|EFK38495.1| 50S ribosomal protein L4 [Peptoniphilus sp. oral taxon 836 str.
           F0141]
          Length = 207

 Score =  117 bits (294), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 72/206 (34%), Positives = 112/206 (54%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ + N++G     I V+++IF     + ++  V++     +R G   +K RSEV   
Sbjct: 1   MAKIQMINIEGNPVSEIEVNDNIFNCDVNEHVVYLVVKNILANRRQGTHSAKTRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    QFRGGG  F   P    +  PKKVR LAL+  L+ K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQFRGGGVVFAKKPRDYSYTTPKKVRRLALKSVLTSKLQD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           ++I+V+D L   E KTK +V   + +      +I     + N   ++RNI  +    V+ 
Sbjct: 121 SEIIVLDKLELNEIKTKTVVNILKDIKADKKALIVINDKNENIIRSSRNIEGVKTEFVKN 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYD+L+ + LV++K A++ LE+ F
Sbjct: 181 INVYDLLKYNSLVITKDALDTLEEVF 206


>gi|227871801|ref|ZP_03990205.1| ribosomal protein L4 [Oribacterium sinus F0268]
 gi|227842364|gb|EEJ52590.1| ribosomal protein L4 [Oribacterium sinus F0268]
          Length = 206

 Score =  117 bits (294), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 70/206 (33%), Positives = 113/206 (54%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +SV N+ G++ G + +++ IFA    + +L   +  Q   KR G  K+  R+EV+  
Sbjct: 1   MANVSVFNMQGKEVGKMDLNDAIFAAPVHEHLLHLAVVAQLANKRQGTQKALTRAEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q++GGG  F P P      + KK +  AL+ ALS+    
Sbjct: 61  GRKPWRQKGTGHARQGSIRAPQWKGGGVVFAPTPRDYTTGMNKKEKRAALKSALSNAVAE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N ++V+D +   E KTK   +   A  ++ A ++   Q D+N  L+ARNI N+    V  
Sbjct: 121 NKLIVLDEIRFDEIKTKNFQSMLDAFKVNKAFVLLD-QNDQNTVLSARNIQNVKTAQVNE 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVYD+L+   ++ +K+A+  LE+ +
Sbjct: 180 LNVYDVLKYGTVLATKAALLKLEEVY 205


>gi|255659504|ref|ZP_05404913.1| ribosomal protein L4/L1 family protein [Mitsuokella multacida DSM
           20544]
 gi|260848056|gb|EEX68063.1| ribosomal protein L4/L1 family protein [Mitsuokella multacida DSM
           20544]
          Length = 207

 Score =  117 bits (294), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 75/207 (36%), Positives = 113/207 (54%), Gaps = 2/207 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  ++V ++     G I +++ IF ++   G+L + +  Q   +R+G   +K R  V   
Sbjct: 1   MATVAVYDITNNQVGDIELNDSIFGVEMNAGLLHQAVVMQLAAQRLGTHATKTRGFVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     + GGG  FGP P     ++P+K R LAL+ ALSDK  S
Sbjct: 61  GRKPWKQKGTGRARAGSTRSPLWVGGGTVFGPHPRKYAFSMPRKQRRLALKCALSDKVKS 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDL-SNALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
            D++V+++L     KTK +V       + S AL I   + + N + +ARNIP    +   
Sbjct: 121 GDLIVLESLDFDAPKTKQVVKMLGDFGVDSKALFITADEAE-NVEKSARNIPGAKAIQAL 179

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRF 206
           G+NVYDIL   KL ++K AI  +E+ F
Sbjct: 180 GLNVYDILHHDKLFITKDAITRIEEVF 206


>gi|291533620|emb|CBL06733.1| LSU ribosomal protein L4P [Megamonas hypermegale ART12/1]
          Length = 207

 Score =  117 bits (293), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 114/204 (55%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +++V  + G+  G I ++E +F ++  +G++ + +  Q   +R+G   +K R  V   
Sbjct: 1   MPKVAVYTVAGQQIGDIELNESVFGVEVNEGLVHQAVVMQLAAQRLGTHATKTRGLVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     + GGG  FGP P      +P+K R LA++ AL+DK  +
Sbjct: 61  GRKPWKQKGTGRARSGSTRSPLWVGGGTVFGPSPRSYAFRMPRKQRRLAIKCALTDKVNN 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            D +V+++L     KTK +V      +++   +I    +  N + ++RNIP +  +   G
Sbjct: 121 GDFIVLESLDFAAPKTKEVVKMMSDFNVAEKALIVTADVVENVEKSSRNIPGVKAISSCG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +NVYDIL  +KL ++K AI  +E+
Sbjct: 181 LNVYDILNHNKLFITKDAITRIEE 204


>gi|268609592|ref|ZP_06143319.1| 50S ribosomal protein L4 [Ruminococcus flavefaciens FD-1]
          Length = 207

 Score =  117 bits (293), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 115/207 (55%), Gaps = 2/207 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGIL-ARVLRWQSWRKRIGCSKSKGRSEVAY 59
           M  +SV ++ G+      +++++F + P +G++ A V+ + +  +R G   +  R+EV+ 
Sbjct: 1   MSTISVFDMTGKQVSETELNDEVFGITPNEGVMHAAVVNYLA-NQRQGTQSTLTRTEVSG 59

Query: 60  TGSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFC 119
            G K + QKGTG AR  S    Q+  GG A GP P    +AL KKV+ LA++ ALS K  
Sbjct: 60  GGRKPWRQKGTGHARQGSTRAPQWVHGGIALGPKPRDYRYALNKKVKRLAMKSALSTKVI 119

Query: 120 SNDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
            N+++V+D L  +  KTK +V   +AL +    +I   + D     +A NIP +    V 
Sbjct: 120 DNNMIVLDALTLESYKTKPVVEMLKALGVEGKALIVTAEADAKVIKSAANIPGVKTAAVN 179

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRF 206
            +NVYDIL   K ++ K+A+  +E+ +
Sbjct: 180 TLNVYDILNYDKFIVVKNAVGKIEEVY 206


>gi|160881784|ref|YP_001560752.1| ribosomal protein L4/L1e [Clostridium phytofermentans ISDg]
 gi|189029497|sp|A9KJJ3|RL4_CLOPH RecName: Full=50S ribosomal protein L4
 gi|160430450|gb|ABX44013.1| ribosomal protein L4/L1e [Clostridium phytofermentans ISDg]
          Length = 206

 Score =  117 bits (293), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 66/206 (32%), Positives = 115/206 (55%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + V N++G++ G + +++ IF ++  + ++   +  Q   KR G   +K R+EV+  
Sbjct: 1   MANVKVYNIEGKEVGSLELNDAIFGVEVNEHLMHMAVVSQLANKRQGTQSAKTRAEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q++GGG  F P P      + +K +SLA++ AL+ +  +
Sbjct: 61  GRKPWRQKGTGHARQGSTRSPQWKGGGVVFAPKPRDYSFKMNRKEKSLAIKSALTSRVEA 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             ++V+D++   E KTK        L ++ AL++   + D N  L+ARNIP +       
Sbjct: 121 QKLIVLDSMNMDEIKTKKFKAVLENLKVNKALVVLDKK-DENVILSARNIPTVRTATSNA 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYDI++   LV++K A+  +E+ +
Sbjct: 180 INVYDIVKYDTLVITKDAVAQIEEVY 205


>gi|73748317|ref|YP_307556.1| 50S ribosomal protein L4 [Dehalococcoides sp. CBDB1]
 gi|147669097|ref|YP_001213915.1| 50S ribosomal protein L4 [Dehalococcoides sp. BAV1]
 gi|289432365|ref|YP_003462238.1| ribosomal protein L4/L1e [Dehalococcoides sp. GT]
 gi|109893591|sp|Q3ZZM3|RL4_DEHSC RecName: Full=50S ribosomal protein L4
 gi|189029500|sp|A5FRZ0|RL4_DEHSB RecName: Full=50S ribosomal protein L4
 gi|73660033|emb|CAI82640.1| ribosomal protein L4 [Dehalococcoides sp. CBDB1]
 gi|146270045|gb|ABQ17037.1| LSU ribosomal protein L4P [Dehalococcoides sp. BAV1]
 gi|288946085|gb|ADC73782.1| ribosomal protein L4/L1e [Dehalococcoides sp. GT]
          Length = 210

 Score =  117 bits (293), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 71/203 (34%), Positives = 107/203 (52%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +E+ V N  GE    I++SED+F +   + ++ +    Q    R G   +K R EV  + 
Sbjct: 1   MEIPVYNASGEIVKNINISEDVFGVPFNEALVHQAFVAQQANARQGTQSTKTRGEVQGSS 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTG AR  +      R GG AFGP P      LPKK+R  A+R  LS K  S 
Sbjct: 61  RKIYRQKGTGNARMGTNRSPVRRHGGVAFGPRPRDFSKDLPKKMRRQAIRCVLSFKLESG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           ++ VID L   E KT+ +     AL + +  +I     D NF  +ARNIP +   P   +
Sbjct: 121 ELKVIDQLSFDEPKTRDMAKILTALQVISPTLIAVDNPDTNFIKSARNIPAVKTTPANLL 180

Query: 182 NVYDILRCSKLVLSKSAIEALED 204
           N+ D+L+  +LV+++ A+  +E+
Sbjct: 181 NISDMLKNKQLVMTEEAVRQVEE 203


>gi|253581391|ref|ZP_04858617.1| LSU ribosomal protein L1E [Fusobacterium varium ATCC 27725]
 gi|251836755|gb|EES65289.1| LSU ribosomal protein L1E [Fusobacterium varium ATCC 27725]
          Length = 210

 Score =  117 bits (293), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 71/208 (34%), Positives = 111/208 (53%), Gaps = 5/208 (2%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  L++ +L G   G + V + +F ++P Q +L  VL  +    R G + +K R+ V   
Sbjct: 1   MAVLNIYDLTGTQTGTVEVKDTVFGIEPNQAVLHEVLTAELAAARQGTAATKTRAMVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  +       GGG  FGP P      + KKVR+LALR ALS K  +
Sbjct: 61  GRKPFKQKGTGRARQGTIRAPHMVGGGVTFGPHPRSYEKKVNKKVRNLALRSALSAKVAN 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNA--LIIDGC--QLDRNFQLAARNIPNINLL 176
            DI+V+D  +    KTK ++    A++ +     +++    Q D N  L+ RN+ N  +L
Sbjct: 121 GDILVLDGTIDT-PKTKTIIALTNAINATTKQLFVVNDLAEQADYNLYLSVRNLENAVVL 179

Query: 177 PVQGINVYDILRCSKLVLSKSAIEALED 204
               I VY +L+  K++L+K A+  +E+
Sbjct: 180 QPNEIGVYWLLKQEKVILTKEALTTIEE 207


>gi|255994808|ref|ZP_05427943.1| ribosomal protein L4/L1 family protein [Eubacterium saphenum ATCC
           49989]
 gi|255993521|gb|EEU03610.1| ribosomal protein L4/L1 family protein [Eubacterium saphenum ATCC
           49989]
          Length = 207

 Score =  117 bits (293), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 66/206 (32%), Positives = 112/206 (54%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M E+++  ++G+D G + +S+ +F + P +  +  V++      R G   +K R +V   
Sbjct: 1   MSEVNMMTIEGKDAGKLKLSDAVFGITPNENAVREVIKNFLANNRQGTQSAKTRGDVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S +     GGG AF P P    + LPKKV+ LA+  ALS K  +
Sbjct: 61  GRKPFRQKGTGRARQGSTTDPTKVGGGVAFAPKPRSYSYTLPKKVKKLAMISALSSKAQN 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            +++V+D L   + +TK +V   + +  +   +I     D     +A NIPN+    V  
Sbjct: 121 KELIVLDKLEIADYRTKDVVEMLKNVKAAKKALIVTADKDEKVVKSAANIPNVETTNVSR 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVY+I+  +  + +K+AIE +E+ +
Sbjct: 181 MNVYEIVNHTNFIATKAAIEKIEEVY 206


>gi|307694151|ref|ZP_07636388.1| 50S ribosomal protein L4 [Ruminococcaceae bacterium D16]
          Length = 206

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 70/206 (33%), Positives = 113/206 (54%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M + +V N+ G+  G I +SE +F ++P Q ++  V++      R G   +  R+EV+  
Sbjct: 1   MAKANVFNMAGQQVGEIELSEAVFGIEPNQAVVHEVVKNHLANCRQGTQSALTRAEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+  GG  F P P    + L KKV+ LAL+ ALS K  S
Sbjct: 61  GKKPWRQKGTGHARQGSTRAPQWTHGGIVFAPKPRDYSYTLNKKVKRLALKSALSAKAAS 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            DI+V+D L     KTK +     A++   +++I   +++     +ARNIP +     + 
Sbjct: 121 GDILVVDELKLDAIKTKDMRNFLNAVEAGKSVVIT-PEVNEIVVKSARNIPGVVTTTAKI 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           ++VYDI+   +LV+ K+A+  +E+ F
Sbjct: 180 LSVYDIVNAKRLVIDKAALAIIEEVF 205


>gi|302388713|ref|YP_003824534.1| LSU ribosomal protein L4P [Thermosediminibacter oceani DSM 16646]
 gi|302199341|gb|ADL06911.1| LSU ribosomal protein L4P [Thermosediminibacter oceani DSM 16646]
          Length = 208

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 73/208 (35%), Positives = 121/208 (58%), Gaps = 4/208 (1%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N+ G+  G + +S+ +F ++ +  ++ +V+      +R+G + +K R+EV   
Sbjct: 1   MPKVALYNMQGQQVGEVELSDSVFGVEVKPEVMHQVVLNYLANQRVGTASTKTRAEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRARH S     +R GG  FGP P    + LPKK++ LAL+ ALS K   
Sbjct: 61  GRKPWRQKGTGRARHGSIRSPLWRKGGIVFGPKPRSYKYTLPKKLKRLALKSALSAKVRD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRAL--DLSNALIIDGCQLDRNFQLAARNIPNINLLPV 178
           N+I+V+D L  +  KTK +V     L  D  + +++D    D N   +ARNIP +    V
Sbjct: 121 NEIIVLDRLTMEAPKTKEMVKVLSNLKADTKSLIVLDAS--DVNVVKSARNIPGVTTTTV 178

Query: 179 QGINVYDILRCSKLVLSKSAIEALEDRF 206
             +NVYDIL   KL+++  A++ +E+ +
Sbjct: 179 NTLNVYDILNHDKLIMTMDAVKRVEEVY 206


>gi|188584837|ref|YP_001916382.1| LSU ribosomal protein L4P [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|226730697|sp|B2A4E0|RL4_NATTJ RecName: Full=50S ribosomal protein L4
 gi|179349524|gb|ACB83794.1| LSU ribosomal protein L4P [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 207

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 68/207 (32%), Positives = 114/207 (55%), Gaps = 2/207 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N +G   G I++ + IFA    + ++   +      KR G + +K RSEV   
Sbjct: 1   MPKVALYNNEGSQVGEITLDDSIFATDINETLMHEAVNMHLASKRRGTASAKTRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRARH S     + GGG +F P P    + +PKK +  A++ AL+ K  +
Sbjct: 61  GRKPWRQKGTGRARHGSIRSPIWVGGGISFAPKPRDYSYKMPKKAKRKAIKSALTTKLNN 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSN-ALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
            +I++++ L  +  KTK ++     L +++ A+I+ G   D N   + RNIP ++     
Sbjct: 121 GEIVILEELTMEAPKTKKIIEMLENLSINHKAMIVTGAS-DLNVYRSTRNIPGVSSALAN 179

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRF 206
            +NVYD+L    LVL+K A+  +E+ F
Sbjct: 180 NLNVYDVLNHDYLVLTKDAVSVIEEVF 206


>gi|257470827|ref|ZP_05634917.1| 50S ribosomal protein L4 [Fusobacterium ulcerans ATCC 49185]
 gi|317065031|ref|ZP_07929516.1| 50S ribosomal protein L4 [Fusobacterium ulcerans ATCC 49185]
 gi|313690707|gb|EFS27542.1| 50S ribosomal protein L4 [Fusobacterium ulcerans ATCC 49185]
          Length = 210

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 71/208 (34%), Positives = 111/208 (53%), Gaps = 5/208 (2%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  L++ +L G   G + V + +F ++P Q +L  VL  +    R G + +K R+ V   
Sbjct: 1   MAVLNIYDLTGTQTGTVEVKDTVFGIEPNQAVLHEVLTAELAAARQGTAATKTRAMVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  +       GGG  FGP P      + KKVR+LALR ALS K  +
Sbjct: 61  GRKPFKQKGTGRARQGTIRAPHMVGGGVTFGPHPRSYEKKVNKKVRNLALRSALSAKVAN 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNA--LIIDGC--QLDRNFQLAARNIPNINLL 176
            DI+V+D  +    KTK ++    A++ +     +++    Q D N  L+ RN+ N  +L
Sbjct: 121 GDILVLDGTIDT-PKTKTIIALTNAVNATTKQLFVVNDLAEQADYNLYLSVRNLENAVVL 179

Query: 177 PVQGINVYDILRCSKLVLSKSAIEALED 204
               I VY +L+  K++L+K A+  +E+
Sbjct: 180 QPNEIGVYWLLKQEKVILTKEALTTIEE 207


>gi|260558288|ref|ZP_05830484.1| ribosomal protein L4 [Enterococcus faecium C68]
 gi|260075462|gb|EEW63768.1| ribosomal protein L4 [Enterococcus faecium C68]
          Length = 207

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 64/195 (32%), Positives = 110/195 (56%)

Query: 10  DGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKG 69
           DG   G I+++E+IF ++P + ++   +  Q    R G    K RS V   G K + QKG
Sbjct: 10  DGSQNGEITLNEEIFGIEPNESVVYDAIVMQRASLRQGTHAVKNRSAVRGGGRKPWRQKG 69

Query: 70  TGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNL 129
           TGRAR  S    Q+RGGG  FGP P    + LPKKVR LA++  LS+K   N+++ I+ L
Sbjct: 70  TGRARQGSIRSPQWRGGGVVFGPTPRSYSYKLPKKVRRLAMKSVLSEKVAENNLVAIEGL 129

Query: 130 VSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRC 189
                KTK        L + + +++   + +    L+ARN+PN++++    ++V D++  
Sbjct: 130 KFDAPKTKEFKQVLANLSIDSKVLVVLEKGNDFAALSARNLPNVSVVTSDNVSVLDVVSN 189

Query: 190 SKLVLSKSAIEALED 204
           +K++ +++A+  +E+
Sbjct: 190 TKVLATQTALTQIEE 204


>gi|291532094|emb|CBK97679.1| LSU ribosomal protein L4P [Eubacterium siraeum 70/3]
 gi|291558165|emb|CBL35282.1| LSU ribosomal protein L4P [Eubacterium siraeum V10Sc8a]
          Length = 206

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 116/207 (56%), Gaps = 3/207 (1%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGIL-ARVLRWQSWRKRIGCSKSKGRSEVAY 59
           M ++SV ++ G     + ++++IF ++P   ++ A V+ + +  +R G   +  R+EV+ 
Sbjct: 1   MAKISVYDMTGAVVSDLELNDNIFGIEPNTVVMHAAVVNYLA-NQRQGTQSTLTRTEVSG 59

Query: 60  TGSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFC 119
            G K + QKGTG AR  S    Q+  GG A GP P    ++L KKV+ LAL+ ALS K  
Sbjct: 60  GGKKPWRQKGTGHARQGSTRAPQWTHGGVALGPKPRSYTYSLNKKVKRLALKSALSAKVQ 119

Query: 120 SNDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
              ++V+D++ + E KTK +V   +AL    ALI+    +D     +A NIP +      
Sbjct: 120 DGSMIVVDSITADEFKTKTIVNMLKALSADKALIVLNS-VDEKVIKSAANIPGVKTTQAN 178

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRF 206
            +NVYDIL+ +K ++ K A+  +E+ +
Sbjct: 179 TLNVYDILKYNKFIVVKDAVATIEEVY 205


>gi|237743900|ref|ZP_04574381.1| LSU ribosomal protein L1E [Fusobacterium sp. 7_1]
 gi|256027489|ref|ZP_05441323.1| 50S ribosomal protein L4 [Fusobacterium sp. D11]
 gi|260495202|ref|ZP_05815330.1| ribosomal protein L4/L1 [Fusobacterium sp. 3_1_33]
 gi|289765451|ref|ZP_06524829.1| LSU ribosomal protein L1E [Fusobacterium sp. D11]
 gi|229432931|gb|EEO43143.1| LSU ribosomal protein L1E [Fusobacterium sp. 7_1]
 gi|260197259|gb|EEW94778.1| ribosomal protein L4/L1 [Fusobacterium sp. 3_1_33]
 gi|289717006|gb|EFD81018.1| LSU ribosomal protein L1E [Fusobacterium sp. D11]
          Length = 209

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 72/206 (34%), Positives = 110/206 (53%), Gaps = 2/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  L++ NL GE  G + V++ +F ++P + +L  VL  +    R G + +K R+ V   
Sbjct: 1   MAVLNIYNLAGEQTGTVEVNDAVFGIEPNKVVLHEVLTAELAAARQGTASTKTRAMVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  +       GGG  FGP P      + KKVR+LALR ALS K  +
Sbjct: 61  GRKPFKQKGTGRARQGTIRAPHMVGGGVTFGPHPRSYEKKVNKKVRNLALRSALSAKVAA 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNA--LIIDGCQLDRNFQLAARNIPNINLLPV 178
            +I+V+D    +  KTK +V     +D       ++     D N  L+ARN+ N  +L  
Sbjct: 121 GNILVLDYDGIETPKTKVIVNLVNKVDAKQKQLFVVGDLIKDYNLYLSARNLENAVILQP 180

Query: 179 QGINVYDILRCSKLVLSKSAIEALED 204
             I VY +L+  K++L+K A+  +E+
Sbjct: 181 NEIGVYWLLKQEKVILTKEALAVVEE 206


>gi|325104867|ref|YP_004274521.1| LSU ribosomal protein L4P [Pedobacter saltans DSM 12145]
 gi|324973715|gb|ADY52699.1| LSU ribosomal protein L4P [Pedobacter saltans DSM 12145]
          Length = 209

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 70/205 (34%), Positives = 114/205 (55%), Gaps = 2/205 (0%)

Query: 2   IELSVRNLDGEDKGV-ISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           +E+ V N+ G++ G  + + E IF ++P    +   ++     +R G  KSK R+E+A +
Sbjct: 1   MEVKVLNISGKETGAKVQLPEGIFGIEPNDHAIYLDVKQYLANQRQGTHKSKQRNEIAGS 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
             K+Y QKGTG AR  S     F GGG+ FGP P      L KK++ LA + ALS K   
Sbjct: 61  TRKLYKQKGTGGARAGSIKSPLFNGGGRIFGPQPRDYSFKLNKKLKELARKSALSYKAQG 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNA-LIIDGCQLDRNFQLAARNIPNINLLPVQ 179
           N I+V+++   +  KTK  +    AL+ SN   ++   + + N  LA+RN+P   ++   
Sbjct: 121 NSILVLEDFNFETPKTKNFLNLLSALNSSNEKTLVVLAEGNENVYLASRNLPKAKVVVAS 180

Query: 180 GINVYDILRCSKLVLSKSAIEALED 204
            +N YD+L  +KLVL+  +++ LE+
Sbjct: 181 DLNTYDVLDAAKLVLTTGSVKTLEE 205


>gi|227550721|ref|ZP_03980770.1| 50S ribosomal protein L4 [Enterococcus faecium TX1330]
 gi|257878726|ref|ZP_05658379.1| ribosomal protein L4 [Enterococcus faecium 1,230,933]
 gi|257881367|ref|ZP_05661020.1| ribosomal protein L4 [Enterococcus faecium 1,231,502]
 gi|257885635|ref|ZP_05665288.1| ribosomal protein L4 [Enterococcus faecium 1,231,501]
 gi|257888020|ref|ZP_05667673.1| ribosomal protein L4 [Enterococcus faecium 1,141,733]
 gi|257890585|ref|ZP_05670238.1| ribosomal protein L4 [Enterococcus faecium 1,231,410]
 gi|257893175|ref|ZP_05672828.1| ribosomal protein L4 [Enterococcus faecium 1,231,408]
 gi|257896361|ref|ZP_05676014.1| ribosomal protein L4 [Enterococcus faecium Com12]
 gi|257899335|ref|ZP_05678988.1| ribosomal protein L4 [Enterococcus faecium Com15]
 gi|258615210|ref|ZP_05712980.1| 50S ribosomal protein L4 [Enterococcus faecium DO]
 gi|261206994|ref|ZP_05921683.1| ribosomal protein L4 [Enterococcus faecium TC 6]
 gi|289565371|ref|ZP_06445821.1| 50S ribosomal protein L4/L1 [Enterococcus faecium D344SRF]
 gi|293379447|ref|ZP_06625591.1| ribosomal protein L4/L1 family protein [Enterococcus faecium PC4.1]
 gi|293553880|ref|ZP_06674486.1| ribosomal protein L4/L1 family [Enterococcus faecium E1039]
 gi|293562947|ref|ZP_06677414.1| ribosomal protein L4/L1 family [Enterococcus faecium E1162]
 gi|293567930|ref|ZP_06679271.1| ribosomal protein L4/L1 family [Enterococcus faecium E1071]
 gi|293570685|ref|ZP_06681735.1| ribosomal protein L4/L1 family [Enterococcus faecium E980]
 gi|294615392|ref|ZP_06695265.1| ribosomal protein L4/L1 family [Enterococcus faecium E1636]
 gi|294618319|ref|ZP_06697900.1| ribosomal protein L4/L1 family [Enterococcus faecium E1679]
 gi|294621079|ref|ZP_06700270.1| ribosomal protein L4/L1 [Enterococcus faecium U0317]
 gi|314937609|ref|ZP_07844935.1| ribosomal protein L4/L1 family protein [Enterococcus faecium
           TX0133a04]
 gi|314942892|ref|ZP_07849705.1| ribosomal protein L4/L1 family protein [Enterococcus faecium
           TX0133C]
 gi|314947972|ref|ZP_07851376.1| ribosomal protein L4/L1 family protein [Enterococcus faecium
           TX0082]
 gi|314950889|ref|ZP_07853958.1| ribosomal protein L4/L1 family protein [Enterococcus faecium
           TX0133A]
 gi|314991463|ref|ZP_07856940.1| ribosomal protein L4/L1 family protein [Enterococcus faecium
           TX0133B]
 gi|314995016|ref|ZP_07860136.1| ribosomal protein L4/L1 family protein [Enterococcus faecium
           TX0133a01]
 gi|227180182|gb|EEI61154.1| 50S ribosomal protein L4 [Enterococcus faecium TX1330]
 gi|257812954|gb|EEV41712.1| ribosomal protein L4 [Enterococcus faecium 1,230,933]
 gi|257817025|gb|EEV44353.1| ribosomal protein L4 [Enterococcus faecium 1,231,502]
 gi|257821491|gb|EEV48621.1| ribosomal protein L4 [Enterococcus faecium 1,231,501]
 gi|257824074|gb|EEV51006.1| ribosomal protein L4 [Enterococcus faecium 1,141,733]
 gi|257826945|gb|EEV53571.1| ribosomal protein L4 [Enterococcus faecium 1,231,410]
 gi|257829554|gb|EEV56161.1| ribosomal protein L4 [Enterococcus faecium 1,231,408]
 gi|257832926|gb|EEV59347.1| ribosomal protein L4 [Enterococcus faecium Com12]
 gi|257837247|gb|EEV62321.1| ribosomal protein L4 [Enterococcus faecium Com15]
 gi|260078622|gb|EEW66324.1| ribosomal protein L4 [Enterococcus faecium TC 6]
 gi|289162861|gb|EFD10711.1| 50S ribosomal protein L4/L1 [Enterococcus faecium D344SRF]
 gi|291291686|gb|ADD91677.1| 50S ribosomal protein L4 [Enterococcus faecium]
 gi|291589515|gb|EFF21322.1| ribosomal protein L4/L1 family [Enterococcus faecium E1071]
 gi|291591766|gb|EFF23402.1| ribosomal protein L4/L1 family [Enterococcus faecium E1636]
 gi|291595413|gb|EFF26725.1| ribosomal protein L4/L1 family [Enterococcus faecium E1679]
 gi|291599315|gb|EFF30341.1| ribosomal protein L4/L1 [Enterococcus faecium U0317]
 gi|291601932|gb|EFF32178.1| ribosomal protein L4/L1 family [Enterococcus faecium E1039]
 gi|291605073|gb|EFF34540.1| ribosomal protein L4/L1 family [Enterococcus faecium E1162]
 gi|291609157|gb|EFF38429.1| ribosomal protein L4/L1 family [Enterococcus faecium E980]
 gi|292641970|gb|EFF60136.1| ribosomal protein L4/L1 family protein [Enterococcus faecium PC4.1]
 gi|313590742|gb|EFR69587.1| ribosomal protein L4/L1 family protein [Enterococcus faecium
           TX0133a01]
 gi|313593943|gb|EFR72788.1| ribosomal protein L4/L1 family protein [Enterococcus faecium
           TX0133B]
 gi|313596898|gb|EFR75743.1| ribosomal protein L4/L1 family protein [Enterococcus faecium
           TX0133A]
 gi|313598364|gb|EFR77209.1| ribosomal protein L4/L1 family protein [Enterococcus faecium
           TX0133C]
 gi|313642986|gb|EFS07566.1| ribosomal protein L4/L1 family protein [Enterococcus faecium
           TX0133a04]
 gi|313645570|gb|EFS10150.1| ribosomal protein L4/L1 family protein [Enterococcus faecium
           TX0082]
          Length = 207

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 64/195 (32%), Positives = 110/195 (56%)

Query: 10  DGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKG 69
           DG   G I+++E+IF ++P + ++   +  Q    R G    K RS V   G K + QKG
Sbjct: 10  DGSQNGEITLNEEIFGIEPNESVVYDAIVMQRASLRQGTHAVKNRSAVRGGGRKPWRQKG 69

Query: 70  TGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNL 129
           TGRAR  S    Q+RGGG  FGP P    + LPKKVR LA++  LS+K   N+++ I+ L
Sbjct: 70  TGRARQGSIRSPQWRGGGVVFGPTPRSYSYKLPKKVRRLAMKSVLSEKVAENNLVAIEGL 129

Query: 130 VSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRC 189
                KTK        L + + +++   + +    L+ARN+PN++++    ++V D++  
Sbjct: 130 NFDAPKTKEFKQVLANLSIDSKVLVVLEKGNDFAALSARNLPNVSVVTSDNVSVLDVVSN 189

Query: 190 SKLVLSKSAIEALED 204
           +K++ +++A+  +E+
Sbjct: 190 TKVLATQTALTQIEE 204


>gi|46577159|sp|P61069|RL4_SPIKU RecName: Full=50S ribosomal protein L4
 gi|34849394|gb|AAP58893.1| ribosomal protein L4 [Spiroplasma kunkelii CR2-3x]
          Length = 208

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 73/208 (35%), Positives = 119/208 (57%), Gaps = 4/208 (1%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L V + +G     ISV++ I+ ++P Q  +   +  Q    R G  K+K ++EV+  G
Sbjct: 1   MKLQVLDANGTSVKEISVNDAIWGIEPHQQAMFDAVIAQQASMRQGTHKTKTKTEVSGGG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIG-VHALPKKVRSLALRHALSDKFCS 120
            K + QKGTGRAR  S    Q++GGG  FGP P    +  + KKVR LA++ A S K   
Sbjct: 61  RKPWRQKGTGRARQGSIRAPQWKGGGIVFGPTPEKKYLKHVNKKVRKLAIKSAFSLKVQD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNA--LIIDGCQLDRNFQLAARNIPNINLLPV 178
            +IM+ID     +  TK +V     L ++    LII     + NF+ ++RNI  +N++  
Sbjct: 121 KNIMIIDQFGIDKPSTKAMVKVLNNLKVNGEKLLIITTEGDEVNFK-SSRNIEKVNIITS 179

Query: 179 QGINVYDILRCSKLVLSKSAIEALEDRF 206
            GIN+YD+L  +KL++++ AI+A+E+ +
Sbjct: 180 AGINIYDLLNANKLLVTEQAIKAIEEVY 207


>gi|260589278|ref|ZP_05855191.1| ribosomal protein L4/L1 family protein [Blautia hansenii DSM 20583]
 gi|331082684|ref|ZP_08331807.1| 50S ribosomal protein L4 [Lachnospiraceae bacterium 6_1_63FAA]
 gi|260540359|gb|EEX20928.1| ribosomal protein L4/L1 family protein [Blautia hansenii DSM 20583]
 gi|330400303|gb|EGG79945.1| 50S ribosomal protein L4 [Lachnospiraceae bacterium 6_1_63FAA]
          Length = 206

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 113/206 (54%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +SV N++G++ G + +++ +F ++    ++   +  Q    R G  K+K RSEV+  
Sbjct: 1   MANVSVYNMEGKEVGTMELNDAVFGVEINDHLVHLAVVRQLANNRQGTQKAKTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+ GGG  F P P      + KK R  AL+  L+ +   
Sbjct: 61  GRKPWRQKGTGHARQGSTRSPQWAGGGVVFAPTPRDYSLKMNKKERRAALKSVLTSRVQE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N ++V+D L   E KTK +      L++S AL++     D N  L+ RNIP++       
Sbjct: 121 NKLIVLDELKLDEVKTKAMQNVLNNLNVSKALVVLADN-DANVVLSTRNIPDVVTALPNT 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYD+L+ + ++L+K++  A+E+ +
Sbjct: 180 INVYDVLKYNTVILTKASAAAIEEVY 205


>gi|325479201|gb|EGC82298.1| 50S ribosomal protein L4 [Anaerococcus prevotii ACS-065-V-Col13]
          Length = 207

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 67/206 (32%), Positives = 112/206 (54%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ + N+ GE+ G + ++E +F  +  +  +  V++ Q   KR G   +K RSEV   
Sbjct: 1   MPKVDILNIKGENVGSLELNETLFNTEISEHTVYEVVKNQLANKRQGTQSAKTRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     + GGG  F P P    + +PKK+R  AL   L+ K   
Sbjct: 61  GRKPFRQKGTGRARQGSIRAPHYTGGGVVFAPKPRDYSYKVPKKLRRKALYSVLTSKVND 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+++V+++L  +  KTK      +A++  +   I   + D     + RNI  +++     
Sbjct: 121 NELIVLEDLNLENAKTKEASQVLKAINAGDKAYIVTAENDNEVYRSFRNIEGVDVSAASL 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYD+++ +KLV++K A+  LE+ F
Sbjct: 181 INVYDLVKHNKLVITKDAVAKLEEVF 206


>gi|167749438|ref|ZP_02421565.1| hypothetical protein EUBSIR_00392 [Eubacterium siraeum DSM 15702]
 gi|167657610|gb|EDS01740.1| hypothetical protein EUBSIR_00392 [Eubacterium siraeum DSM 15702]
          Length = 206

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 116/207 (56%), Gaps = 3/207 (1%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGIL-ARVLRWQSWRKRIGCSKSKGRSEVAY 59
           M ++SV ++ G     + ++++IF ++P   ++ A V+ + +  +R G   +  R+EV+ 
Sbjct: 1   MAKVSVYDMTGAVVSDLELNDNIFGIEPNTVVMHAAVVNYLA-NQRQGTQSTLTRTEVSG 59

Query: 60  TGSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFC 119
            G K + QKGTG AR  S    Q+  GG A GP P    ++L KKV+ LAL+ ALS K  
Sbjct: 60  GGKKPWRQKGTGHARQGSTRAPQWTHGGVALGPKPRSYTYSLNKKVKRLALKSALSAKVQ 119

Query: 120 SNDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
              ++V+D++ + E KTK +V   +AL    ALI+    +D     +A NIP +      
Sbjct: 120 DGSMIVVDSITADEFKTKTIVNMLKALSADKALIVLNS-VDEKVIKSAANIPGVKTTQAN 178

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRF 206
            +NVYDIL+ +K ++ K A+  +E+ +
Sbjct: 179 TLNVYDILKYNKFIVVKDAVATIEEVY 205


>gi|301772042|ref|XP_002921423.1| PREDICTED: 39S ribosomal protein L4, mitochondrial-like [Ailuropoda
           melanoleuca]
 gi|281337408|gb|EFB12992.1| hypothetical protein PANDA_010325 [Ailuropoda melanoleuca]
          Length = 294

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 72/207 (34%), Positives = 113/207 (54%), Gaps = 6/207 (2%)

Query: 5   SVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKM 64
           S+R  + E  G+  +  ++F++ P+  IL +V+ WQ   KRI  +K+K R+EV   G K 
Sbjct: 68  SLRGYEQERVGLAELHPEVFSIAPRLDILHQVVTWQKNFKRISYAKTKTRAEVRGGGRKP 127

Query: 65  YVQKGTGRARHSSKSVSQFRGGGKAFGPV-PIIGVHALPKKVRSLALRHALSDKFCSNDI 123
           + QKG+GR+RH S     +RGGG A GP  P    + LP KVR   L+ AL+ K   +D+
Sbjct: 128 WPQKGSGRSRHGSIRSPIWRGGGIAHGPRGPTSYYYMLPMKVRVQGLKVALTVKLAQDDL 187

Query: 124 MVIDNLVSKECKTKYL--VTRFRALDLSNALIIDGCQLD--RNFQLAARNIPNINLLPVQ 179
            ++D+L       +YL  + R+R     + L++D    D  +N   AA  +   NL+P  
Sbjct: 188 HIVDSLELPTSDPQYLTELARYRRWG-DSVLLVDLAHDDMPQNIVAAASGLKTFNLIPAV 246

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRF 206
           G+NVY +L+   LVL+   +  LE + 
Sbjct: 247 GLNVYSMLKHQTLVLTLQTVAFLEQKL 273


>gi|29374852|ref|NP_814005.1| 50S ribosomal protein L4 [Enterococcus faecalis V583]
 gi|46577230|sp|Q839G3|RL4_ENTFA RecName: Full=50S ribosomal protein L4
 gi|29342310|gb|AAO80076.1| ribosomal protein L4 [Enterococcus faecalis V583]
          Length = 207

 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 107/195 (54%)

Query: 10  DGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKG 69
           DG   G I+++E+IF ++P + ++   +  Q    R G    K RS V   G K + QKG
Sbjct: 10  DGTQNGEITLNEEIFGIEPNESVVYDAIIMQRASLRQGTHAVKNRSAVRGGGRKPWRQKG 69

Query: 70  TGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNL 129
           TGRAR  S    Q+RGGG  FGP P    +  PKKVR LA++  LSDK   N+++ ++ L
Sbjct: 70  TGRARQGSIRSPQWRGGGVVFGPTPRSYSYKFPKKVRRLAMKSVLSDKVAENNLVAVEGL 129

Query: 130 VSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRC 189
                KTK        L +   +++     +    L+ARN+PN++++    ++V D++  
Sbjct: 130 SFDAPKTKEFKQVLANLSIDTKVLVVLENGNDFAALSARNLPNVSVVTSDNVSVLDVVSA 189

Query: 190 SKLVLSKSAIEALED 204
           +K++ +++A+  +E+
Sbjct: 190 NKVLATQTALTQIEE 204


>gi|330718971|ref|ZP_08313571.1| 50S ribosomal protein L4 [Leuconostoc fallax KCTC 3537]
          Length = 207

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 110/203 (54%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +++V   DG     I +++ +F ++P   ++   +  Q    R G    K RS V+  
Sbjct: 1   MTKVAVLKQDGSQATEIELNDAVFGVEPNNAVVTDAVLMQRAALRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + + +K   LAL+ ALS K   
Sbjct: 61  GKKPWKQKGTGRARQGSTRSPQWRGGGVVFGPTPRSYAYRINRKSYQLALKSALSQKVSE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           + ++V+D L  +  KTK        L + + +++   + + N  L+ARN+ N+ ++  +G
Sbjct: 121 SKLLVVDALSFETPKTKAFGQVLANLSVDSKVLVIVDEDNDNAILSARNLNNVQVMTAKG 180

Query: 181 INVYDILRCSKLVLSKSAIEALE 203
           INV D++   KLV+ +SAIE ++
Sbjct: 181 INVLDVVNADKLVIVQSAIEEIQ 203


>gi|56417002|ref|YP_154076.1| 50S ribosomal protein L4 [Anaplasma marginale str. St. Maries]
 gi|222475370|ref|YP_002563787.1| 50S ribosomal protein L4 (rplD) [Anaplasma marginale str. Florida]
 gi|81599118|sp|Q5PA59|RL4_ANAMM RecName: Full=50S ribosomal protein L4
 gi|254803710|sp|B9KJ69|RL4_ANAMF RecName: Full=50S ribosomal protein L4
 gi|56388234|gb|AAV86821.1| 50S ribosomal protein L4 [Anaplasma marginale str. St. Maries]
 gi|222419508|gb|ACM49531.1| 50S ribosomal protein L4 (rplD) [Anaplasma marginale str. Florida]
          Length = 208

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 72/208 (34%), Positives = 114/208 (54%), Gaps = 6/208 (2%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +E++V N+  E  G + +S ++F ++ ++ +L  V+ WQ  ++R G  K++  S+V+ T 
Sbjct: 1   MEVNVVNIKNEVVGKVQLSAEVFGVQLRRDVLRDVVTWQLAKRRAGTHKTRCISDVSGTT 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +K Y QK TGRAR  S    QFRGG   FGPV     ++L KKVR L L+ ALS K   +
Sbjct: 61  AKPYRQKHTGRARQGSLRSPQFRGGAVVFGPVNRSHAYSLNKKVRRLGLKVALSMKVSDS 120

Query: 122 DIMVIDN---LVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPV 178
            ++V+D+   L+ K          F A     + ++     +     A RN+PN++LL  
Sbjct: 121 KLVVLDDSGLLLEKTADAHVAFGNFGA---HGSYLVVAETYEDKVMCACRNLPNVDLLKY 177

Query: 179 QGINVYDILRCSKLVLSKSAIEALEDRF 206
            GINV DILR   ++L+   ++ LE R 
Sbjct: 178 AGINVLDILRHDCVILTVGTVKCLESRL 205


>gi|160902255|ref|YP_001567836.1| 50S ribosomal protein L4 [Petrotoga mobilis SJ95]
 gi|189029512|sp|A9BHA4|RL4_PETMO RecName: Full=50S ribosomal protein L4
 gi|160359899|gb|ABX31513.1| ribosomal protein L4/L1e [Petrotoga mobilis SJ95]
          Length = 221

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 70/218 (32%), Positives = 118/218 (54%), Gaps = 14/218 (6%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ + N+  E  G + + ++IF + P   +L R +  Q   KR G + +K RSEV+  
Sbjct: 1   MSQIDIYNIQNEKVGTLDIKDEIFNIDPNMDVLYRYVDMQLTNKRAGTASTKTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QK TGRAR  S     FR GG  FGP P      L KK++ LAL+ ALS ++  
Sbjct: 61  GRKPWPQKHTGRARAGSIRSPLFRHGGVTFGPKPREFHKDLNKKMKRLALKSALSVRYRE 120

Query: 121 NDIMVIDNLVSKECKT---KYLVTRFRALDLSNALIIDGCQLD-RNFQLAARNIPNINLL 176
           N+++V+D +  ++ +T   K ++++F   D     +    Q    NF+L+ARN+P + ++
Sbjct: 121 NNLIVLDEVKFEKPRTKDVKNILSKFGMEDTKVLFLFPYHQEQYENFKLSARNLPKVKVI 180

Query: 177 ----------PVQGINVYDILRCSKLVLSKSAIEALED 204
                      V G+NV+D++   K+VL+K  +  +E+
Sbjct: 181 IADNPGQNKKNVDGLNVFDLINSEKIVLTKEMVNKIEE 218


>gi|312130548|ref|YP_003997888.1| lsu ribosomal protein l4p [Leadbetterella byssophila DSM 17132]
 gi|311907094|gb|ADQ17535.1| LSU ribosomal protein L4P [Leadbetterella byssophila DSM 17132]
          Length = 209

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 71/210 (33%), Positives = 113/210 (53%), Gaps = 6/210 (2%)

Query: 2   IELSVRNLDGEDKG-VISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           +E+ V N  G++ G  + +SE++F ++P Q ++   ++     +R G  KSK R+EVA +
Sbjct: 1   MEVKVINKTGQETGKTLKLSEEVFGIEPNQHVVWLDVKHYLAAQRQGTHKSKERAEVARS 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
             K+  QKG+G ARH S     + GGG+ FGP P      L  KV+ LA +  LS +   
Sbjct: 61  TKKLLRQKGSGGARHGSAKAPIYVGGGRVFGPRPRNYDFKLNLKVKQLARKSVLSARLAE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNA---LIIDGCQLDRNFQLAARNIPNINLLP 177
           N + V+++      KTK  V    AL LS      +++G +   N  L+ARNIP   ++ 
Sbjct: 121 NQLKVVEDFGFDTPKTKAYVEFLNALSLSGKKTLFVVNGSE--NNLYLSARNIPKTKVVD 178

Query: 178 VQGINVYDILRCSKLVLSKSAIEALEDRFK 207
           V  +N YD++    ++L++SAI  LE   K
Sbjct: 179 VNSVNTYDLVNTDTILLAESAISPLETILK 208


>gi|225717040|gb|ACO14366.1| Mitochondrial 39S ribosomal protein L4 [Esox lucius]
          Length = 302

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 73/201 (36%), Positives = 109/201 (54%), Gaps = 5/201 (2%)

Query: 10  DGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKG 69
           D E  G++ +  DIFA+  +  IL  V  WQ   KRI  + +K RSEV   G K + QKG
Sbjct: 82  DSEPLGLVDLHPDIFAVPARVDILHDVEMWQRSFKRISYAHTKVRSEVRGGGRKPWKQKG 141

Query: 70  TGRARHSSKSVSQFRGGGKAFGPV-PIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDN 128
           +GRARH S     +RGGG + GP  P    + LP K+R   L+ ALS K   + + V+D 
Sbjct: 142 SGRARHGSIRSPLWRGGGVSHGPRGPTSYYYMLPMKIRVQGLKIALSSKLAQDYLHVVDT 201

Query: 129 LVSKECKTKYL--VTRFRALDLSNALIIDGC-QLDRNFQLAARNIPNINLLPVQGINVYD 185
           L       +YL  + RFR     + LI+D C +   N   A  ++  +N++P  G+NV+ 
Sbjct: 202 LNIPTPDPEYLMDLIRFRYWG-ESVLIVDACEEFPENILQATESLKTVNVIPAIGLNVHS 260

Query: 186 ILRCSKLVLSKSAIEALEDRF 206
           +L+   LVL+  A++ LE++ 
Sbjct: 261 MLKHEVLVLTLEAVKFLENKL 281


>gi|217077284|ref|YP_002335002.1| 50S ribosomal protein L4 [Thermosipho africanus TCF52B]
 gi|226731434|sp|B7IHU7|RL4_THEAB RecName: Full=50S ribosomal protein L4
 gi|217037139|gb|ACJ75661.1| ribosomal protein L4/L1 family [Thermosipho africanus TCF52B]
          Length = 221

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 72/218 (33%), Positives = 120/218 (55%), Gaps = 14/218 (6%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++S+ N  GE+ G I + +++FA++P   ++ R +  Q    R G + +K R EV+  
Sbjct: 1   MAKVSLFNSKGENIGPIDLKDEVFAIEPNFDVIWRYVDMQLTNARAGTASTKTRGEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K ++QK TGRAR  S     +R GG A GP P +    L KK++ LAL+ ALS +   
Sbjct: 61  GRKPWIQKHTGRARQGSIRAPHWRHGGVAHGPKPRVYFKRLNKKMKRLALKSALSLRLKE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSN--ALIIDGCQLDR--NFQLAARNIPNINLL 176
            +++V+D +  K  KTK L    + L L N   L++   +++   N +++ RNIP + ++
Sbjct: 121 GNLIVVDEIKFKRPKTKDLREVLKNLGLENQKVLVVLPKKVEEYVNVKISGRNIPGVKVI 180

Query: 177 ----------PVQGINVYDILRCSKLVLSKSAIEALED 204
                      + G+NVYDIL   KLVL +  ++ +E+
Sbjct: 181 IADNPGVDRTNIDGLNVYDILNHDKLVLLQGTVQKIEE 218


>gi|313904951|ref|ZP_07838322.1| ribosomal protein L4/L1e [Eubacterium cellulosolvens 6]
 gi|313470208|gb|EFR65539.1| ribosomal protein L4/L1e [Eubacterium cellulosolvens 6]
          Length = 206

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 112/206 (54%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +SV N++G + G + +S+ +F ++ ++ ++ + +  Q    R G  K+K RSEV   
Sbjct: 1   MANVSVYNMEGAEVGKMELSDAVFGVEIKENLVHQAVVLQLANNRQGTQKAKTRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+ GGG  F P P      + +K +  AL+  L+ K   
Sbjct: 61  GRKPWRQKGTGHARQGSTRAPQWTGGGVVFAPTPRDYSFKMNRKEKQAALKSVLTSKVQE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N  +V+D L     KTK +     AL +  AL+I G   D N  L+ARN+  +     + 
Sbjct: 121 NKFLVLDELKFDAPKTKEMKKVIDALKVEKALVIVGKDSD-NAVLSARNLEGVATASAET 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYD+L+ + ++ +KS++ A+E+ +
Sbjct: 180 INVYDLLKYNTVIATKSSVAAIEEVY 205


>gi|19704965|ref|NP_602460.1| 50S ribosomal protein L4 [Fusobacterium nucleatum subsp. nucleatum
           ATCC 25586]
 gi|296329219|ref|ZP_06871720.1| ribosomal protein L4/L1 family protein [Fusobacterium nucleatum
           subsp. nucleatum ATCC 23726]
 gi|46577280|sp|Q8RIF6|RL4_FUSNN RecName: Full=50S ribosomal protein L4
 gi|19712867|gb|AAL93759.1| LSU ribosomal protein L1E [Fusobacterium nucleatum subsp. nucleatum
           ATCC 25586]
 gi|296153575|gb|EFG94392.1| ribosomal protein L4/L1 family protein [Fusobacterium nucleatum
           subsp. nucleatum ATCC 23726]
          Length = 209

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 71/206 (34%), Positives = 110/206 (53%), Gaps = 2/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  L++ NL GE  G + V++ +F ++P + +L  VL  +    R G + +K R+ V   
Sbjct: 1   MAVLNIYNLAGEQTGTVEVNDAVFGIEPNKVVLHEVLTAELAAARQGTASTKTRAMVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  +       GGG  FGP P      + KKVR+LALR ALS K  +
Sbjct: 61  GRKPFKQKGTGRARQGTIRAPHMVGGGVTFGPHPRSYEKKVNKKVRNLALRSALSAKVAA 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNA--LIIDGCQLDRNFQLAARNIPNINLLPV 178
            +++V+D    +  KTK +V     +D       ++     D N  L+ARN+ N  +L  
Sbjct: 121 GNVLVLDYDGIETPKTKVIVNLVNKVDAKQKQLFVVGDLIKDYNLYLSARNLENAVILQP 180

Query: 179 QGINVYDILRCSKLVLSKSAIEALED 204
             I VY +L+  K++L+K A+  +E+
Sbjct: 181 NEIGVYWLLKQEKVILTKEALATVEE 206


>gi|254517471|ref|ZP_05129527.1| ribosomal protein L4 [Clostridium sp. 7_2_43FAA]
 gi|226911220|gb|EEH96421.1| ribosomal protein L4 [Clostridium sp. 7_2_43FAA]
          Length = 206

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 67/206 (32%), Positives = 115/206 (55%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + + N +G+  G I +++++F ++     + +V+      KR G   +K R+EV   
Sbjct: 1   MPTVGLFNQEGKQVGDIQLNDNVFGVEVNTDAMHQVVVALLANKRQGTQSAKTRAEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+  GG  F P P     ++PK +R +A++ AL+ K   
Sbjct: 61  GIKPWRQKGTGRARQGSIRAPQWIKGGIVFAPKPRDYRMSVPKSMRRVAMKSALTSKVQD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             ++V++ L  +  KTK +V   +A D    LII G + +     +ARNI ++ ++PV  
Sbjct: 121 GQMVVLETLAFEAPKTKKMVEVLKAFDAKKTLIITG-ESNEVLYKSARNIADVQIMPVNN 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYD+L+  KL+++K A+  +E+ +
Sbjct: 180 INVYDLLKFEKLIITKDAVSKIEEVY 205


>gi|225016284|ref|ZP_03705476.1| hypothetical protein CLOSTMETH_00187 [Clostridium methylpentosum
           DSM 5476]
 gi|224950959|gb|EEG32168.1| hypothetical protein CLOSTMETH_00187 [Clostridium methylpentosum
           DSM 5476]
          Length = 207

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 69/206 (33%), Positives = 111/206 (53%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  ++V N+ G++   I +S+ IF ++P + +L   +      +R G   +  R+EV   
Sbjct: 1   MPNVAVMNMAGKEVSKIDLSDAIFGIEPNKAVLHMAVVNYLANQRQGTQSTLTRTEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+  GG A GP P    ++L KKV+ LA++ ALS K   
Sbjct: 61  GKKPWRQKGTGHARQGSTRSPQWTHGGVALGPKPRDYSYSLNKKVKRLAMKSALSAKAVD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           ND++V+D++   E KTK ++    AL      +I   ++D     +A NIP +    V  
Sbjct: 121 NDLIVVDSIALAEYKTKEVIKMLGALGADKKALIVLPEMDAKVIKSAANIPGVRTTQVNE 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVYDIL   KL++ ++A   +E+ +
Sbjct: 181 LNVYDILNHDKLIVVEAAAHKIEEVY 206


>gi|187776577|ref|ZP_02993050.1| hypothetical protein CLOSPO_00091 [Clostridium sporogenes ATCC
           15579]
 gi|187775236|gb|EDU39038.1| hypothetical protein CLOSPO_00091 [Clostridium sporogenes ATCC
           15579]
          Length = 206

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 66/206 (32%), Positives = 115/206 (55%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ + N +GE  G + +++ +F ++     + +V++     KR G   +K R+EV+  
Sbjct: 1   MPKVDLFNQNGEKVGDLQLADSVFGVEVNTYAMHQVVKALLANKRQGTQSAKTRAEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+  GG  F P P     ++PK ++ +A++ AL+ K   
Sbjct: 61  GIKPWRQKGTGRARQGSIRAPQWIHGGIVFAPKPRDYRMSIPKSMKKVAIKSALTSKVNE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             ++V+D++  +  KTK +V    A D    LII     + N   +ARNI  + ++PV  
Sbjct: 121 KLMVVVDDIKLETPKTKEVVKMLNAFDAKKTLIITNNS-EENVYKSARNIEGVQIIPVNN 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYD+L+  K+V++K A+  +E+ +
Sbjct: 180 INVYDVLKYDKVVITKDAVSKIEEVY 205


>gi|295093644|emb|CBK82735.1| LSU ribosomal protein L4P [Coprococcus sp. ART55/1]
          Length = 206

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 67/206 (32%), Positives = 110/206 (53%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + V +++G++   + +++ +F ++  + I+ + +  Q    R G   +K RSEV+  
Sbjct: 1   MASVKVYDIEGKEVETLELNDAVFGVEINEHIMHKAVVGQLANNRQGTQSAKTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+ GGG  F P P      + KK + LA++ ALS K   
Sbjct: 61  GRKPWRQKGTGHARQGSTRSPQWTGGGVVFAPKPRDYSVKMNKKEKQLAMKSALSSKVAE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N ++V+D L  +E KT         L    AL++   + + N  L+A NIP +       
Sbjct: 121 NKLVVVDKLDLQEAKTSVFAKILAKLSAPKALVVTKDK-NNNVVLSANNIPTVKTTVANS 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           ++VYDIL+  KLVL+K A+ A+E+ +
Sbjct: 180 LSVYDILKYEKLVLTKEAVAAIEEVY 205


>gi|163815976|ref|ZP_02207346.1| hypothetical protein COPEUT_02156 [Coprococcus eutactus ATCC 27759]
 gi|158448786|gb|EDP25781.1| hypothetical protein COPEUT_02156 [Coprococcus eutactus ATCC 27759]
          Length = 206

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 67/206 (32%), Positives = 109/206 (52%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + V +++G +   + +++ +F ++  + I+ + +  Q    R G   +K RSEV+  
Sbjct: 1   MASVKVYDIEGNEVETLELNDAVFGVEINEHIMHKAVVGQLANSRQGTQSAKTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+ GGG  F P P      + KK + LA++ ALS K   
Sbjct: 61  GRKPWRQKGTGHARQGSTRSPQWTGGGVVFAPKPRDYSVKMNKKEKQLAMKSALSSKVAE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N ++V+D L  +E KT         L    AL++   + + N  L+A NIP +       
Sbjct: 121 NKLVVVDKLELQEAKTSVFAKILAKLSAPKALVVTKDK-NNNVVLSANNIPTVKTTVANS 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           ++VYDIL+  KLVL+K A+ A+E+ +
Sbjct: 180 LSVYDILKYEKLVLTKEAVAAIEEVY 205


>gi|170759420|ref|YP_001788820.1| 50S ribosomal protein L4 [Clostridium botulinum A3 str. Loch Maree]
 gi|226730645|sp|B1KSM4|RL4_CLOBM RecName: Full=50S ribosomal protein L4
 gi|169406409|gb|ACA54820.1| 50S ribosomal protein L4 [Clostridium botulinum A3 str. Loch Maree]
          Length = 206

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 65/206 (31%), Positives = 115/206 (55%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ + N +GE  G + +++ +F ++     + +V++     KR G   +K R+EV+  
Sbjct: 1   MAKVDLFNQNGEKVGDLQLADSVFGVEVNTYAMHQVVKALLANKRQGTQSAKTRAEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+  GG  F P P     ++PK ++ +A++ AL+ K   
Sbjct: 61  GIKPWRQKGTGRARQGSIRAPQWIHGGIVFAPKPRDYRMSIPKSMKKVAIKSALTSKVNE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N ++V+D +  +  KTK +V    A +    LII     + N   +ARNI  + ++PV  
Sbjct: 121 NLMVVVDEIKLETPKTKEVVKMLNAFNAKKTLIITN-NAEENVYKSARNIEGVQIIPVNN 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYD+L+  K++++K A+  +E+ +
Sbjct: 180 INVYDVLKYDKVIITKDAVSKIEEVY 205


>gi|313680514|ref|YP_004058253.1| LSU ribosomal protein l4p [Oceanithermus profundus DSM 14977]
 gi|313153229|gb|ADR37080.1| LSU ribosomal protein L4P [Oceanithermus profundus DSM 14977]
          Length = 208

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 62/160 (38%), Positives = 89/160 (55%)

Query: 32  ILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGTGRARHSSKSVSQFRGGGKAFG 91
           +L  V+RWQ   +R G + +K R EV+Y+  K++ QKG GRARH S+  + F GGG  FG
Sbjct: 28  VLYEVVRWQLASRRRGTASTKTRGEVSYSTRKLFPQKGLGRARHGSRGANIFVGGGVVFG 87

Query: 92  PVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNLVSKECKTKYLVTRFRALDLSNA 151
           P P    + LP+KVR   L  AL+D+     +++++     E KTK  V       L  +
Sbjct: 88  PRPRDYGYTLPRKVRRAGLAMALADRAREEKLLIVEAFAGVEGKTKQFVEWASKHGLDGS 147

Query: 152 LIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRCSK 191
             +     D N + AARN+P +  L  +GINVYDILR  +
Sbjct: 148 ERVTLVTADENVRRAARNLPWVVTLSPEGINVYDILRTDR 187


>gi|182418832|ref|ZP_02950097.1| ribosomal protein L4/L1 family [Clostridium butyricum 5521]
 gi|237666492|ref|ZP_04526477.1| ribosomal protein, L4/L1 family [Clostridium butyricum E4 str. BoNT
           E BL5262]
 gi|182377329|gb|EDT74890.1| ribosomal protein L4/L1 family [Clostridium butyricum 5521]
 gi|237657691|gb|EEP55246.1| ribosomal protein, L4/L1 family [Clostridium butyricum E4 str. BoNT
           E BL5262]
          Length = 206

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 70/206 (33%), Positives = 115/206 (55%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + V N++G+    + ++E +FA +  Q  L +V+      KR G   +K RSEV   
Sbjct: 1   MPTVGVYNIEGKKVSDMELNESVFATEVNQYALHQVVVALLANKRQGTQSTKTRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+  GG  F P P     + PK +R +A++ AL+ K   
Sbjct: 61  GIKPWRQKGTGRARQGSIRAPQWIKGGIVFAPKPRDYRVSTPKSMRKVAMKSALTSKVQD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N ++V+++L     KTK +V    AL+   ALII     +  ++ +ARNI  ++++P   
Sbjct: 121 NSMIVLESLNFDAPKTKNVVAMLNALEAPKALIITAESNEAVYK-SARNIQGVSVIPANN 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYD+L+  K++++K A+  +E+ +
Sbjct: 180 INVYDLLKFDKVIMTKDAVSKIEEVY 205


>gi|159901427|ref|YP_001547674.1| 50S ribosomal protein L4/L1e [Herpetosiphon aurantiacus ATCC 23779]
 gi|159894466|gb|ABX07546.1| ribosomal protein L4/L1e [Herpetosiphon aurantiacus ATCC 23779]
          Length = 209

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 107/204 (52%), Gaps = 3/204 (1%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +E  + N  G+  G + + + IF ++P   ++ + +  Q    R+G   +K R EV  + 
Sbjct: 1   MEAKLYNQAGQAIGTLELQDYIFGIEPNIPVMHQAVIRQLANARLGTHSTKTRGEVRGST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTGRAR  +       GGG   GP P     A+P+K+R LA+R ALS K+  N
Sbjct: 61  RKLYRQKGTGRARQGAIRAPHHSGGGVVHGPKPRKYTKAMPRKMRRLAVRSALSAKYAEN 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDL--SNALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
            I+ +D+L     KTK  +   + L L     L+  G + D N  L+A N+PN+  L   
Sbjct: 121 QIIFLDDLSLNAPKTKDFLALLKNLPLVGDKTLVALGEKSD-NITLSASNLPNVKTLLAA 179

Query: 180 GINVYDILRCSKLVLSKSAIEALE 203
            +NV D+L    L+L KSA+  +E
Sbjct: 180 YLNVRDLLTYDTLILPKSALSVVE 203


>gi|253681900|ref|ZP_04862697.1| ribosomal protein, L4 [Clostridium botulinum D str. 1873]
 gi|253561612|gb|EES91064.1| ribosomal protein, L4 [Clostridium botulinum D str. 1873]
          Length = 206

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 67/206 (32%), Positives = 115/206 (55%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + + N +G+  G + ++E +FA++    +L +V+  Q   KR G   +K R+EV+  
Sbjct: 1   MPTVDLYNREGQKVGDLQLAEAVFAVEVNADVLHQVVVAQLANKRQGTQSAKTRAEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+  GG  F P P     A+PK ++ +A++ AL+ K   
Sbjct: 61  GKKPWRQKGTGRARQGSIRAPQWIHGGIVFAPKPRDYRMAIPKSMKRVAMKSALTSKVND 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            +++V++NL  +  KTK +V    A +    LI+     +  ++ + RNI    ++PV  
Sbjct: 121 QELVVLENLELEAPKTKEMVKMINAFEAKKPLIVVAESNEVVYK-SIRNIEGATVVPVNN 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYDIL+  K +++K A+  +E+ +
Sbjct: 180 INVYDILKHDKFIITKDAVAKIEEVY 205


>gi|315222819|ref|ZP_07864705.1| ribosomal protein L4/L1 family protein [Streptococcus anginosus
           F0211]
 gi|315188122|gb|EFU21851.1| ribosomal protein L4/L1 family protein [Streptococcus anginosus
           F0211]
          Length = 207

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 65/204 (31%), Positives = 109/204 (53%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + + +  G++ G + +++ +F ++P + ++  V+  Q    R G    K RS V+  
Sbjct: 1   MANVKLFDQTGKEAGEVVLNDAVFGIEPNESVVFDVVISQRASLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LP+KVR LAL+   S+K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGTVFGPTPRSYAYKLPQKVRRLALKSVYSEKVAE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N  + +D+L     KT        AL + + +++   + +    L+ARN+PN+ +     
Sbjct: 121 NKFVAVDSLSFTAPKTAEFAKVLAALSIDSKVLVILEEGNEFAALSARNLPNVKVATATT 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
            +V DI+   KL+++K AI  +E+
Sbjct: 181 ASVLDIVNSDKLLVTKEAISTIEE 204


>gi|116617330|ref|YP_817701.1| 50S ribosomal protein L4P [Leuconostoc mesenteroides subsp.
           mesenteroides ATCC 8293]
 gi|122272469|sp|Q03ZP4|RL4_LEUMM RecName: Full=50S ribosomal protein L4
 gi|116096177|gb|ABJ61328.1| LSU ribosomal protein L4P [Leuconostoc mesenteroides subsp.
           mesenteroides ATCC 8293]
          Length = 207

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 107/203 (52%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +++V   DG     I +++ +FA++P   ++   +  Q    R G    K RS V+  
Sbjct: 1   MTKVAVLKQDGSQAAEIELNDAVFAIEPNNAVITDAVLMQRASLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    QFRGGG  FGP P    + + +K   LAL+  LS K   
Sbjct: 61  GRKPWKQKGTGRARAGSIREPQFRGGGIVFGPSPRSYAYRINRKAYQLALKSVLSQKVAD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N ++V+D L  +  KT+        L      ++   + + N  L+ARN+ N+ ++  +G
Sbjct: 121 NKLVVVDALSFEAPKTQDFKKVLANLSADKKTLVVVDEDNENAILSARNLANVQVMTTKG 180

Query: 181 INVYDILRCSKLVLSKSAIEALE 203
           INV D++   KLV+ +S+IE ++
Sbjct: 181 INVLDVVNADKLVIVQSSIEEIQ 203


>gi|154483186|ref|ZP_02025634.1| hypothetical protein EUBVEN_00887 [Eubacterium ventriosum ATCC
           27560]
 gi|149735994|gb|EDM51880.1| hypothetical protein EUBVEN_00887 [Eubacterium ventriosum ATCC
           27560]
          Length = 206

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 67/206 (32%), Positives = 111/206 (53%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++SV N++G + G I +S+ +F ++  + ++ + +  Q    R G  K+K RSEV+  
Sbjct: 1   MAKVSVLNMEGSEVGTIELSDAVFGVEVNEHLVHQAVLSQLANNRQGTQKAKTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+ GGG  F P P      + KK + +AL+ AL+ +   
Sbjct: 61  GRKPWRQKGTGHARQGSTRSPQWTGGGVVFAPTPRDYSFKMNKKEKRIALKSALTSRVNE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             ++V+D L  +  KTK        L+   AL++   + D N   +A+NIP +       
Sbjct: 121 GKLIVVDELKFEAPKTKEFAKVMANLNTKKALVVLN-ENDANTVKSAKNIPTVKTALTNT 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYDIL+   +V+ K+A+  +E+ +
Sbjct: 180 INVYDILKYDTVVVEKAAVATIEEVY 205


>gi|315925255|ref|ZP_07921469.1| 50S ribosomal protein L4 [Pseudoramibacter alactolyticus ATCC
           23263]
 gi|315621489|gb|EFV01456.1| 50S ribosomal protein L4 [Pseudoramibacter alactolyticus ATCC
           23263]
          Length = 206

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 71/206 (34%), Positives = 111/206 (53%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ + ++ G       +S+ +F ++P + ++ +V+  Q   KR G   +K RSEV   
Sbjct: 1   MPKIDILDMKGNVVDSAELSDRVFGIEPNEPVVHQVVVAQLANKRQGTKGTKTRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     + GGG  F P        + KKVR+LA+R   S KF  
Sbjct: 61  GRKPWRQKGTGRARAGSSRSPLWIGGGVIFAPKARDFSKKVNKKVRNLAMRSVFSAKFAD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            ++ V+D L     KTK ++    A+D   AL++   ++D N  L+ARNIP      V  
Sbjct: 121 KELRVVDALNFDAPKTKDMIAALAAIDAGKALVVTPEKVD-NVYLSARNIPKTRATTVAE 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVYD+L+   LVL+K A+  +E+ +
Sbjct: 180 LNVYDMLKYDVLVLTKDALAKIEEVY 205


>gi|296111430|ref|YP_003621812.1| 50S ribosomal protein L4 [Leuconostoc kimchii IMSNU 11154]
 gi|295832962|gb|ADG40843.1| 50S ribosomal protein L4 [Leuconostoc kimchii IMSNU 11154]
          Length = 207

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 69/206 (33%), Positives = 112/206 (54%), Gaps = 6/206 (2%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +++V   DG     + +++ +FA++P   ++   +  Q    R G    K RS V+  
Sbjct: 1   MTKVAVLKQDGSQAAELELNDAVFAIEPNNTVITDAVLMQRASMRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    QFRGGG  FGP P    + + +K   LAL+  LS K   
Sbjct: 61  GRKPWKQKGTGRARAGSIREPQFRGGGIVFGPSPRSYAYRINRKAYQLALKSVLSQKVAE 120

Query: 121 NDIMVIDNLVSKECKT---KYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLP 177
             ++V+D L  +  KT   K ++T   A D    +++D  + + N  L+ARN+ N+ ++ 
Sbjct: 121 GKLVVVDALTFEAPKTQDFKKVLTNL-AADTKTLVVVD--ENNENAILSARNLANVQVMT 177

Query: 178 VQGINVYDILRCSKLVLSKSAIEALE 203
            +GINV D++   KLV+ +S+IE ++
Sbjct: 178 TKGINVLDVVNADKLVIVQSSIEEIQ 203


>gi|306825985|ref|ZP_07459321.1| ribosomal protein L4/L1 family protein [Streptococcus sp. oral
           taxon 071 str. 73H25AP]
 gi|304431701|gb|EFM34681.1| ribosomal protein L4/L1 family protein [Streptococcus sp. oral
           taxon 071 str. 73H25AP]
          Length = 207

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 109/204 (53%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +++ +  G+  G + +++ IF ++P Q ++  V+  Q    R G    K RS V+  
Sbjct: 1   MANVTLFDQTGKQAGEVVLNDAIFGIEPNQSVVFDVIISQRASLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LP+KVR LAL+   S+K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGTVFGPTPRSYAYKLPQKVRRLALKSVYSEKVAE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N  + +D+L     KT        AL + + +++   + +    L+ARN+PN+ +     
Sbjct: 121 NKFVAVDSLEFTAPKTAEFAKVLAALSIDSKVLVILEEGNEFAALSARNLPNVKVATATT 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
            +V DI    KL+++++AI  +E+
Sbjct: 181 ASVLDIANSDKLLVTQAAISKIEE 204


>gi|238922831|ref|YP_002936344.1| ribosomal protein L4/L1e [Eubacterium rectale ATCC 33656]
 gi|259491558|sp|C4ZBD5|RL4_EUBR3 RecName: Full=50S ribosomal protein L4
 gi|238874503|gb|ACR74210.1| ribosomal protein L4/L1e [Eubacterium rectale ATCC 33656]
 gi|291523733|emb|CBK89320.1| LSU ribosomal protein L4P [Eubacterium rectale DSM 17629]
 gi|291528801|emb|CBK94387.1| LSU ribosomal protein L4P [Eubacterium rectale M104/1]
          Length = 206

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 66/206 (32%), Positives = 110/206 (53%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  ++V N++G++   I +++ IF ++  + ++   +  Q   KR G  K+K RSEV   
Sbjct: 1   MANVAVYNMEGKEVDKIELNDSIFGVEINEHLVHMAVLQQLANKRQGTQKAKTRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+ GGG  F P P      L KK +  AL+ AL+ +   
Sbjct: 61  GRKPWRQKGTGHARQGSTRSPQWTGGGVVFAPTPRDYSFKLNKKEKRAALKSALTSRVVE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N  +V+D L   E KTK  V   + L++  AL++    +D     +A NIP +       
Sbjct: 121 NKFVVVDELKLDEIKTKKFVEVLKNLNVEKALVVLN-DMDEKVIASAANIPTVKTTQTNE 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NV+D+L+   +V++K+A+  +E+ +
Sbjct: 180 LNVFDVLKYDTVVVTKAAVATIEEVY 205


>gi|290968243|ref|ZP_06559786.1| ribosomal protein L4/L1 family protein [Megasphaera genomosp.
           type_1 str. 28L]
 gi|290781725|gb|EFD94310.1| ribosomal protein L4/L1 family protein [Megasphaera genomosp.
           type_1 str. 28L]
          Length = 207

 Score =  115 bits (289), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 63/204 (30%), Positives = 109/204 (53%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++S  N+ G   G I +++ +F ++  + ++ + L  Q   +R+G   +K R  V   
Sbjct: 1   MPKVSTYNITGAKTGEIELNDSVFGVEVNEAVMRQALLRQLANERLGTHSTKTRGLVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     + GGG  +GP P      +P+K R LA++ ALSDK  +
Sbjct: 61  GRKPWKQKGTGRARVGSSRSPLWVGGGTVWGPHPRSYAQKMPRKARRLAVKSALSDKVNT 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N++ V+D +     KTK +V   +    +   ++     D      ARNI  +  +  +G
Sbjct: 121 NELFVLDEIKLAAAKTKEVVALIKNFQFTGEKVLFVTDNDEIVIRCARNIEGVKAISTEG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +N++D+L  +KL ++KSA+  +E+
Sbjct: 181 VNIFDLLHYTKLFVTKSAVAKIEE 204


>gi|237742671|ref|ZP_04573152.1| LSU ribosomal protein L1E [Fusobacterium sp. 4_1_13]
 gi|256846066|ref|ZP_05551524.1| ribosomal protein L4/L1 [Fusobacterium sp. 3_1_36A2]
 gi|229430319|gb|EEO40531.1| LSU ribosomal protein L1E [Fusobacterium sp. 4_1_13]
 gi|256719625|gb|EEU33180.1| ribosomal protein L4/L1 [Fusobacterium sp. 3_1_36A2]
          Length = 209

 Score =  115 bits (288), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 72/206 (34%), Positives = 110/206 (53%), Gaps = 2/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  L+V NL G+  G + V++ +F ++P + +L  VL  +    R G + +K R+ V   
Sbjct: 1   MAVLNVYNLAGDQTGTLEVNDAVFGIEPNKVVLHEVLTAELAAARQGTASTKTRAMVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S       GGG  FGP P      + KKVR+LALR ALS K  +
Sbjct: 61  GRKPFKQKGTGRARQGSIRAPHMVGGGVTFGPHPRSYEKKVNKKVRNLALRSALSAKVAA 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNA--LIIDGCQLDRNFQLAARNIPNINLLPV 178
            +++V+D    +  KTK +V     +D       ++     D N  L+ARN+ N  +L  
Sbjct: 121 GNVLVLDYDGIETPKTKVIVNLVNKVDAKQKQLFVVGDLIKDYNLYLSARNLENAVILQP 180

Query: 179 QGINVYDILRCSKLVLSKSAIEALED 204
             I VY +L+  K++L+K A+  +E+
Sbjct: 181 NEIGVYWLLKQEKVILTKEALAVVEE 206


>gi|255526579|ref|ZP_05393486.1| ribosomal protein L4/L1e [Clostridium carboxidivorans P7]
 gi|296187267|ref|ZP_06855663.1| ribosomal protein L4/L1 family protein [Clostridium carboxidivorans
           P7]
 gi|255509687|gb|EET86020.1| ribosomal protein L4/L1e [Clostridium carboxidivorans P7]
 gi|296048138|gb|EFG87576.1| ribosomal protein L4/L1 family protein [Clostridium carboxidivorans
           P7]
          Length = 206

 Score =  115 bits (288), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 70/206 (33%), Positives = 116/206 (56%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + + N +G+  G + +S+++F ++  Q  L +V+      KR G   +K RSEV+  
Sbjct: 1   MPTVGLFNKEGKKVGDVQLSDNVFGVEVNQYALHQVVVALLANKRQGTQSAKTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+  GG  F   P     ++PK +R +A++ AL+ K   
Sbjct: 61  GIKPWRQKGTGRARQGSIRAPQWIHGGMVFAVKPRDYRTSVPKSMRRVAMKSALTSKVND 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             I+V+++L  +  KTK +V    AL+    LI+   + + N   +ARNI  + +LPV  
Sbjct: 121 EQIVVLESLELEAPKTKEVVKMLDALNAKKTLIVT-SESNENAYKSARNIQGVEILPVNN 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVYD+L+  KLV++K A+  +E+ +
Sbjct: 180 LNVYDLLKYEKLVITKDAVSKIEEVY 205


>gi|328945216|gb|EGG39370.1| 50S ribosomal protein L4 [Streptococcus sanguinis SK1087]
          Length = 207

 Score =  115 bits (288), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 65/204 (31%), Positives = 110/204 (53%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + + +  G++ G + +++ +F ++P + ++  V+  Q    R G    K RS V+  
Sbjct: 1   MANVKLFDQTGKEAGEVVLNDAVFGIEPNESVVFDVIISQRASLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LP+KVR LAL+   S+K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGIVFGPTPRSYAYKLPRKVRRLALKSVYSEKVAE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N  + +D+L     KT   V    AL +   +++   + +    L+ARN+PN+ +     
Sbjct: 121 NKFVAVDSLSFTAPKTAEFVKVLAALSIDTKVLVILEEGNEFAALSARNLPNVKVATATT 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
            +V DI+   KL+++++AI  +E+
Sbjct: 181 ASVLDIVNSDKLLVTQAAISKIEE 204


>gi|300174030|ref|YP_003773196.1| 50S ribosomal protein L4 [Leuconostoc gasicomitatum LMG 18811]
 gi|299888409|emb|CBL92377.1| 50S ribosomal protein L4 [Leuconostoc gasicomitatum LMG 18811]
          Length = 207

 Score =  115 bits (288), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 67/206 (32%), Positives = 107/206 (51%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +++V   DG     I + + +FA++P   ++   +  Q    R G    K RS V+  
Sbjct: 1   MTKVAVLKQDGSQAAEIELDDAVFAVEPNNAVITDAVLMQRASMRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    QFRGGG  FGP P    + + +K   LAL+  LS K   
Sbjct: 61  GRKPWKQKGTGRARAGSIREPQFRGGGIVFGPSPRSYAYRINRKAYQLALKSVLSQKVTE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             ++V+D L  +  KT+        L +    ++   + + N  L+ARN+ N+ ++  +G
Sbjct: 121 GKLVVVDALSFEAPKTQDFKKVLANLSVDTKTLVVVDEDNENAILSARNLSNVQVMTTKG 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INV D++   KLV+ +S+IE ++  F
Sbjct: 181 INVLDVVNADKLVIVQSSIEEIQGGF 206


>gi|283768461|ref|ZP_06341373.1| ribosomal protein L4/L1 family protein [Bulleidia extructa W1219]
 gi|283104853|gb|EFC06225.1| ribosomal protein L4/L1 family protein [Bulleidia extructa W1219]
          Length = 209

 Score =  115 bits (288), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 115/204 (56%), Gaps = 6/204 (2%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKP-QQGILARVLRWQSWRKRIGCSKSKGRSEVAY 59
           M ++ V N + +    + +S+ +F+++P QQ +   VL +Q+   R G   +  RS V+ 
Sbjct: 1   MAKMEVFNQEAKSVKTVEISDAVFSIEPNQQVMFDAVLAYQAGL-RQGTHSTLTRSFVSG 59

Query: 60  TGSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVP-IIGVHALPKKVRSLALRHALSDKF 118
           TG K + QKGTGRAR  S    Q+R G  AFGP P   GV    +KVR LALR ALS+K 
Sbjct: 60  TGKKPFRQKGTGRARQGSTRAIQWRHGAVAFGPHPRKYGVKT-NRKVRRLALRSALSEKV 118

Query: 119 CSNDIMVIDNLVSKECKTKYLVTRFRA--LDLSNALIIDGCQLDRNFQLAARNIPNINLL 176
             ++ ++I+NL  +E KTK  V   +A   D     ++D  +   N  ++ RN+PN  + 
Sbjct: 119 LESNFVLIENLNFEEMKTKKAVALLKAFGFDRKTLFVVDASEDFVNAYISMRNLPNALVT 178

Query: 177 PVQGINVYDILRCSKLVLSKSAIE 200
            V  +NVYD++  +K+V ++ A E
Sbjct: 179 TVFDLNVYDLVNANKVVFTEKAAE 202


>gi|262066303|ref|ZP_06025915.1| ribosomal protein L4/L1 family protein [Fusobacterium periodonticum
           ATCC 33693]
 gi|294783641|ref|ZP_06748965.1| ribosomal protein L4 [Fusobacterium sp. 1_1_41FAA]
 gi|291379998|gb|EFE87516.1| ribosomal protein L4/L1 family protein [Fusobacterium periodonticum
           ATCC 33693]
 gi|294480519|gb|EFG28296.1| ribosomal protein L4 [Fusobacterium sp. 1_1_41FAA]
          Length = 209

 Score =  115 bits (288), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 72/206 (34%), Positives = 109/206 (52%), Gaps = 2/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  L+V NL G+  G + V++ +F ++P + +L  VL  +    R G + +K R+ V   
Sbjct: 1   MAVLNVYNLAGDQTGTLEVNDAVFGIEPNKVVLHEVLTAELAAARQGTASTKTRAMVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S       GGG  FGP P      + KKVR+LALR ALS K  +
Sbjct: 61  GRKPFKQKGTGRARQGSIRAPHMVGGGVTFGPHPRSYEKKVNKKVRNLALRSALSAKVAA 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNA--LIIDGCQLDRNFQLAARNIPNINLLPV 178
            +++V+D       KTK +V     +D       ++     D N  L+ARN+ N  +L  
Sbjct: 121 GNVLVLDYEGIDTPKTKVIVNLVNKVDAKQKQLFVVGDLIKDYNLYLSARNLENAVILQP 180

Query: 179 QGINVYDILRCSKLVLSKSAIEALED 204
             I VY +L+  K++L+K A+  +E+
Sbjct: 181 NEIGVYWLLKQEKVILTKEALAVVEE 206


>gi|148381420|ref|YP_001255961.1| ribosomal protein L4 [Clostridium botulinum A str. ATCC 3502]
 gi|153933556|ref|YP_001385795.1| 50S ribosomal protein L4 [Clostridium botulinum A str. ATCC 19397]
 gi|153934780|ref|YP_001389202.1| 50S ribosomal protein L4 [Clostridium botulinum A str. Hall]
 gi|153940969|ref|YP_001392833.1| 50S ribosomal protein L4 [Clostridium botulinum F str. Langeland]
 gi|168178833|ref|ZP_02613497.1| ribosomal protein L4 [Clostridium botulinum NCTC 2916]
 gi|226950932|ref|YP_002806023.1| ribosomal protein L4 [Clostridium botulinum A2 str. Kyoto]
 gi|166234655|sp|A7FZ68|RL4_CLOB1 RecName: Full=50S ribosomal protein L4
 gi|166234656|sp|A5I7K5|RL4_CLOBH RecName: Full=50S ribosomal protein L4
 gi|166234657|sp|A7GJ73|RL4_CLOBL RecName: Full=50S ribosomal protein L4
 gi|254803725|sp|C1FMV0|RL4_CLOBJ RecName: Full=50S ribosomal protein L4
 gi|148290904|emb|CAL85040.1| 50S ribosomal protein L4 [Clostridium botulinum A str. ATCC 3502]
 gi|152929600|gb|ABS35100.1| 50S ribosomal protein L4 [Clostridium botulinum A str. ATCC 19397]
 gi|152930694|gb|ABS36193.1| 50S ribosomal protein L4 [Clostridium botulinum A str. Hall]
 gi|152936865|gb|ABS42363.1| 50S ribosomal protein L4 [Clostridium botulinum F str. Langeland]
 gi|182670131|gb|EDT82107.1| ribosomal protein L4 [Clostridium botulinum NCTC 2916]
 gi|226844588|gb|ACO87254.1| ribosomal protein L4 [Clostridium botulinum A2 str. Kyoto]
 gi|295320813|gb|ADG01191.1| 50S ribosomal protein L4 [Clostridium botulinum F str. 230613]
 gi|322807805|emb|CBZ05380.1| LSU ribosomal protein L4p (L1e) [Clostridium botulinum H04402 065]
          Length = 206

 Score =  115 bits (288), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 65/206 (31%), Positives = 115/206 (55%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ + N +GE  G + +++ +F ++     + +V++     KR G   +K R+EV+  
Sbjct: 1   MPKVDLFNQNGEKVGDLQLADSVFGVEVNTYAMHQVVKALLANKRQGTQSAKTRAEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+  GG  F P P     ++PK ++ +A++ AL+ K   
Sbjct: 61  GIKPWRQKGTGRARQGSIRAPQWIHGGVVFAPKPRDYRMSIPKSMKKVAIKSALTSKVNE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N ++V+D +  +  KTK +V    + +    LII     + N   +ARNI  + ++PV  
Sbjct: 121 NLMVVVDEIKLETPKTKEVVKMLNSFNAKKTLIITN-NAEENVYKSARNIEGVQIIPVNN 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYD+L+  K+V++K A+  +E+ +
Sbjct: 180 INVYDVLKYDKVVITKDAVSKIEEVY 205


>gi|257453270|ref|ZP_05618569.1| 50S ribosomal protein L4 [Fusobacterium sp. 3_1_5R]
 gi|257467135|ref|ZP_05631446.1| 50S ribosomal protein L4 [Fusobacterium gonidiaformans ATCC 25563]
 gi|315918266|ref|ZP_07914506.1| LSU ribosomal protein L1E [Fusobacterium gonidiaformans ATCC 25563]
 gi|317059804|ref|ZP_07924289.1| LSU ribosomal protein L1E [Fusobacterium sp. 3_1_5R]
 gi|313685480|gb|EFS22315.1| LSU ribosomal protein L1E [Fusobacterium sp. 3_1_5R]
 gi|313692141|gb|EFS28976.1| LSU ribosomal protein L1E [Fusobacterium gonidiaformans ATCC 25563]
          Length = 210

 Score =  115 bits (287), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 74/208 (35%), Positives = 110/208 (52%), Gaps = 5/208 (2%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  L++ +L G   G + V+E +F ++P + +L  VL  +    R G + +K R+ V   
Sbjct: 1   MAVLNIYDLAGNQTGTVEVNEAVFGIEPNKTVLHEVLTAELAAARQGTAATKTRAMVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S       GGG  FGP P      + KKVR+LALR ALS K  +
Sbjct: 61  GRKPFKQKGTGRARQGSIRAPHMVGGGVTFGPQPRSYEKKVNKKVRNLALRSALSAKVAN 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQL----DRNFQLAARNIPNINLL 176
           N I+V++  V +  KTK +V     +D     +     L    D N  L+ARN+ N  +L
Sbjct: 121 NQIVVLEGAV-EAPKTKTIVNLVNKIDAKQKQLFVVNDLTDVKDYNLYLSARNLENAVVL 179

Query: 177 PVQGINVYDILRCSKLVLSKSAIEALED 204
               I VY +L+  K++L+K A+  +E+
Sbjct: 180 QPNEIGVYWLLKQEKVILTKEALTTIEE 207


>gi|319945834|ref|ZP_08020084.1| 50S ribosomal protein L4 [Streptococcus australis ATCC 700641]
 gi|319747899|gb|EFW00143.1| 50S ribosomal protein L4 [Streptococcus australis ATCC 700641]
          Length = 207

 Score =  115 bits (287), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 109/204 (53%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +++ +  G+  G + +++ IF ++P Q ++  V+  Q    R G    K RS V+  
Sbjct: 1   MANITLFDQTGKQAGEVVLNDAIFGIEPNQAVVFDVIISQRASLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LP+KVR LAL+   S+K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGIVFGPTPRSYAYKLPQKVRRLALKSVYSEKVAE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N  + +D+L     KT        AL + + +++   + +    L+ARN+PN+ +     
Sbjct: 121 NKFVAVDSLEFTAPKTAEFAKVLAALSIDSKVLVILEEGNEFAALSARNLPNVKVATATT 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
            +V DI    KL+++++AI  +E+
Sbjct: 181 ASVLDIANSDKLLVTQAAISKIEE 204


>gi|88657712|ref|YP_507228.1| 50S ribosomal protein L4 [Ehrlichia chaffeensis str. Arkansas]
 gi|109893594|sp|Q2GH55|RL4_EHRCR RecName: Full=50S ribosomal protein L4
 gi|88599169|gb|ABD44638.1| ribosomal protein L4 [Ehrlichia chaffeensis str. Arkansas]
          Length = 205

 Score =  115 bits (287), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 70/205 (34%), Positives = 118/205 (57%), Gaps = 1/205 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +E+++ N++ +  G I ++  IF++  +  IL  V+ WQ  ++R G  K+K   +++ T 
Sbjct: 1   MEVNIINVNSDRIGTIDLNPLIFSVNYRPDILKMVVDWQLSKRRAGTHKAKTIGDISGTT 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +K + QK TGRAR  S    QFRGG   FGPV     ++L KKVR+L L+ ALS K   N
Sbjct: 61  AKPHRQKHTGRARQGSLRSPQFRGGAVIFGPVVRSHAYSLNKKVRNLGLKVALSLKNSCN 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
            ++++D++     KT  ++   +  +  + LIID    +++   + RN+ N+ LL   G 
Sbjct: 121 KLLILDSIDVNFVKTTQVLQFIKNFEHKSFLIIDK-DYNKSVVCSCRNLHNVTLLKQIGT 179

Query: 182 NVYDILRCSKLVLSKSAIEALEDRF 206
           NV DILR   ++L+  A++ LE+R 
Sbjct: 180 NVLDILRHDCIILTVGAVKYLEERL 204


>gi|307214236|gb|EFN89342.1| 39S ribosomal protein L4, mitochondrial [Harpegnathos saltator]
          Length = 285

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 75/211 (35%), Positives = 114/211 (54%), Gaps = 8/211 (3%)

Query: 3   ELSVRNLDG--EDK-GVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAY 59
           ++ + NLD   E K G +++   IFA  P+  I+ + +RWQ   + +  + +K R+EV  
Sbjct: 55  QVWLENLDTIKEKKLGFVTLHPHIFAATPRIDIIHQNVRWQKMYRWVCYAHTKTRTEVRG 114

Query: 60  TGSKMYVQKGTGRARHSSKSVSQFRGGGKAFGP-VPIIGVHALPKKVRSLALRHALSDKF 118
            G K + QKGTGRARH S     +RGGG+A GP  P    + LP   R   L   LS K 
Sbjct: 115 GGRKPWPQKGTGRARHGSIRSPLWRGGGRAHGPRSPTPHFYMLPFFTRVAGLTSMLSVKL 174

Query: 119 CSNDIMVIDNL--VSKECKTKYLVTRFRALDLSNALIIDGCQ-LDRNFQLAARNIPNINL 175
             +D+ +I+NL   + EC     +   R    S  LI+D    + +N  LA   I +INL
Sbjct: 175 AQDDLHIINNLEIPTSECSYIEQLVEERNWGPS-VLIVDSYDIMPKNITLATDEIKHINL 233

Query: 176 LPVQGINVYDILRCSKLVLSKSAIEALEDRF 206
           +PV G+NVY +L+ + LVL++ A   +E++ 
Sbjct: 234 MPVYGLNVYSMLKHNTLVLTEQAARLIEEKL 264


>gi|170754589|ref|YP_001783120.1| 50S ribosomal protein L4 [Clostridium botulinum B1 str. Okra]
 gi|226730644|sp|B1IGF3|RL4_CLOBK RecName: Full=50S ribosomal protein L4
 gi|169119801|gb|ACA43637.1| 50S ribosomal protein L4 [Clostridium botulinum B1 str. Okra]
          Length = 206

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 65/206 (31%), Positives = 115/206 (55%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ + N +GE  G + +++ +F ++     + +V++     KR G   +K R+EV+  
Sbjct: 1   MPKIDLFNQNGEKVGDLQLADSVFGVEVNTYAMHQVVKALLANKRQGTQSAKTRAEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+  GG  F P P     ++PK ++ +A++ AL+ K   
Sbjct: 61  GIKPWRQKGTGRARQGSIRAPQWIHGGIVFAPKPRDYRMSIPKSMKKVAMKSALTSKVNE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             ++V+D++  +  KTK +V    + D    LII     + N   +ARNI  + ++PV  
Sbjct: 121 KLMVVVDDIKLETPKTKEVVKMLNSFDAKKTLIITN-NAEENVYKSARNIEGVQIIPVNN 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYD+L+  K+V++K A+  +E+ +
Sbjct: 180 INVYDLLKYDKVVITKDAVSKIEEVY 205


>gi|257125037|ref|YP_003163151.1| 50S ribosomal protein L4 [Leptotrichia buccalis C-1013-b]
 gi|257048976|gb|ACV38160.1| ribosomal protein L4/L1e [Leptotrichia buccalis C-1013-b]
          Length = 214

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 67/211 (31%), Positives = 113/211 (53%), Gaps = 7/211 (3%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  L++  LDG   G I V+ D+F ++P + ++  VL  +    R G + +K R+EV   
Sbjct: 1   MPVLNIYKLDGSQAGTIEVNNDVFGIEPNKHVMHEVLVAELAEARQGSASTKTRAEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S       GGG   GP P      + KKVR LAL+ AL+ K   
Sbjct: 61  GRKPFRQKGTGRARQGSTRAPHMVGGGVVHGPKPRNYAKKVNKKVRKLALKSALATKISE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALII-----DGCQLDRNF--QLAARNIPNI 173
            +++V+D+   +  KTK  +   +AL+   A  +     D   +DR++   L+ RNI  +
Sbjct: 121 GNVIVLDDFALEIPKTKTFIDFAKALNFDGAKQLYVTNDDTDNIDRDYFLYLSTRNIEKV 180

Query: 174 NLLPVQGINVYDILRCSKLVLSKSAIEALED 204
             +  + +++Y +++  K++L+K A+  +E+
Sbjct: 181 AAINTRDLSIYWLIKQDKVILTKEALATIEE 211


>gi|256618379|ref|ZP_05475225.1| 50S ribosomal protein L4 [Enterococcus faecalis ATCC 4200]
 gi|256597906|gb|EEU17082.1| 50S ribosomal protein L4 [Enterococcus faecalis ATCC 4200]
          Length = 207

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 107/195 (54%)

Query: 10  DGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKG 69
           DG   G I+++E+IF ++P + ++   +  Q      G    K RS V   G K + QKG
Sbjct: 10  DGTQNGEITLNEEIFGIEPNESVVYDAIIMQRASLGQGTHAVKNRSAVRGGGRKPWRQKG 69

Query: 70  TGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNL 129
           TGRAR  S    Q+RGGG  FGP P    + LPKKVR LA++  LSDK   N+++ ++ L
Sbjct: 70  TGRARQGSIRSPQWRGGGVVFGPTPRSYSYKLPKKVRRLAMKSVLSDKVAENNLVAVEGL 129

Query: 130 VSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRC 189
                KTK        L +   +++     +    L+ARN+PN++++    ++V D++  
Sbjct: 130 SFDAPKTKEFKQVLANLSIDTKVLVVLENGNDFAALSARNLPNVSVVTSDNVSVLDVVSA 189

Query: 190 SKLVLSKSAIEALED 204
           +K++ +++A+  +E+
Sbjct: 190 NKVLATQTALTQIEE 204


>gi|319940059|ref|ZP_08014413.1| 50S ribosomal protein L4 [Streptococcus anginosus 1_2_62CV]
 gi|319810773|gb|EFW07100.1| 50S ribosomal protein L4 [Streptococcus anginosus 1_2_62CV]
          Length = 207

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 65/204 (31%), Positives = 108/204 (52%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + + +  G++ G + +++ +F ++P + ++  V+  Q    R G    K RS V+  
Sbjct: 1   MANVKLFDQTGKEAGEVVLNDAVFGIEPNESVVFDVVISQRASLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LP+KVR LAL+   S+K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGTVFGPTPRSYAYKLPQKVRRLALKSVYSEKVAE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           +  + +D+L     KT        AL L   +++   + +    L+ARN+PN+ +     
Sbjct: 121 DKFVAVDSLSFTAPKTAEFAKVLAALSLDTKVLVILEEGNEFAALSARNLPNVKVATATT 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
            +V DI+   KL+++K AI  +E+
Sbjct: 181 ASVLDIVNSDKLLVTKEAISTIEE 204


>gi|257463962|ref|ZP_05628347.1| 50S ribosomal protein L4 [Fusobacterium sp. D12]
 gi|317061485|ref|ZP_07925970.1| LSU ribosomal protein L1E [Fusobacterium sp. D12]
 gi|313687161|gb|EFS23996.1| LSU ribosomal protein L1E [Fusobacterium sp. D12]
          Length = 210

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 72/208 (34%), Positives = 111/208 (53%), Gaps = 5/208 (2%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  L++ +L G   G + V+E +F ++P + +L  VL  +    R G + +K R+ V   
Sbjct: 1   MAVLNIYDLAGNQTGTVEVNEAVFGIEPNKTVLHEVLTAELAAARQGTAATKTRAMVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S       GGG  FGP P      + KKVR+LALR ALS K  +
Sbjct: 61  GRKPFKQKGTGRARQGSIRAPHMVGGGVTFGPQPRSYEKKVNKKVRNLALRSALSAKVAN 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQL----DRNFQLAARNIPNINLL 176
           N+++V++  + +  KTK +V     +D     +     L    D N  L+ARN+ N  +L
Sbjct: 121 NEVVVLEGAI-EAPKTKTIVNLVNKIDAKQKQLFVVNDLTDVKDYNLYLSARNLENAVVL 179

Query: 177 PVQGINVYDILRCSKLVLSKSAIEALED 204
               I VY +L+  K++L+K A+  +E+
Sbjct: 180 QPNEIGVYWLLKQEKVILTKEALTTIEE 207


>gi|168181865|ref|ZP_02616529.1| 50S ribosomal protein L4 [Clostridium botulinum Bf]
 gi|237796941|ref|YP_002864493.1| 50S ribosomal protein L4 [Clostridium botulinum Ba4 str. 657]
 gi|259491549|sp|C3KVQ0|RL4_CLOB6 RecName: Full=50S ribosomal protein L4
 gi|182674730|gb|EDT86691.1| 50S ribosomal protein L4 [Clostridium botulinum Bf]
 gi|229261648|gb|ACQ52681.1| 50S ribosomal protein L4 [Clostridium botulinum Ba4 str. 657]
          Length = 206

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 66/206 (32%), Positives = 115/206 (55%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ + N +GE  G + +++ +F ++     + +V++     KR G   +K R+EV+  
Sbjct: 1   MPKVDLFNQNGEKVGDLQLADSVFGVEVNTYAMHQVVKALLANKRQGTQSAKTRAEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+  GG  F P P     ++PK ++ +A++ AL+ K   
Sbjct: 61  GIKPWRQKGTGRARQGSIRAPQWIHGGIVFAPKPRDYRMSIPKSMKKVAIKSALTSKVNE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             ++V+D++  +  KTK +V    A +    LII     + N   +ARNI  + ++PV  
Sbjct: 121 KLMVVVDDIKLETPKTKEVVKMLNAFNAKKTLIITN-NAEENVYKSARNIEGVQIIPVNN 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYDIL+  K+V++K A+  +E+ +
Sbjct: 180 INVYDILKYDKVVITKDAVSKIEEVY 205


>gi|296875403|ref|ZP_06899477.1| ribosomal protein L4/L1 family protein [Streptococcus parasanguinis
           ATCC 15912]
 gi|312867055|ref|ZP_07727266.1| 50S ribosomal protein L4 [Streptococcus parasanguinis F0405]
 gi|322390661|ref|ZP_08064175.1| 50S ribosomal protein L4 [Streptococcus parasanguinis ATCC 903]
 gi|296433596|gb|EFH19369.1| ribosomal protein L4/L1 family protein [Streptococcus parasanguinis
           ATCC 15912]
 gi|311097537|gb|EFQ55770.1| 50S ribosomal protein L4 [Streptococcus parasanguinis F0405]
 gi|321142634|gb|EFX38098.1| 50S ribosomal protein L4 [Streptococcus parasanguinis ATCC 903]
          Length = 207

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 109/204 (53%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +++ +  G+  G + +++ IF ++P Q ++  V+  Q    R G    K RS V+  
Sbjct: 1   MANVTLFDQTGKQAGEVVLNDAIFGIEPNQAVVFDVIISQRASLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LP+KVR LAL+   S+K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGIVFGPTPRSYAYKLPQKVRRLALKSVYSEKVAE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N  + +D+L     KT        AL + + +++   + +    L+ARN+PN+ +     
Sbjct: 121 NKFVAVDSLEFTAPKTAEFAKVLAALSIDSKVLVILEEGNEFAALSARNLPNVKVATATT 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
            +V DI    KL+++++AI  +E+
Sbjct: 181 ASVLDIANSDKLLVTQAAISKIEE 204


>gi|72163044|ref|YP_290701.1| 50S ribosomal protein L4 [Thermobifida fusca YX]
 gi|109893650|sp|Q47LJ4|RL4_THEFY RecName: Full=50S ribosomal protein L4
 gi|71916776|gb|AAZ56678.1| LSU ribosomal protein L4P [Thermobifida fusca YX]
          Length = 222

 Score =  114 bits (286), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 66/205 (32%), Positives = 107/205 (52%), Gaps = 3/205 (1%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + V++ +G  KG + + ++IFA K    ++ +V+  Q    R G   +K R EV   
Sbjct: 1   MATIEVKDREGAAKGSVELPDEIFAQKVNIPLIHQVVVAQQAAGRQGTHSTKTRGEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K Y QKGTGRAR  S    QF GGG   GP P       PKK+++ ALR ALS++   
Sbjct: 61  GKKPYRQKGTGRARQGSVRAPQFTGGGTVHGPKPRDYAQRTPKKMKAAALRGALSNRAQH 120

Query: 121 NDIMVIDNLVSKECKTKYLVT---RFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLP 177
             I V+   V ++  TK   T     R +  S+ +++   + D++ +LA RN+P +++L 
Sbjct: 121 GRIHVVSEFVPEDVTTKRTQTALKTLRKITDSDKVLVVLSREDQHNRLALRNLPEVHILD 180

Query: 178 VQGINVYDILRCSKLVLSKSAIEAL 202
              +N YD+L    +V +++  +  
Sbjct: 181 ANQVNTYDVLYADDIVFTEAGYQEF 205


>gi|157149830|ref|YP_001451234.1| 50S ribosomal protein L4 [Streptococcus gordonii str. Challis
           substr. CH1]
 gi|262283582|ref|ZP_06061347.1| ribosomal protein L4/L1 family protein [Streptococcus sp.
           2_1_36FAA]
 gi|189042889|sp|A8AZM4|RL4_STRGC RecName: Full=50S ribosomal protein L4
 gi|157074624|gb|ABV09307.1| ribosomal protein L4/L1 family [Streptococcus gordonii str. Challis
           substr. CH1]
 gi|262260639|gb|EEY79340.1| ribosomal protein L4/L1 family protein [Streptococcus sp.
           2_1_36FAA]
          Length = 207

 Score =  114 bits (286), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 65/204 (31%), Positives = 109/204 (53%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + + +  G++ G + +++ IF ++P + ++  V+  Q    R G    K RS V+  
Sbjct: 1   MANVKLFDQTGKEAGEVVLNDAIFGIEPNESVVFDVIISQRASLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LP+KVR LAL+   S+K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYAYKLPRKVRRLALKSVYSEKVAE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N  + +D+L     KT        AL +   +++   + +    L+ARN+PN+ +     
Sbjct: 121 NKFVAVDSLSFTAPKTAEFAKVLAALSIDTKVLVILEEGNEFAALSARNLPNVKVATATT 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
            +V DI+   KL+++++AI  +E+
Sbjct: 181 ASVLDIVNSDKLLVTQAAISKIEE 204


>gi|149279663|ref|ZP_01885792.1| 50S ribosomal protein L4 [Pedobacter sp. BAL39]
 gi|149229699|gb|EDM35089.1| 50S ribosomal protein L4 [Pedobacter sp. BAL39]
          Length = 209

 Score =  114 bits (286), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 70/208 (33%), Positives = 114/208 (54%), Gaps = 4/208 (1%)

Query: 2   IELSVRNLDGEDKGV-ISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           +E+ V N+ G++ G  + + E +F + P    +   ++     +R G  KSK R+E+A +
Sbjct: 1   MEVKVLNISGKETGAKVQLPESVFGITPVDHAIYLDVKQYLANQRQGTHKSKQRNEIAGS 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
             K+Y QKGTG AR  S     F GGG+ FGP P      L KK++ LA + ALS K   
Sbjct: 61  TRKLYKQKGTGGARAGSIKSPLFNGGGRVFGPQPRDYSFKLNKKLKVLARKSALSYKAQD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLS--NALIIDGCQLDRNFQLAARNIPNINLLPV 178
           N+++V+++      KTK  V    AL+L+    L++   Q + N  L++RNI    ++  
Sbjct: 121 NNVVVLEDFSFDSIKTKNYVNLVSALNLAGEKTLLVLPSQ-NNNIYLSSRNIQKAKVITA 179

Query: 179 QGINVYDILRCSKLVLSKSAIEALEDRF 206
             +N YD+L C KL+L+  +++ LE+ F
Sbjct: 180 DQLNTYDVLNCGKLLLTADSLKTLEEAF 207


>gi|170017942|ref|YP_001728861.1| 50S ribosomal protein L4 [Leuconostoc citreum KM20]
 gi|226730683|sp|B1MW13|RL4_LEUCK RecName: Full=50S ribosomal protein L4
 gi|169804799|gb|ACA83417.1| 50S ribosomal protein L4 [Leuconostoc citreum KM20]
          Length = 207

 Score =  114 bits (286), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 67/205 (32%), Positives = 111/205 (54%), Gaps = 4/205 (1%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +++V   DG     + +++ +FA++P   ++   +  Q    R G    K RS V+  
Sbjct: 1   MTKVAVLKQDGSQAAELELNDAVFAIEPNNAVITDAVLMQRASMRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    QFRGGG  FGP P    + + +K   LAL+  LS K   
Sbjct: 61  GRKPWKQKGTGRARAGSIREPQFRGGGIVFGPTPRSYAYRINRKAYQLALKSVLSQKVAE 120

Query: 121 NDIMVIDNLVSKECKTKYL--VTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPV 178
             ++V+D L  +  KT+    V    ++D    +++D  + + N  L+ARN+ N+ ++  
Sbjct: 121 GKLVVVDALSFEAPKTQDFKKVLANLSVDTKTLVVVD--EDNENAILSARNLTNVQVMTT 178

Query: 179 QGINVYDILRCSKLVLSKSAIEALE 203
           +GINV D++   KLV+ +S+IE ++
Sbjct: 179 KGINVLDVVNADKLVIVQSSIEEIQ 203


>gi|85057801|ref|YP_456717.1| 50S ribosomal protein L4 [Aster yellows witches'-broom phytoplasma
           AYWB]
 gi|109893576|sp|Q2NIV5|RL4_AYWBP RecName: Full=50S ribosomal protein L4
 gi|84789906|gb|ABC65638.1| LSU ribosomal protein L1E [Aster yellows witches'-broom phytoplasma
           AYWB]
          Length = 207

 Score =  114 bits (286), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 72/207 (34%), Positives = 110/207 (53%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N  G+      ++  +F +KP Q +L  V+  Q    R G   +K R+ VA  
Sbjct: 1   MPKINILNQQGDLVSEKVLATTVFDIKPNQQVLYDVVNAQRAAMRQGTHATKTRALVAGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRARH S     +RGGG  FGP P      + +KVR LAL+ ALS +  +
Sbjct: 61  GKKPWRQKGTGRARHGSIRSPLWRGGGVTFGPSPRNYSVKVNQKVRILALKSALSLQVQN 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N ++V+DN+     KTK      + L++++  +I   Q+     LA+RN+  I L     
Sbjct: 121 NQLVVLDNINLATHKTKDFQQMLQKLNITSKSLIVVTQMTEQLALASRNLSYITLETASH 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRFK 207
            +VY IL C +LVL+  A+   E+  K
Sbjct: 181 ASVYQILNCKQLVLTADAVNYFEEVLK 207


>gi|148693203|gb|EDL25150.1| mitochondrial ribosomal protein L4, isoform CRA_d [Mus musculus]
          Length = 302

 Score =  114 bits (286), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 72/215 (33%), Positives = 117/215 (54%), Gaps = 14/215 (6%)

Query: 5   SVRNLDGEDKGVISVSEDIFALKPQQG--------ILARVLRWQSWRKRIGCSKSKGRSE 56
           S+R  + E  G+  +  D+FA  P+          I+ +V  WQ   +RI  + +K R+E
Sbjct: 68  SLRGFEQERIGLAELHPDVFATAPRWSLTMKYRLDIVHQVAIWQRNFRRISYANTKTRAE 127

Query: 57  VAYTGSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPV-PIIGVHALPKKVRSLALRHALS 115
           V+  G K + QKG+GRARH S     +RGGG A GP  P    + LP KVR+L L+ AL+
Sbjct: 128 VSGGGRKPWQQKGSGRARHGSIRSPLWRGGGVAHGPRGPTSYYYMLPMKVRALGLKVALT 187

Query: 116 DKFCSNDIMVIDNLVSKECKTKYL--VTRFRALDLSNALIIDGC--QLDRNFQLAARNIP 171
            K   +D+ ++D+L       +YL  + ++R    S+ L++D    ++ +N   A   + 
Sbjct: 188 VKLMQDDLHIVDSLELPTADPQYLTELAQYRHWG-SSVLLVDLTHEEMPKNVVAATSGLN 246

Query: 172 NINLLPVQGINVYDILRCSKLVLSKSAIEALEDRF 206
           + NL+P  G+NVY +L+   LVL+  ++  LED+ 
Sbjct: 247 SFNLIPAVGLNVYSMLKHQTLVLTLPSVAFLEDKL 281


>gi|291290889|ref|NP_001167475.1| mitochondrial ribosomal protein L4 [Xenopus laevis]
 gi|161611723|gb|AAI55897.1| Unknown (protein for MGC:181787) [Xenopus laevis]
          Length = 298

 Score =  114 bits (286), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 69/205 (33%), Positives = 115/205 (56%), Gaps = 3/205 (1%)

Query: 5   SVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKM 64
           S+++ D +  G++ +  D+F + P+  IL +V+ WQ   KRI  +K K R+EV   G K 
Sbjct: 73  SLKHPDDQQLGLVHLHPDVFTVPPRIDILHQVITWQRNFKRISYAKVKTRAEVRGGGKKP 132

Query: 65  YVQKGTGRARHSSKSVSQFRGGGKAFGPV-PIIGVHALPKKVRSLALRHALSDKFCSNDI 123
             QKG+GR+R  S     +RGGG A GP  P    + +P K+R L L+ AL+ K   +D+
Sbjct: 133 RQQKGSGRSRQGSIRSPLWRGGGVAHGPRGPTSYYYMMPMKLRVLGLKIALTTKLAQDDL 192

Query: 124 MVIDNLVSKECKTKYLVTRFRALDLSNA-LIIDGCQ-LDRNFQLAARNIPNINLLPVQGI 181
            +ID+L       +YL+         ++ LI+D  + L  N   A  N+  IN++P  G+
Sbjct: 193 HIIDSLEISTPDPQYLIDLVNHRQWGDSVLIVDVNENLPENIFNATINLKKINVIPATGL 252

Query: 182 NVYDILRCSKLVLSKSAIEALEDRF 206
           NV+ +L+   +VL+ +A++ LE++ 
Sbjct: 253 NVFSMLKHDTVVLTVAAVDFLEEKL 277


>gi|260891593|ref|ZP_05902856.1| hypothetical protein GCWU000323_02808 [Leptotrichia hofstadii
           F0254]
 gi|260858701|gb|EEX73201.1| ribosomal protein L4/L1 family protein [Leptotrichia hofstadii
           F0254]
          Length = 214

 Score =  114 bits (286), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 68/211 (32%), Positives = 113/211 (53%), Gaps = 7/211 (3%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  L++  LDG   G I V+ D+F ++P + ++  VL  +    R G + +K R+EV   
Sbjct: 1   MPVLNIYKLDGSQAGTIEVNNDVFGIEPNKHVMHEVLVAELAEARQGSASTKTRAEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S       GGG   GP P      + KKVR LAL+ AL+ K   
Sbjct: 61  GRKPFRQKGTGRARQGSTRAPHMVGGGVVHGPKPRNYAKKVNKKVRKLALKSALATKINE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNA--LII---DGCQLDRNF--QLAARNIPNI 173
            +++V+D+   +  KTK  +   +AL+      L I   D   +DR++   L+ RNI  +
Sbjct: 121 GNVIVLDDFTLETPKTKTFINFAKALNFDGVKQLYITNDDTDNIDRDYFLYLSTRNIEKV 180

Query: 174 NLLPVQGINVYDILRCSKLVLSKSAIEALED 204
             +  + +++Y +++  K++L+K A+  +E+
Sbjct: 181 AAINTRDLSIYWLIKQDKVILTKEALATIEE 211


>gi|311748513|ref|ZP_07722298.1| ribosomal protein L4/L1 [Algoriphagus sp. PR1]
 gi|126577029|gb|EAZ81277.1| ribosomal protein L4/L1 [Algoriphagus sp. PR1]
          Length = 209

 Score =  114 bits (286), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 113/204 (55%), Gaps = 2/204 (0%)

Query: 2   IELSVRNLDGEDKG-VISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           +EL+V N  GED G  +S+SE+IF ++P    +   ++     +R G  KSK R+E+A +
Sbjct: 1   MELAVINHKGEDTGRKVSLSEEIFGIEPNDHAIYLDVKQYLANQRQGTHKSKERNEIAGS 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
             K+  QKGTG AR  S     FRGGG+ FGP P      L KK++ LA + ALS K   
Sbjct: 61  TKKIKKQKGTGSARAGSIKSPIFRGGGRVFGPSPRNYSFKLNKKLKQLARKSALSYKVKD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSN-ALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
           N + V++NL  +  KTK  +     L L++   ++   + ++N  L++RN+P   ++ V 
Sbjct: 121 NSLSVLENLSFEAPKTKSYLALLNGLSLADKKTLVVIPEENKNVYLSSRNLPKSKVVTVN 180

Query: 180 GINVYDILRCSKLVLSKSAIEALE 203
            +N Y +L    LV+ + ++  LE
Sbjct: 181 DVNTYQVLNADHLVICEGSVSMLE 204


>gi|330814198|ref|YP_004358437.1| LSU ribosomal protein L4p (L1e) [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327487293|gb|AEA81698.1| LSU ribosomal protein L4p (L1e) [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 209

 Score =  114 bits (286), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 73/203 (35%), Positives = 112/203 (55%), Gaps = 6/203 (2%)

Query: 8   NLDGEDKGVISVSEDIFALKPQQGILARVLRWQ--SWRKRIGCSKSKGRSEVAYTGSKMY 65
           N++G+  G   VS+ +F+LKP++ ++  V+ WQ  + RK+ G +KS+G  EV  +  K+ 
Sbjct: 7   NIEGKKIGTHEVSDQVFSLKPRKDLIQLVINWQLNNQRKKKGHTKSRG--EVKGSRRKIV 64

Query: 66  VQKGTGRARHSSKSVSQFRGGGKAFGPVP--IIGVHALPKKVRSLALRHALSDKFCSNDI 123
            QKG+G ARH + +   F GGG A GP       +  L KKV++L L  ALS K  + +I
Sbjct: 65  QQKGSGGARHGNITAPIFVGGGIAHGPRHRGQTRLTKLNKKVKNLGLISALSSKVLTKNI 124

Query: 124 MVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINV 183
            + D       KTK        L+  +ALII        F  + +NIPN   + V G NV
Sbjct: 125 NIFDEPKLDTFKTKSFNNFLSKLESKSALIIHHDGASEKFIKSMKNIPNTKRIKVVGTNV 184

Query: 184 YDILRCSKLVLSKSAIEALEDRF 206
           YD+++  K++ +K AI+ LE+R 
Sbjct: 185 YDLIKFEKILFTKEAIKTLEERL 207


>gi|227538717|ref|ZP_03968766.1| ribosomal protein L4 [Sphingobacterium spiritivorum ATCC 33300]
 gi|300770250|ref|ZP_07080129.1| ribosomal protein L4/L1 family protein [Sphingobacterium
           spiritivorum ATCC 33861]
 gi|227241636|gb|EEI91651.1| ribosomal protein L4 [Sphingobacterium spiritivorum ATCC 33300]
 gi|300762726|gb|EFK59543.1| ribosomal protein L4/L1 family protein [Sphingobacterium
           spiritivorum ATCC 33861]
          Length = 209

 Score =  114 bits (286), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 70/209 (33%), Positives = 116/209 (55%), Gaps = 6/209 (2%)

Query: 2   IELSVRNLDGEDKGV-ISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           +E+ V NL G++ G  + + E +F L+P    +   ++     +R G  KSK R+E+A +
Sbjct: 1   MEVKVLNLSGKETGAKVQLPESVFGLEPNDHAIYLDVKQYLANQRQGTHKSKQRNEIAGS 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
             K++ QKGTG AR  S     F GGG+ FGP P      L KK++ LA + ALS K   
Sbjct: 61  TRKLHKQKGTGGARAGSIKSPLFNGGGRVFGPQPRDYSFKLNKKLKQLARKSALSYKAQE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNA---LIIDGCQLDRNFQLAARNIPNINLLP 177
           N+I+V+D +     KTK  V+   AL++++    L++     D N  L++RN+    ++ 
Sbjct: 121 NNIVVLDAVSFDTIKTKNYVSLVAALNVADEKTLLVLPAY--DNNVYLSSRNLKKAKVVS 178

Query: 178 VQGINVYDILRCSKLVLSKSAIEALEDRF 206
              +N YD+L  +KL+L+  +++ LE+ F
Sbjct: 179 ADQLNTYDVLNATKLLLTTDSVKTLEEAF 207


>gi|47212296|emb|CAF90559.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 302

 Score =  114 bits (286), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 107/200 (53%), Gaps = 3/200 (1%)

Query: 10  DGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKG 69
           D E  GV  +  D+FA+ P+  IL  V  WQ   KRI  + +K R+EV   G K + QKG
Sbjct: 82  DSEPVGVAHLHPDVFAVPPRLDILHMVETWQRNFKRISHAHTKVRAEVRGGGRKPWRQKG 141

Query: 70  TGRARHSSKSVSQFRGGGKAFGPV-PIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDN 128
           +GRARH S     +RGGG + GP  P    + LP KVR L L+ ALS K   + + V+++
Sbjct: 142 SGRARHGSIRSPLWRGGGVSHGPRGPTSYYYMLPMKVRVLGLKVALSSKLAQSHLHVVES 201

Query: 129 LVSKECKTKYL--VTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDI 186
           L       +YL  + R R    S  L+ +  +L  +   A   + +IN++P  G+NV+ +
Sbjct: 202 LNLPSPDPQYLLDLARRRHWGESLLLVHESEELPEDVLQATATLKSINVIPALGLNVHSL 261

Query: 187 LRCSKLVLSKSAIEALEDRF 206
           L+   LVL+   +  LED+ 
Sbjct: 262 LKHQALVLTLETLRFLEDKL 281


>gi|148263141|ref|YP_001229847.1| 50S ribosomal protein L4 [Geobacter uraniireducens Rf4]
 gi|189029505|sp|A5GAW6|RL4_GEOUR RecName: Full=50S ribosomal protein L4
 gi|146396641|gb|ABQ25274.1| LSU ribosomal protein L4P [Geobacter uraniireducens Rf4]
          Length = 207

 Score =  114 bits (286), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 62/203 (30%), Positives = 113/203 (55%), Gaps = 1/203 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +L V ++  +  G I +S+ +F  + ++ ++   ++ Q   +R G    K RS VA +
Sbjct: 1   MAKLDVFDIKNKKVGEIELSDSVFNDEVKEYLIHEAVKIQLANRRAGTVGVKNRSAVAGS 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG+AR   +   Q+ GGG AFGP       ++ KK R  A+R ALS  F +
Sbjct: 61  GKKPFKQKGTGQARQGCRRAPQYPGGGVAFGPQAKTYNLSMNKKARRAAMRSALSLLFKN 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N + V++N+      TK  V       L   L++   + +RN +L+ARN+ N+ +L  +G
Sbjct: 121 NKLTVLNNIDLDNVSTKNFVGILNGFTLDKTLVVTDVE-NRNLELSARNVKNVKVLKSEG 179

Query: 181 INVYDILRCSKLVLSKSAIEALE 203
           +N++DI++   ++ +++++  +E
Sbjct: 180 LNIFDIMKYQSVIFTENSVRKVE 202


>gi|307709911|ref|ZP_07646358.1| 50S ribosomal protein L4 (BL4) [Streptococcus mitis SK564]
 gi|307711053|ref|ZP_07647475.1| 50S ribosomal protein L4 (BL4) [Streptococcus mitis SK321]
 gi|322388400|ref|ZP_08062003.1| 50S ribosomal protein L4 [Streptococcus infantis ATCC 700779]
 gi|307617015|gb|EFN96193.1| 50S ribosomal protein L4 (BL4) [Streptococcus mitis SK321]
 gi|307619282|gb|EFN98411.1| 50S ribosomal protein L4 (BL4) [Streptococcus mitis SK564]
 gi|321140713|gb|EFX36215.1| 50S ribosomal protein L4 [Streptococcus infantis ATCC 700779]
          Length = 207

 Score =  114 bits (286), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 109/204 (53%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +++ +  G+  G + +++ IF ++P Q ++  V+  Q    R G    K RS V+  
Sbjct: 1   MANVTLFDQTGKQAGEVVLNDAIFGIEPNQSVVFDVIISQRASLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LP+KVR LAL+   S+K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGIVFGPTPRSYAYKLPQKVRRLALKSVYSEKVAE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N  + +D+L     KT        AL + + +++   + +    L+ARN+PN+ +     
Sbjct: 121 NKFVAVDSLEFTAPKTAEFAKVLAALSIDSKVLVILEEGNEFAALSARNLPNVKVATATT 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
            +V DI    KL+++++AI  +E+
Sbjct: 181 ASVLDIANSDKLLVTQAAISKIEE 204


>gi|326692236|ref|ZP_08229241.1| 50S ribosomal protein L4 [Leuconostoc argentinum KCTC 3773]
          Length = 207

 Score =  114 bits (285), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 107/203 (52%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +++V   DG     + +++ +FA++P   ++   +  Q    R G    K RS V+  
Sbjct: 1   MTKVAVLKQDGSQAAELELNDAVFAIEPNNAVITDAVLMQRASMRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    QFRGGG  FGP P    + + +K   LAL+  LS K   
Sbjct: 61  GRKPWKQKGTGRARAGSIREPQFRGGGIVFGPTPRSYAYRINRKSYQLALKSVLSQKLAD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             ++V+D L  +  KT+        L +    ++   + + N  L+ARN+ N+ ++  +G
Sbjct: 121 GKLVVVDALSFEAPKTQDFKKVLANLSVDTKTLVVVDEDNENAILSARNLANVQVMTTKG 180

Query: 181 INVYDILRCSKLVLSKSAIEALE 203
           INV D++   KLV+ +S+IE ++
Sbjct: 181 INVLDVVNADKLVIVQSSIEEIQ 203


>gi|325689230|gb|EGD31236.1| 50S ribosomal protein L4 [Streptococcus sanguinis SK115]
          Length = 207

 Score =  114 bits (285), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 65/204 (31%), Positives = 109/204 (53%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + + +  G++ G + +++ IF ++P + ++  V+  Q    R G    K RS V+  
Sbjct: 1   MANVKLFDQTGKEAGEVVLNDAIFGIEPNESVVFDVIISQRASLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LP+KVR LAL+   S+K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGIVFGPTPRSYAYKLPRKVRRLALKSVYSEKVAE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N  + +D+L     KT        AL +   +++   + +    L+ARN+PN+ +     
Sbjct: 121 NKFVAVDSLSFTAPKTAEFAKVLAALSIDTKVLVILEEGNEFAALSARNLPNVKVATATT 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
            +V DI+   KL+++++AI  +E+
Sbjct: 181 ASVLDIVNSDKLLVTQAAISKIEE 204


>gi|324990001|gb|EGC21942.1| 50S ribosomal protein L4 [Streptococcus sanguinis SK353]
 gi|325697977|gb|EGD39860.1| 50S ribosomal protein L4 [Streptococcus sanguinis SK160]
          Length = 207

 Score =  114 bits (285), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 109/204 (53%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + + +  G++ G + +++ +F ++P + ++  V+  Q    R G    K RS V+  
Sbjct: 1   MANVKLFDQTGKEAGEVVLNDTVFGIEPNESVVFDVIISQRASLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LP+KVR LAL+   S+K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGIVFGPTPRSYAYKLPRKVRRLALKSVYSEKVAE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N  + +D+L     KT        AL +   +++   + +    L+ARN+PN+ +     
Sbjct: 121 NKFVAVDSLSFTAPKTAEFAKVLAALSIDTKVLVILEEGNEFAALSARNLPNVKVATATT 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
            +V DI+   KL+++++AI  +E+
Sbjct: 181 ASVLDIVNSDKLLVTQAAISKIEE 204


>gi|294784803|ref|ZP_06750091.1| ribosomal protein L4/L1 family protein [Fusobacterium sp. 3_1_27]
 gi|294486517|gb|EFG33879.1| ribosomal protein L4/L1 family protein [Fusobacterium sp. 3_1_27]
          Length = 209

 Score =  114 bits (285), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 71/206 (34%), Positives = 109/206 (52%), Gaps = 2/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  L+V NL G+  G + V++ +F ++P + +L  VL  +    R G + +K R+ V   
Sbjct: 1   MAVLNVYNLAGDQTGTLEVNDAVFGIEPNKVVLHEVLTAELAAARQGTASTKTRAMVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S       GGG  FGP P      + KKVR+LALR ALS K  +
Sbjct: 61  GRKPFKQKGTGRARQGSIRAPHMVGGGVTFGPHPRSYEKKVNKKVRNLALRSALSAKVAA 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNA--LIIDGCQLDRNFQLAARNIPNINLLPV 178
            +++V+D    +  KTK +V     +D       ++     D N  L+ARN+ N  +L  
Sbjct: 121 GNVLVLDYDGIETPKTKVIVNLVNKVDAKQKQLFVVGDLIKDYNLYLSARNLENAVILQP 180

Query: 179 QGINVYDILRCSKLVLSKSAIEALED 204
             I VY +L+  K++ +K A+  +E+
Sbjct: 181 NEIGVYWLLKQEKVIFTKEALAVVEE 206


>gi|148284213|ref|YP_001248303.1| 50S ribosomal protein L4 [Orientia tsutsugamushi str. Boryong]
 gi|189183952|ref|YP_001937737.1| 50S ribosomal protein L4 [Orientia tsutsugamushi str. Ikeda]
 gi|166234696|sp|A5CCL1|RL4_ORITB RecName: Full=50S ribosomal protein L4
 gi|226730701|sp|B3CT06|RL4_ORITI RecName: Full=50S ribosomal protein L4
 gi|146739652|emb|CAM79441.1| 50S ribosomal protein L4 [Orientia tsutsugamushi str. Boryong]
 gi|189180723|dbj|BAG40503.1| 50S ribosomal protein L4 [Orientia tsutsugamushi str. Ikeda]
          Length = 210

 Score =  114 bits (285), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 73/208 (35%), Positives = 116/208 (55%), Gaps = 3/208 (1%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +++ V NL  E +  + ++  +F LK +  I+  V+ WQ  ++  G   +K  S V+ T 
Sbjct: 1   MKVKVYNLLQEIEKEVELNPSVFCLKYRPDIIKLVIDWQLAKRMSGTHCTKTISGVSGTT 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K + QKGTG AR  S    Q RGGG + GPV       +PKK+R  AL++ALS K   N
Sbjct: 61  KKPFKQKGTGNARQGSLRSVQMRGGGISHGPVVRSHEFDVPKKIRKQALKYALSYKLSVN 120

Query: 122 DIMVIDNLVSKECKT---KYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPV 178
            ++V+D+      KT   K L+ ++   + S    ID   +DRNF LA+RN+ N+N++  
Sbjct: 121 KLIVVDDFNIGSNKTAVLKNLLKKYNYSNYSGFFCIDDQNVDRNFFLASRNLFNLNVVAQ 180

Query: 179 QGINVYDILRCSKLVLSKSAIEALEDRF 206
            G N YDI++   ++++ SA ++LE R 
Sbjct: 181 IGANPYDIMKHDCVMVTLSAAKSLEMRL 208


>gi|154249816|ref|YP_001410641.1| 50S ribosomal protein L4 [Fervidobacterium nodosum Rt17-B1]
 gi|171769378|sp|A7HM51|RL4_FERNB RecName: Full=50S ribosomal protein L4
 gi|154153752|gb|ABS60984.1| ribosomal protein L4/L1e [Fervidobacterium nodosum Rt17-B1]
          Length = 223

 Score =  114 bits (285), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 67/219 (30%), Positives = 121/219 (55%), Gaps = 15/219 (6%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++++ N+ GE  G I +++++F ++P   ++ R +  Q    R G + +K R EVA  
Sbjct: 1   MAQVTLYNIKGEKIGNIEIADEVFNVEPNLDVMWRYIDMQLTNSRAGTASTKTRGEVAGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QK TGRAR  S     +R GG A GP P   +  L KK++ LAL+ ALS +F  
Sbjct: 61  GRKPWPQKHTGRARQGSIRAIHWRHGGVAHGPKPRNYLKRLNKKMKKLALKSALSARFQE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALII----DGCQLDRNFQLAARNIP----- 171
            +++V+ ++  ++ +TK +    + L +++  ++       ++  N +L+ RNIP     
Sbjct: 121 GNLIVVSDIRFEKAQTKQMREVLKNLGIADEKVLFVLPRKEEVYENVKLSGRNIPGVKVI 180

Query: 172 ------NINLLPVQGINVYDILRCSKLVLSKSAIEALED 204
                 N N + + G+NVYDI+  SK+VL++  +  +E+
Sbjct: 181 IADNPNNGNPVNIDGLNVYDIINSSKVVLTEGTVRKIEE 219


>gi|303246994|ref|ZP_07333270.1| ribosomal protein L4/L1e [Desulfovibrio fructosovorans JJ]
 gi|302491701|gb|EFL51584.1| ribosomal protein L4/L1e [Desulfovibrio fructosovorans JJ]
          Length = 210

 Score =  114 bits (285), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 110/206 (53%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + V +   ++ G + ++ ++F ++ Q  +L  V+R Q   KR G    K RS V+  
Sbjct: 1   MANVKVYDQGRQEIGDVELAPEVFEVEVQPELLHLVVRAQLAAKRAGTHSVKTRSTVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     +RGG    GP P      + +KVR LALR ALS K   
Sbjct: 61  GKKPWRQKGTGRARAGSTRSPIWRGGAIVHGPQPRDYGFKVNRKVRLLALRMALSAKLGD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           + ++++D L   E KTK++        L  ALI+     D N +L+ARN+P I ++    
Sbjct: 121 DSLVLVDALSVPEVKTKHMAKVTSDFGLKKALIVLPAS-DNNLELSARNLPGIKVVREDM 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVYD+LR   LV+ K A   +++R 
Sbjct: 180 LNVYDVLRHDHLVMVKDAALKVQERL 205


>gi|125716986|ref|YP_001034119.1| 50S ribosomal protein L4 [Streptococcus sanguinis SK36]
 gi|323350941|ref|ZP_08086599.1| 50S ribosomal protein L4 [Streptococcus sanguinis VMC66]
 gi|166199916|sp|A3CK64|RL4_STRSV RecName: Full=50S ribosomal protein L4
 gi|125496903|gb|ABN43569.1| 50S ribosomal protein L4, putative [Streptococcus sanguinis SK36]
 gi|322122923|gb|EFX94629.1| 50S ribosomal protein L4 [Streptococcus sanguinis VMC66]
 gi|324991816|gb|EGC23741.1| 50S ribosomal protein L4 [Streptococcus sanguinis SK405]
 gi|324996294|gb|EGC28202.1| 50S ribosomal protein L4 [Streptococcus sanguinis SK678]
 gi|325686406|gb|EGD28436.1| 50S ribosomal protein L4 [Streptococcus sanguinis SK72]
 gi|325695809|gb|EGD37706.1| 50S ribosomal protein L4 [Streptococcus sanguinis SK150]
 gi|327463722|gb|EGF10038.1| 50S ribosomal protein L4 [Streptococcus sanguinis SK1057]
 gi|327467336|gb|EGF12836.1| 50S ribosomal protein L4 [Streptococcus sanguinis SK330]
 gi|327471741|gb|EGF17182.1| 50S ribosomal protein L4 [Streptococcus sanguinis SK408]
 gi|327490462|gb|EGF22244.1| 50S ribosomal protein L4 [Streptococcus sanguinis SK1058]
          Length = 207

 Score =  114 bits (284), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 109/204 (53%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + + +  G++ G + +++ +F ++P + ++  V+  Q    R G    K RS V+  
Sbjct: 1   MANVKLFDQTGKEAGEVVLNDAVFGIEPNESVVFDVIISQRASLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LP+KVR LAL+   S+K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGIVFGPTPRSYAYKLPRKVRRLALKSVYSEKVAE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N  + +D+L     KT        AL +   +++   + +    L+ARN+PN+ +     
Sbjct: 121 NKFVAVDSLSFTAPKTAEFAKVLAALSIDTKVLVILEEGNEFAALSARNLPNVKVATATT 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
            +V DI+   KL+++++AI  +E+
Sbjct: 181 ASVLDIVNSDKLLVTQAAISKIEE 204


>gi|15896382|ref|NP_349731.1| 50S ribosomal protein L4 [Clostridium acetobutylicum ATCC 824]
 gi|46577285|sp|Q97EH9|RL4_CLOAB RecName: Full=50S ribosomal protein L4
 gi|15026198|gb|AAK81071.1|AE007808_24 Ribosomal protein L4 [Clostridium acetobutylicum ATCC 824]
 gi|325510538|gb|ADZ22174.1| 50S ribosomal protein L4 [Clostridium acetobutylicum EA 2018]
          Length = 206

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 70/206 (33%), Positives = 109/206 (52%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + V N +G+    I +SE +F  K  +  L +V+  Q   KR G   +K R+EV+  
Sbjct: 1   MPTVEVFNKEGKKVEDIELSEKVFGAKISESALHQVVVAQLANKRQGTQSAKTRTEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+  GG  F P P     ++PK +R  A+  AL+ K   
Sbjct: 61  GIKPWRQKGTGRARQGSIRAPQWIHGGVVFAPKPRDYRISIPKSMRRTAMLSALTSKVND 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            +++V+D L     KTK +V    A +   ALI+   + D+N   + RNI    ++P   
Sbjct: 121 KEMIVLDELKIDAPKTKEIVKMLNAFEAKKALIV-VAESDQNVYKSVRNIQGAAVIPANN 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVYDIL+  K +++K A+  +E+ +
Sbjct: 180 LNVYDILKYDKFIVTKEAVSKIEEVY 205


>gi|291521897|emb|CBK80190.1| LSU ribosomal protein L4P [Coprococcus catus GD/7]
          Length = 206

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 69/206 (33%), Positives = 109/206 (52%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +LSV N++G   G I +++ +F ++  + ++ + +  Q    R G   +K RSEV+  
Sbjct: 1   MAKLSVYNIEGNQVGEIELNDAVFGVEVNENLMHKAVVAQLAASRQGTQSAKTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+ GGG  F P P      L KK R LA++ AL+ K   
Sbjct: 61  GRKPWRQKGTGHARQGSTRSPQWTGGGVVFAPKPRDYSIKLNKKERRLAIKSALTTKVNE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           + ++V+D+    E KTK  V     L    AL++   + D N   +A N+P +       
Sbjct: 121 SKLIVLDSFELDEIKTKKFVAVMNNLKAEKALVVLNEKND-NVIKSANNVPTVKTALTNT 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYDIL+   LVL++ A+  +++ +
Sbjct: 180 INVYDILKYDTLVLTQDAVATIQEVY 205


>gi|303328093|ref|ZP_07358532.1| ribosomal protein L4/L1 family protein [Desulfovibrio sp. 3_1_syn3]
 gi|302861919|gb|EFL84854.1| ribosomal protein L4/L1 family protein [Desulfovibrio sp. 3_1_syn3]
          Length = 210

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 73/209 (34%), Positives = 114/209 (54%), Gaps = 7/209 (3%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + V + + ++ G ++++ D+F ++ +  IL  V+R Q   KR G   +K R+ V+  
Sbjct: 1   MATVKVYDQNKQESGEMTLASDVFEIEVRPEILNLVVRAQMAAKRAGTHNAKTRAFVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     +RGG   FGP P      +  KVR+LAL+ ALS +   
Sbjct: 61  GVKPWKQKGTGRARSGSNRSPIWRGGAIIFGPSPRDYGFKVNSKVRALALKMALSSRLAG 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALII---DGCQLDRNFQLAARNIPNINLLP 177
             ++V+  +   E KTK+      AL L  ALI+   D   L R+    ARNIP + L  
Sbjct: 121 ESLLVVKGIELPEAKTKHFAKVAGALGLGKALIVTPEDNEALSRS----ARNIPGLTLTT 176

Query: 178 VQGINVYDILRCSKLVLSKSAIEALEDRF 206
              ++V D+L+  +LVL + A+E+++ RF
Sbjct: 177 PDRLSVLDVLKHKQLVLLEGAVESVQARF 205


>gi|238018624|ref|ZP_04599050.1| hypothetical protein VEIDISOL_00459 [Veillonella dispar ATCC 17748]
 gi|303230124|ref|ZP_07316893.1| 50S ribosomal protein L4 [Veillonella atypica ACS-134-V-Col7a]
 gi|303231196|ref|ZP_07317934.1| 50S ribosomal protein L4 [Veillonella atypica ACS-049-V-Sch6]
 gi|237865095|gb|EEP66385.1| hypothetical protein VEIDISOL_00459 [Veillonella dispar ATCC 17748]
 gi|302514103|gb|EFL56107.1| 50S ribosomal protein L4 [Veillonella atypica ACS-049-V-Sch6]
 gi|302515185|gb|EFL57158.1| 50S ribosomal protein L4 [Veillonella atypica ACS-134-V-Col7a]
          Length = 207

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 62/204 (30%), Positives = 113/204 (55%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  ++  N  G   G I +++ +F ++  + ++ + +  Q   +R+G   +K R  V   
Sbjct: 1   MPTVATYNQSGVKVGEIQLNDAVFGVEVNEAVMHQAVVRQLSNERLGTHATKTRGMVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     + GGG  FGP P     A+P+K R LA++ ALSDK  +
Sbjct: 61  GRKPWKQKGTGRARSGSSRSPIWIGGGTTFGPQPRSYYKAMPRKARRLAVKSALSDKVNN 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           +++ V++ +     KTK ++    + ++ +A ++   + D N + +ARNI  +  L  +G
Sbjct: 121 SELYVLEEITLAAPKTKEVLNIINSFNVGDAKVLFITEGDVNVERSARNIQGVKALACEG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +N++D+L   KL ++K A+  +E+
Sbjct: 181 MNIFDLLHYDKLFITKGAVAKIEE 204


>gi|62296686|sp|P49665|RL4_THETH RecName: Full=50S ribosomal protein L4
 gi|12056100|emb|CAC21224.1| ribosomal protein L4 [Thermus thermophilus]
          Length = 210

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 64/178 (35%), Positives = 99/178 (55%), Gaps = 6/178 (3%)

Query: 32  ILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGTGRARHSSKSVSQFRGGGKAFG 91
           +L  V+RWQ  ++R G + +K R EVAY+G K++ QK TGRARH       F GGG  FG
Sbjct: 32  LLWEVVRWQLAKRRRGTASTKTRGEVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFG 91

Query: 92  PVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNLVSKECKTKYLVTRFRALDLSNA 151
           P P    + LPKKVR   L  A++D+     +++++     E + + +    +   L  +
Sbjct: 92  PKPRDYSYTLPKKVRKKGLAMAVADRAREGKLLLVEAFAGVERQDQAIPAWAKEAGLDGS 151

Query: 152 ---LIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRCSKLVLSKSAIEALEDRF 206
              L++ G +L R    AARN+P +  L  +G+NVYDI+R  +LV+   A E  ++R 
Sbjct: 152 ESVLLVTGNELVRR---AARNLPWVVTLAPEGLNVYDIVRTERLVMDLDAWEVFQNRI 206


>gi|194213187|ref|XP_001493119.2| PREDICTED: similar to Mitochondrial ribosomal protein L4 [Equus
           caballus]
          Length = 326

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 111/206 (53%), Gaps = 4/206 (1%)

Query: 5   SVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKM 64
           S+R  + E  G+  +  D+FA  P+  IL +V  WQ   KRI  +K+K R+EV   G K 
Sbjct: 100 SLRGYEQERVGLTELHPDVFAAAPRLDILHQVAIWQKNFKRISYAKTKTRAEVRGGGRKP 159

Query: 65  YVQKGTGRARHSSKSVSQFRGGGKAFGPV-PIIGVHALPKKVRSLALRHALSDKFCSNDI 123
           + QKG+GRARH S     +RGGG A GP  P    + LP KVR   L+ ALS K   +D+
Sbjct: 160 WPQKGSGRARHGSIRSPIWRGGGIAHGPRGPTSYYYMLPMKVRVQGLKVALSVKLAQDDL 219

Query: 124 MVIDNLVSKECKTKYL--VTRFRALDLSNALI-IDGCQLDRNFQLAARNIPNINLLPVQG 180
            V+D+L     + +YL  + R+R    S  L+ ++   +  +   A   +   NL+P  G
Sbjct: 220 HVVDSLELPSAEPQYLAELARYRRWGDSVLLVDLEHEDMPPSIVAATSCLKTFNLVPAIG 279

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NV+ +L+   LVL+   +  LED+ 
Sbjct: 280 LNVHSMLKHQTLVLTLRTVAFLEDKL 305


>gi|310659501|ref|YP_003937222.1| 50S ribosomal protein L4 [Clostridium sticklandii DSM 519]
 gi|308826279|emb|CBH22317.1| 50S ribosomal subunit protein L4 [Clostridium sticklandii]
          Length = 207

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 66/206 (32%), Positives = 110/206 (53%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ V N++G+    + +SE IFA +  +  +  V++     +R G   +K R+EV   
Sbjct: 1   MPKVDVLNINGQKVEELELSESIFAAEISEYAVYEVIKNHLANRRQGTQSAKTRAEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+ GGG  F P P    +++ KKVR LAL+  L+ K   
Sbjct: 61  GRKPWRQKGTGRARQGSTRSPQWIGGGVVFAPKPRDYSYSVNKKVRRLALKSVLTTKVNE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            +++V+D L     KTK  +    A++     ++   +   N   + RNIP +++  V  
Sbjct: 121 GNLIVLDALEMNAPKTKDFIAMLSAVNAGKKALVVTSENSPNVVKSGRNIPGVDITFVNT 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVYDI+R   L+++K A+   E+ +
Sbjct: 181 LNVYDIMRHDSLIITKEAVRKTEEVY 206


>gi|269798549|ref|YP_003312449.1| ribosomal protein L4/L1e [Veillonella parvula DSM 2008]
 gi|282849865|ref|ZP_06259248.1| ribosomal protein L4/L1 family protein [Veillonella parvula ATCC
           17745]
 gi|294792795|ref|ZP_06757942.1| ribosomal protein L4/L1 family protein [Veillonella sp. 6_1_27]
 gi|294794549|ref|ZP_06759685.1| ribosomal protein L4/L1 family protein [Veillonella sp. 3_1_44]
 gi|313892995|ref|ZP_07826572.1| 50S ribosomal protein L4 [Veillonella sp. oral taxon 158 str.
           F0412]
 gi|269095178|gb|ACZ25169.1| ribosomal protein L4/L1e [Veillonella parvula DSM 2008]
 gi|282580302|gb|EFB85702.1| ribosomal protein L4/L1 family protein [Veillonella parvula ATCC
           17745]
 gi|294454879|gb|EFG23252.1| ribosomal protein L4/L1 family protein [Veillonella sp. 3_1_44]
 gi|294456694|gb|EFG25057.1| ribosomal protein L4/L1 family protein [Veillonella sp. 6_1_27]
 gi|313442348|gb|EFR60763.1| 50S ribosomal protein L4 [Veillonella sp. oral taxon 158 str.
           F0412]
          Length = 207

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 62/204 (30%), Positives = 113/204 (55%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  ++  N  G   G I +++ +F ++  + ++ + +  Q   +R+G   +K R  V   
Sbjct: 1   MPTVATYNQSGVKVGEIQLNDAVFGVEVNEAVMHQAVVRQLSNERLGTHATKTRGMVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     + GGG  FGP P     A+P+K R LA++ ALSDK  +
Sbjct: 61  GRKPWKQKGTGRARAGSSRSPIWIGGGTTFGPQPRSYYKAMPRKARRLAVKSALSDKVNN 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           +++ V++ +     KTK ++    + ++ +A ++   + D N + +ARNI  +  L  +G
Sbjct: 121 SELYVLEEITLAAPKTKEVLNIINSFNVGDAKVLFITEGDVNVERSARNIQGVKALACEG 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +N++D+L   KL ++K A+  +E+
Sbjct: 181 MNIFDLLHYDKLFITKGAVAKIEE 204


>gi|160932200|ref|ZP_02079591.1| hypothetical protein CLOLEP_01035 [Clostridium leptum DSM 753]
 gi|156868802|gb|EDO62174.1| hypothetical protein CLOLEP_01035 [Clostridium leptum DSM 753]
          Length = 207

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 107/206 (51%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  ++V ++ G++ G I +S+ +F ++P   ++  V+      +R G   +  RSEV+  
Sbjct: 1   MPNVAVFDVTGKEVGKIDLSDAVFGIEPNAVVMHEVVVNYLANQRQGTQSALTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+  GG  F P P    + + KKVR LAL+ ALS K   
Sbjct: 61  GKKPWRQKGTGHARQGSTRAPQWTHGGIVFAPKPRSYRYTVNKKVRRLALKSALSSKVQE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             ++V+D++     KTK +     AL      +I    +D+    +A NIP +    V  
Sbjct: 121 ESLVVLDSMTMDAYKTKTVAAMLNALGAEKKALIVLPSVDQKLIKSANNIPGVKTAQVNT 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYDIL   KL++ K A+  +E+ +
Sbjct: 181 INVYDILNADKLIVLKDAVAKIEEVY 206


>gi|260787918|ref|XP_002588998.1| hypothetical protein BRAFLDRAFT_124913 [Branchiostoma floridae]
 gi|229274171|gb|EEN45009.1| hypothetical protein BRAFLDRAFT_124913 [Branchiostoma floridae]
          Length = 264

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 66/202 (32%), Positives = 107/202 (52%), Gaps = 3/202 (1%)

Query: 8   NLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQ 67
           ++  E  G++ +  D+FA  P+  IL R +RWQ   ++I    ++ R+E+   G K + Q
Sbjct: 35  DIKDEKLGMVELHPDVFATHPRMDILHRCVRWQYLYRKINYDFARTRAEMRGGGRKPWPQ 94

Query: 68  KGTGRARHSSKSVSQFRGGGKAFGPV-PIIGVHALPKKVRSLALRHALSDKFCSNDIMVI 126
           KGTGRARH S     +  GGK  GP  P      LP K R+L L+ AL+ K    D+ ++
Sbjct: 95  KGTGRARHGSIRSPLWHMGGKCHGPRGPYSYYQYLPLKYRALGLKVALTVKHSQGDLHIV 154

Query: 127 DNLVSKECKTKYL--VTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVY 184
           D L       +YL  + R+R    S  L+    ++  N   A+  +  IN++P+ G+NVY
Sbjct: 155 DTLEIPTTDPEYLEDLVRYRNWGKSVLLVDMNEEISENVCEASAQLNTINVMPLVGLNVY 214

Query: 185 DILRCSKLVLSKSAIEALEDRF 206
            +L+   LVL+   ++ LE++ 
Sbjct: 215 SMLKHDTLVLTLPCVQKLENKL 236


>gi|322391200|ref|ZP_08064672.1| 50S ribosomal protein L4 [Streptococcus peroris ATCC 700780]
 gi|321145953|gb|EFX41342.1| 50S ribosomal protein L4 [Streptococcus peroris ATCC 700780]
          Length = 207

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 65/204 (31%), Positives = 109/204 (53%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +++ +  G+  G + +++ IF ++P + ++  V+  Q    R G    K RS V+  
Sbjct: 1   MANVTLFDQTGKQAGEVVLNDAIFGIEPNESVVFDVIVSQRASLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LP+KVR LAL+   S+K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGIVFGPTPRSYAYKLPQKVRRLALKSVYSEKVAE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N  + +D+L     KT        AL + + +++   + +    L+ARN+PN+ +     
Sbjct: 121 NKFVAVDSLEFTAPKTAEFAKVLAALSIDSKVLVILEEGNEFAALSARNLPNVKVATATT 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
            +V DI    KL+++++AI  +E+
Sbjct: 181 ASVLDIANSDKLLVTQAAISKIEE 204


>gi|256544507|ref|ZP_05471880.1| 50S ribosomal protein L4 [Anaerococcus vaginalis ATCC 51170]
 gi|256399832|gb|EEU13436.1| 50S ribosomal protein L4 [Anaerococcus vaginalis ATCC 51170]
          Length = 207

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 71/206 (34%), Positives = 106/206 (51%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ V N+ GE+ G I ++E +FA +  +  +   ++ Q   KR G   +K R+EV   
Sbjct: 1   MPKVEVLNIKGENVGEIELNETLFAAEIAETAVYDTVKNQLANKRQGTQSAKTRAEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     + GGG  F P P    + +PKK+R  AL   L+ K   
Sbjct: 61  GRKPFRQKGTGRARQGSIRAPHYTGGGIVFAPKPRDYSYKIPKKMRRKALYSVLTSKVND 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+++V+D L     KTK        ++ +    +   + D     + RNI   N+     
Sbjct: 121 NELIVLDELKLDSYKTKEANEILNNINANKKAYVVIAENDDKVYRSFRNIEGCNVEKANL 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYD+LR  KLV++K AI  LE+ F
Sbjct: 181 INVYDLLRHDKLVITKDAINKLEEVF 206


>gi|46579715|ref|YP_010523.1| 50S ribosomal protein L4 [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120602808|ref|YP_967208.1| 50S ribosomal protein L4 [Desulfovibrio vulgaris DP4]
 gi|81566853|sp|Q72CH9|RL4_DESVH RecName: Full=50S ribosomal protein L4
 gi|166234662|sp|A1VEB5|RL4_DESVV RecName: Full=50S ribosomal protein L4
 gi|46449130|gb|AAS95782.1| ribosomal protein L4 [Desulfovibrio vulgaris str. Hildenborough]
 gi|120563037|gb|ABM28781.1| LSU ribosomal protein L4P [Desulfovibrio vulgaris DP4]
 gi|311233506|gb|ADP86360.1| ribosomal protein L4/L1e [Desulfovibrio vulgaris RCH1]
          Length = 206

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 72/207 (34%), Positives = 113/207 (54%), Gaps = 1/207 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + V + + ++ G I+++ ++F ++ +  IL  V+R Q    R G   +K R+ V+  
Sbjct: 1   MAVVKVYDQNKQEAGEITLAPEVFEVEVRPEILHLVVRAQRAAFRAGTHATKTRAFVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     +RGG   FGP P      + KKVR LALR ALS +   
Sbjct: 61  GLKPWRQKGTGRARAGSIRSPLWRGGAIIFGPQPRDYEFKVNKKVRKLALRMALSSRLAG 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           ++++V+      E KTK        L L  ALII   + +    L+ RNIP I +   + 
Sbjct: 121 SNLLVVKGFELPEVKTKLFAKIADTLGLDKALII-APEENTTLALSVRNIPGITIATPEQ 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRFK 207
           ++VY+IL+  +LVL + A+ +++DR K
Sbjct: 180 LSVYEILKHKQLVLVEGAVASVQDRLK 206


>gi|82697333|ref|NP_001032527.1| 39S ribosomal protein L4, mitochondrial [Bos taurus]
 gi|108864722|sp|Q32PI6|RM04_BOVIN RecName: Full=39S ribosomal protein L4, mitochondrial; Short=L4mt;
           Short=MRP-L4
 gi|81294225|gb|AAI08103.1| Mitochondrial ribosomal protein L4 [Bos taurus]
 gi|296485803|gb|DAA27918.1| 39S ribosomal protein L4, mitochondrial [Bos taurus]
          Length = 294

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 70/206 (33%), Positives = 110/206 (53%), Gaps = 4/206 (1%)

Query: 5   SVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKM 64
           S+R  + E  G+  +  D+F+  P+  IL +V  WQ   KRI  +K+K R+EV   G K 
Sbjct: 68  SLRGYEQERVGLTELHPDVFSTAPRLDILHQVAIWQKNFKRISYAKTKTRAEVRGGGRKP 127

Query: 65  YVQKGTGRARHSSKSVSQFRGGGKAFGPV-PIIGVHALPKKVRSLALRHALSDKFCSNDI 123
           + QKG+GRARH S     +RGGG A GP  P    + LP KVR   L+ AL+ K   +D+
Sbjct: 128 WQQKGSGRARHGSIRSPIWRGGGVAHGPRGPTSYYYMLPMKVRVQGLKVALTVKLAQDDL 187

Query: 124 MVIDNLVSKECKTKYLV--TRFRALDLSNALI-IDGCQLDRNFQLAARNIPNINLLPVQG 180
            ++D+L       +YL+   R+R    S   + ++   + +N   A   +   NL+P  G
Sbjct: 188 HIVDSLELPTTDPQYLMELARYRRWGDSVLFVDLEHEDMPQNVVAATSGLKTFNLIPAIG 247

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NV+ +L+   LVL+   +  LE++ 
Sbjct: 248 LNVHSMLKHQTLVLTLPTVAFLEEKL 273


>gi|39997948|ref|NP_953899.1| 50S ribosomal protein L4 [Geobacter sulfurreducens PCA]
 gi|46577153|sp|P61063|RL4_GEOSL RecName: Full=50S ribosomal protein L4
 gi|39984893|gb|AAR36249.1| ribosomal protein L4 [Geobacter sulfurreducens PCA]
 gi|298506887|gb|ADI85610.1| ribosomal protein L4 [Geobacter sulfurreducens KN400]
          Length = 207

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 115/204 (56%), Gaps = 3/204 (1%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + V ++     GV+ +++++F  + ++ ++   ++ Q   +R G    K R+ V+  
Sbjct: 1   MATIDVFDISKNKVGVMDLNDNVFNGEVKEYLIHEAIKVQLANRRAGTVSVKNRAIVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K Y QKGTG+AR        F GGG AFGP P +   ++ KK R  A+R ALS  +  
Sbjct: 61  GKKPYRQKGTGQARQGCIRAPHFVGGGVAFGPRPKVYNLSMNKKARKAAVRSALSMLYKE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNAL-IIDGCQLDRNFQLAARNIPNINLLPVQ 179
           N + V+D+       TK  VT  +A DL+  L ++D   L  N +L+ARN+ ++ +L  +
Sbjct: 121 NKLSVLDSFTLPSISTKGFVTVLKAFDLAKTLVVVDEPNL--NLELSARNVKDVKVLKAE 178

Query: 180 GINVYDILRCSKLVLSKSAIEALE 203
            +NV+DI++ + +++++SA+  +E
Sbjct: 179 HLNVFDIVKYNNIIVTQSAVRTIE 202


>gi|126654433|ref|ZP_01726173.1| 50S ribosomal protein L4 [Bacillus sp. B14905]
 gi|126589120|gb|EAZ83317.1| 50S ribosomal protein L4 [Bacillus sp. B14905]
          Length = 142

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 61/137 (44%), Positives = 78/137 (56%)

Query: 68  KGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVID 127
           KGTGRAR  S    Q+RGGG  FGP P    + LPKKVR LAL+ ALS K    + +V+D
Sbjct: 3   KGTGRARQGSIRSPQWRGGGIVFGPTPRSYSYKLPKKVRRLALKSALSAKVVEQNFLVLD 62

Query: 128 NLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDIL 187
            L     KTK      + L L    +     LD N  L+ARNIP + +L   GINV D+L
Sbjct: 63  ALTLAAPKTKEFTKILKDLSLEKKSLFVTADLDENVALSARNIPGVTVLTANGINVLDLL 122

Query: 188 RCSKLVLSKSAIEALED 204
              K+V +KSA+E +E+
Sbjct: 123 GHEKVVFTKSAVEKVEE 139


>gi|168334351|ref|ZP_02692538.1| ribosomal protein L4/L1e [Epulopiscium sp. 'N.t. morphotype B']
          Length = 207

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 111/207 (53%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +SV N++G+  G +S+ + IF ++ ++ ++ + +      +R G   +K R+EV   
Sbjct: 1   MANVSVLNMEGKQVGEVSLDDGIFGVEIKEHLVHQAVVSYLANQRQGTQCTKTRAEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKG GRAR  S    Q+ GGG  F P P      + +K R  AL+ AL+ +   
Sbjct: 61  GRKPWRQKGGGRARQGSIRSPQWTGGGVVFAPKPRDYSFKVNRKERQQALKCALTSRVQE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             I+V+D L   E KTK +V    AL+L  AL++       N ++AA NI  +    V  
Sbjct: 121 KKIVVLDELKLTEAKTKSMVKVLDALNLKKALVVTEGDCAMNVKIAAGNIQGVKTSAVNN 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRFK 207
           INVYD+L+    V++K A+  +E+ +K
Sbjct: 181 INVYDVLKYDTFVVTKEALSKIEEVYK 207


>gi|222099968|ref|YP_002534536.1| 50S ribosomal protein L4 [Thermotoga neapolitana DSM 4359]
 gi|254803761|sp|B9K887|RL4_THENN RecName: Full=50S ribosomal protein L4
 gi|221572358|gb|ACM23170.1| 50S ribosomal protein L4 [Thermotoga neapolitana DSM 4359]
          Length = 235

 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 72/223 (32%), Positives = 123/223 (55%), Gaps = 19/223 (8%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ + N+ GE  G + +S+ +F + P   ++ R +  Q   +R G + +K R EV+  
Sbjct: 1   MAQVDLLNVKGEKVGTLEISDFVFNIDPNYDVMWRYVDMQLSNRRAGTASTKTRGEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QK TGRARH S     +R GG A GP P      L KK++ LALR ALS K+  
Sbjct: 61  GRKPWPQKHTGRARHGSIRSPIWRHGGVAHGPKPRDWSKKLNKKMKRLALRSALSVKYRE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSN--ALIIDGCQLDR--NFQLAARNIPNINLL 176
           N ++V+++L  +  KTK L    + LDL++  ALI+   + +   N +L+ +N+PN+ ++
Sbjct: 121 NKLLVLEDLKLERPKTKSLKEILQNLDLADKKALIVLPWKEEGYVNVKLSGKNLPNVKVI 180

Query: 177 ----P-----------VQGINVYDILRCSKLVLSKSAIEALED 204
               P           + G+NV+D+L+   L+L++  +  +E+
Sbjct: 181 IADNPNNSKNGEKAVRIDGLNVFDMLKYDYLILTRDMVAKIEE 223


>gi|15900146|ref|NP_344750.1| 50S ribosomal protein L4 [Streptococcus pneumoniae TIGR4]
 gi|15902233|ref|NP_357783.1| 50S ribosomal protein L4 [Streptococcus pneumoniae R6]
 gi|111658800|ref|ZP_01409431.1| hypothetical protein SpneT_02000097 [Streptococcus pneumoniae
           TIGR4]
 gi|116515366|ref|YP_815713.1| 50S ribosomal protein L4 [Streptococcus pneumoniae D39]
 gi|148987946|ref|ZP_01819409.1| 50S ribosomal protein L4 [Streptococcus pneumoniae SP6-BS73]
 gi|148992786|ref|ZP_01822429.1| 50S ribosomal protein L4 [Streptococcus pneumoniae SP9-BS68]
 gi|148996631|ref|ZP_01824349.1| 50S ribosomal protein L4 [Streptococcus pneumoniae SP11-BS70]
 gi|149001685|ref|ZP_01826658.1| 50S ribosomal protein L4 [Streptococcus pneumoniae SP14-BS69]
 gi|149005959|ref|ZP_01829688.1| 50S ribosomal protein L4 [Streptococcus pneumoniae SP18-BS74]
 gi|149011078|ref|ZP_01832383.1| 50S ribosomal protein L4 [Streptococcus pneumoniae SP19-BS75]
 gi|149017898|ref|ZP_01834357.1| 50S ribosomal protein L4 [Streptococcus pneumoniae SP23-BS72]
 gi|168483846|ref|ZP_02708798.1| ribosomal protein L4/L1 family [Streptococcus pneumoniae
           CDC1873-00]
 gi|168489687|ref|ZP_02713886.1| ribosomal protein L4/L1 family [Streptococcus pneumoniae SP195]
 gi|168492163|ref|ZP_02716306.1| ribosomal protein L4/L1 family [Streptococcus pneumoniae
           CDC0288-04]
 gi|168493903|ref|ZP_02718046.1| ribosomal protein L4/L1 family [Streptococcus pneumoniae
           CDC3059-06]
 gi|168576363|ref|ZP_02722246.1| ribosomal protein L4/L1 family [Streptococcus pneumoniae MLV-016]
 gi|169833141|ref|YP_001693742.1| 50S ribosomal protein L4 [Streptococcus pneumoniae Hungary19A-6]
 gi|182683189|ref|YP_001834936.1| 50S ribosomal protein L4 [Streptococcus pneumoniae CGSP14]
 gi|225853816|ref|YP_002735328.1| 50S ribosomal protein L4 [Streptococcus pneumoniae JJA]
 gi|225855975|ref|YP_002737486.1| 50S ribosomal protein L4 [Streptococcus pneumoniae P1031]
 gi|225858064|ref|YP_002739574.1| 50S ribosomal protein L4 [Streptococcus pneumoniae 70585]
 gi|225860252|ref|YP_002741761.1| 50S ribosomal protein L4 [Streptococcus pneumoniae Taiwan19F-14]
 gi|237649722|ref|ZP_04523974.1| 50S ribosomal protein L4 [Streptococcus pneumoniae CCRI 1974]
 gi|298230367|ref|ZP_06964048.1| 50S ribosomal protein L4 [Streptococcus pneumoniae str. Canada
           MDR_19F]
 gi|298255988|ref|ZP_06979574.1| 50S ribosomal protein L4 [Streptococcus pneumoniae str. Canada
           MDR_19A]
 gi|298502024|ref|YP_003723964.1| 50S ribosomal protein L4 [Streptococcus pneumoniae TCH8431/19A]
 gi|303255094|ref|ZP_07341170.1| 50S ribosomal protein L4 [Streptococcus pneumoniae BS455]
 gi|303259262|ref|ZP_07345240.1| 50S ribosomal protein L4 [Streptococcus pneumoniae SP-BS293]
 gi|303261017|ref|ZP_07346966.1| 50S ribosomal protein L4 [Streptococcus pneumoniae SP14-BS292]
 gi|303263345|ref|ZP_07349268.1| 50S ribosomal protein L4 [Streptococcus pneumoniae BS397]
 gi|303265510|ref|ZP_07351410.1| 50S ribosomal protein L4 [Streptococcus pneumoniae BS457]
 gi|303267932|ref|ZP_07353734.1| 50S ribosomal protein L4 [Streptococcus pneumoniae BS458]
 gi|307066887|ref|YP_003875853.1| hypothetical protein SPAP_0258 [Streptococcus pneumoniae AP200]
 gi|307126430|ref|YP_003878461.1| 50S ribosomal protein L4/L1 family [Streptococcus pneumoniae
           670-6B]
 gi|46396654|sp|Q97SV4|RL4_STRPN RecName: Full=50S ribosomal protein L4
 gi|46577255|sp|Q8CWV7|RL4_STRR6 RecName: Full=50S ribosomal protein L4
 gi|122279401|sp|Q04MN5|RL4_STRP2 RecName: Full=50S ribosomal protein L4
 gi|226730731|sp|B1I8J9|RL4_STRPI RecName: Full=50S ribosomal protein L4
 gi|226730739|sp|B2IS41|RL4_STRPS RecName: Full=50S ribosomal protein L4
 gi|254803755|sp|C1CAL3|RL4_STRP7 RecName: Full=50S ribosomal protein L4
 gi|254803758|sp|C1CC07|RL4_STRZJ RecName: Full=50S ribosomal protein L4
 gi|254803759|sp|C1CI98|RL4_STRZP RecName: Full=50S ribosomal protein L4
 gi|254803760|sp|C1CP89|RL4_STRZT RecName: Full=50S ribosomal protein L4
 gi|14971678|gb|AAK74390.1| ribosomal protein L4 [Streptococcus pneumoniae TIGR4]
 gi|15457733|gb|AAK98993.1| 50S Ribosomal protein L4 [Streptococcus pneumoniae R6]
 gi|116075942|gb|ABJ53662.1| ribosomal protein L4 [Streptococcus pneumoniae D39]
 gi|147757206|gb|EDK64245.1| 50S ribosomal protein L4 [Streptococcus pneumoniae SP11-BS70]
 gi|147760143|gb|EDK67132.1| 50S ribosomal protein L4 [Streptococcus pneumoniae SP14-BS69]
 gi|147762315|gb|EDK69276.1| 50S ribosomal protein L4 [Streptococcus pneumoniae SP18-BS74]
 gi|147764714|gb|EDK71644.1| 50S ribosomal protein L4 [Streptococcus pneumoniae SP19-BS75]
 gi|147926410|gb|EDK77483.1| 50S ribosomal protein L4 [Streptococcus pneumoniae SP6-BS73]
 gi|147928512|gb|EDK79527.1| 50S ribosomal protein L4 [Streptococcus pneumoniae SP9-BS68]
 gi|147931462|gb|EDK82440.1| 50S ribosomal protein L4 [Streptococcus pneumoniae SP23-BS72]
 gi|168995643|gb|ACA36255.1| ribosomal protein L4/L1 family [Streptococcus pneumoniae
           Hungary19A-6]
 gi|172042817|gb|EDT50863.1| ribosomal protein L4/L1 family [Streptococcus pneumoniae
           CDC1873-00]
 gi|182628523|gb|ACB89471.1| 50S ribosomal protein L4 [Streptococcus pneumoniae CGSP14]
 gi|183571793|gb|EDT92321.1| ribosomal protein L4/L1 family [Streptococcus pneumoniae SP195]
 gi|183573611|gb|EDT94139.1| ribosomal protein L4/L1 family [Streptococcus pneumoniae
           CDC0288-04]
 gi|183576018|gb|EDT96546.1| ribosomal protein L4/L1 family [Streptococcus pneumoniae
           CDC3059-06]
 gi|183577871|gb|EDT98399.1| ribosomal protein L4/L1 family [Streptococcus pneumoniae MLV-016]
 gi|225720617|gb|ACO16471.1| ribosomal protein L4/L1 family [Streptococcus pneumoniae 70585]
 gi|225723287|gb|ACO19140.1| ribosomal protein L4/L1 family [Streptococcus pneumoniae JJA]
 gi|225725631|gb|ACO21483.1| ribosomal protein L4/L1 family [Streptococcus pneumoniae P1031]
 gi|225728067|gb|ACO23918.1| ribosomal protein L4/L1 family [Streptococcus pneumoniae
           Taiwan19F-14]
 gi|298237619|gb|ADI68750.1| 50S ribosomal protein L4 [Streptococcus pneumoniae TCH8431/19A]
 gi|301793483|emb|CBW35856.1| 50S ribosomal protein L4 [Streptococcus pneumoniae INV104]
 gi|301801154|emb|CBW33827.1| 50S ribosomal protein L4 [Streptococcus pneumoniae INV200]
 gi|302597924|gb|EFL64994.1| 50S ribosomal protein L4 [Streptococcus pneumoniae BS455]
 gi|302637854|gb|EFL68340.1| 50S ribosomal protein L4 [Streptococcus pneumoniae SP14-BS292]
 gi|302639680|gb|EFL70137.1| 50S ribosomal protein L4 [Streptococcus pneumoniae SP-BS293]
 gi|302642628|gb|EFL72973.1| 50S ribosomal protein L4 [Streptococcus pneumoniae BS458]
 gi|302644950|gb|EFL75197.1| 50S ribosomal protein L4 [Streptococcus pneumoniae BS457]
 gi|302647118|gb|EFL77342.1| 50S ribosomal protein L4 [Streptococcus pneumoniae BS397]
 gi|306408424|gb|ADM83851.1| hypothetical protein SPAP_0258 [Streptococcus pneumoniae AP200]
 gi|306483492|gb|ADM90361.1| ribosomal protein L4/L1 family [Streptococcus pneumoniae 670-6B]
 gi|327390629|gb|EGE88969.1| 50S ribosomal protein L4 [Streptococcus pneumoniae GA04375]
 gi|332075875|gb|EGI86342.1| 50S ribosomal protein L4 [Streptococcus pneumoniae GA17570]
 gi|332076656|gb|EGI87118.1| 50S ribosomal protein L4 [Streptococcus pneumoniae GA17545]
 gi|332077511|gb|EGI87972.1| 50S ribosomal protein L4 [Streptococcus pneumoniae GA41301]
          Length = 207

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 65/204 (31%), Positives = 109/204 (53%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +++ +  G++ G + +S+ +F ++P + ++  V+  Q    R G    K RS V+  
Sbjct: 1   MANVTLFDQTGKEAGQVVLSDAVFGIEPNESVVFDVIISQRASLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LP+KVR LAL+   S+K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYGYKLPQKVRRLALKSVYSEKVAE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N  + +D L     KT        AL + + +++   + +    L+ARN+PN+ +     
Sbjct: 121 NKFVAVDALSFTAPKTAEFAKVLAALSIDSKVLVILEEGNEFAALSARNLPNVKVATATT 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
            +V DI    KL+++++AI  +E+
Sbjct: 181 ASVLDIANSDKLLVTQAAISKIEE 204


>gi|302558993|ref|ZP_07311335.1| 50S ribosomal protein L4/L1 [Streptomyces griseoflavus Tu4000]
 gi|302476611|gb|EFL39704.1| 50S ribosomal protein L4/L1 [Streptomyces griseoflavus Tu4000]
          Length = 219

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 107/204 (52%), Gaps = 2/204 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFAL-KPQQGILARVLRWQSWRKRIGCSKSKGRSEVAY 59
           M  + + +  GE  G + +  +IF + K    ++ +V+  Q+   R G  K+K R EV  
Sbjct: 1   MSTVDILSPAGEKTGSVELPAEIFGVEKISIPLIHQVVVAQNAAARQGTHKTKRRGEVRG 60

Query: 60  TGSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFC 119
            G K Y QKGTGRAR  S    QF GGG   GPVP       PKK+++ ALRHAL+D+  
Sbjct: 61  GGKKPYRQKGTGRARQGSTRAPQFAGGGVVHGPVPRDYSQRTPKKMKAAALRHALTDRAR 120

Query: 120 SNDIMVIDNLVSKEC-KTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPV 178
            N I V+  ++  E   TK   T F  +     L++   + D    L+ARN+P +++L  
Sbjct: 121 HNRIHVVSGVIEGETPSTKAARTLFGKISERKNLLLVVDRADEAAWLSARNLPQVHILEP 180

Query: 179 QGINVYDILRCSKLVLSKSAIEAL 202
             +N YD+L    +V +K+A E+ 
Sbjct: 181 GQLNTYDVLVSDDVVFTKAAFESF 204


>gi|295838405|ref|ZP_06825338.1| ribosomal protein L4/L1 family protein [Streptomyces sp. SPB74]
 gi|302519660|ref|ZP_07272002.1| ribosomal protein L4/L1 [Streptomyces sp. SPB78]
 gi|197695798|gb|EDY42731.1| ribosomal protein L4/L1 family protein [Streptomyces sp. SPB74]
 gi|302428555|gb|EFL00371.1| ribosomal protein L4/L1 [Streptomyces sp. SPB78]
          Length = 216

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 68/202 (33%), Positives = 104/202 (51%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + + +  G+  G + +  +IF  K    ++ +V+  Q    R G  K+K R EV   
Sbjct: 1   MSTVDILSPAGDKAGTVELPAEIFDAKVSVPLIHQVVVAQLAAARQGTHKTKTRGEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K Y QKGTGRAR  S    QF GGG   GPVP       PKK+++ ALR ALSD+  +
Sbjct: 61  GKKPYRQKGTGRARQGSTRAPQFAGGGVVHGPVPRDYSQRTPKKMKAAALRGALSDRARN 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             I V+  ++  E  TK   T F  +     L++   + D    L+ARN+P +++L    
Sbjct: 121 ARIHVVSGVIEGEVSTKAAKTLFGKISERKNLLLVAERSDEAAWLSARNLPRVHILEPGQ 180

Query: 181 INVYDILRCSKLVLSKSAIEAL 202
           +N YD+L    +V +++A E+ 
Sbjct: 181 LNTYDVLVSDDVVFTQAAFESF 202


>gi|318058127|ref|ZP_07976850.1| 50S ribosomal protein L4 [Streptomyces sp. SA3_actG]
 gi|318076020|ref|ZP_07983352.1| 50S ribosomal protein L4 [Streptomyces sp. SA3_actF]
          Length = 216

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 68/202 (33%), Positives = 104/202 (51%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + + +  G+  G + +  +IF  K    ++ +V+  Q    R G  K+K R EV   
Sbjct: 1   MSTVDILSPAGDKAGTVELPAEIFDAKVSVPLIHQVVVAQLAAARQGTHKTKTRGEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K Y QKGTGRAR  S    QF GGG   GPVP       PKK+++ ALR ALSD+  +
Sbjct: 61  GKKPYRQKGTGRARQGSTRAPQFAGGGVVHGPVPRDYSQRTPKKMKAAALRGALSDRARN 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             I V+  ++  E  TK   T F  +     L++   + D    L+ARN+P +++L    
Sbjct: 121 ARIHVVSGVIEGEVSTKAAKTLFGKISERKNLLLIAERSDEAAWLSARNLPRVHILEPGQ 180

Query: 181 INVYDILRCSKLVLSKSAIEAL 202
           +N YD+L    +V +++A E+ 
Sbjct: 181 LNTYDVLVSDDVVFTQAAFESF 202


>gi|322386353|ref|ZP_08059983.1| 50S ribosomal protein L4 [Streptococcus cristatus ATCC 51100]
 gi|321269577|gb|EFX52507.1| 50S ribosomal protein L4 [Streptococcus cristatus ATCC 51100]
          Length = 207

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 65/204 (31%), Positives = 108/204 (52%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + + +  G++ G + +++ IF ++P + ++  V+  Q    R G    K RS V+  
Sbjct: 1   MANVKLFDQTGKEAGEVVLNDAIFGIEPNESVVFDVIISQRASLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LP+KVR LAL+   S+K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGIVFGPTPRSYAYKLPQKVRRLALKSVYSEKVAE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N  + +D+L     KT        AL +   +++   + +    L+ARN+PN+ +     
Sbjct: 121 NKFVAVDSLSFTAPKTAEFAKVLAALSIDTKVLVILEEGNEFAALSARNLPNVKVATATT 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
            +V DI    KL+++++AI  +E+
Sbjct: 181 ASVLDIANSDKLLVTQAAISKIEE 204


>gi|307708061|ref|ZP_07644529.1| ribosomal protein L4/L1 family [Streptococcus mitis NCTC 12261]
 gi|307615846|gb|EFN95051.1| ribosomal protein L4/L1 family [Streptococcus mitis NCTC 12261]
          Length = 207

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 65/204 (31%), Positives = 109/204 (53%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +++ +  G+  G + +++ IF ++P + ++  V+  Q    R G    K RS V+  
Sbjct: 1   MANVTLFDQTGKQAGEVVLNDAIFGIEPNESVVFDVIISQRASLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LP+KVR LAL+   S+K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGIVFGPTPRSYAYKLPQKVRRLALKSVYSEKVAE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N  + +D+L     KT        AL + + +++   + +    L+ARN+PN+ +     
Sbjct: 121 NKFVAVDSLEFTAPKTAEFAKVLAALSIDSKVLVILEEGNEFAALSARNLPNVKVATATT 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
            +V DI    KL+++++AI  +E+
Sbjct: 181 ASVLDIANSDKLLVTQAAISKIEE 204


>gi|289168731|ref|YP_003447000.1| 50S ribosomal protein L4 [Streptococcus mitis B6]
 gi|288908298|emb|CBJ23140.1| 50S ribosomal protein L4 [Streptococcus mitis B6]
          Length = 207

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 65/204 (31%), Positives = 109/204 (53%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +++ +  G+  G + +++ IF ++P + ++  V+  Q    R G    K RS V+  
Sbjct: 1   MANVTLFDQTGKQAGEVVLNDAIFGIEPNESVVFDVIVSQRASLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LP+KVR LAL+   S+K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGIVFGPTPRNYAYKLPQKVRRLALKSVYSEKVAE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N  + +D+L     KT        AL + + +++   + +    L+ARN+PN+ +     
Sbjct: 121 NKFVAVDSLEFTAPKTAEFAKVLAALSIDSKVLVILEEGNEFAALSARNLPNVKVATATT 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
            +V DI    KL+++++AI  +E+
Sbjct: 181 ASVLDIANSDKLLVTQAAISKIEE 204


>gi|110639534|ref|YP_679743.1| 50S ribosomal protein L4 [Cytophaga hutchinsonii ATCC 33406]
 gi|122966548|sp|Q11QB3|RL4_CYTH3 RecName: Full=50S ribosomal protein L4
 gi|110282215|gb|ABG60401.1| LSU ribosomal protein L4P [Cytophaga hutchinsonii ATCC 33406]
          Length = 208

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 69/205 (33%), Positives = 116/205 (56%), Gaps = 4/205 (1%)

Query: 2   IELSVRNLDGEDKGV-ISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           +ELS+ N+ G+D G  + +S+DIFA++P    +   ++     +R G  K+K R+EV+++
Sbjct: 1   MELSLLNIKGKDTGKKVVLSDDIFAVEPNNHAIYLDVKQYLAHQRQGTHKAKERAEVSFS 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
             K+  QKGTG AR  S+    F GGG  FGP P      + KKV+ LA + A S K   
Sbjct: 61  TKKLKKQKGTGGARAGSRKSPIFVGGGTIFGPRPRTYGFKVNKKVKDLARKSAFSHKLKE 120

Query: 121 NDIMVIDNLVSKECKTK-YL-VTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPV 178
           +++ V++N      KTK YL + +  +LD    L +    +D+N  L++RN+    ++ V
Sbjct: 121 SNVTVLENFTLNAPKTKDYLAILKDLSLDTKKTLFVI-ADIDKNIILSSRNLKKAKVVSV 179

Query: 179 QGINVYDILRCSKLVLSKSAIEALE 203
             IN YD++   K+V+S+ ++  +E
Sbjct: 180 DQINTYDLVNADKVVISEGSVSKIE 204


>gi|153816251|ref|ZP_01968919.1| hypothetical protein RUMTOR_02500 [Ruminococcus torques ATCC 27756]
 gi|145846434|gb|EDK23352.1| hypothetical protein RUMTOR_02500 [Ruminococcus torques ATCC 27756]
          Length = 206

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 68/208 (32%), Positives = 115/208 (55%), Gaps = 5/208 (2%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++SV N++G++   I +++ +F ++  + ++   +  Q    R G  K+K RSEV+  
Sbjct: 1   MAKVSVYNIEGKEVDTIELNDAVFGVEVNEHLVHMAVVNQLANNRQGTQKAKTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+ GGG  F PVP      + KK +  AL+ ALS +   
Sbjct: 61  GRKPWRQKGTGHARQGSTRAPQWTGGGVVFAPVPRDYSFKMNKKEKRAALKSALSSRVEE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALII--DGCQLDRNFQLAARNIPNINLLPV 178
           N  +V+D +   E KTK        L+++ AL++  DG   + N +++ARNI  +     
Sbjct: 121 NKFIVVDEMNFDEIKTKKFQNVLNNLNVNKALVVLEDG---NTNAEISARNIAGVKTART 177

Query: 179 QGINVYDILRCSKLVLSKSAIEALEDRF 206
             INVYDIL+ + ++ +K+A+  +E+ +
Sbjct: 178 NTINVYDILKYNTVIATKAAVATIEEVY 205


>gi|73986986|ref|XP_854013.1| PREDICTED: similar to mitochondrial ribosomal protein L4 isoform a
           [Canis familiaris]
          Length = 294

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 70/207 (33%), Positives = 111/207 (53%), Gaps = 6/207 (2%)

Query: 5   SVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKM 64
           S+R  + E  G+  +  ++F+  P+  IL +V  WQ   KRI  +K+K R+EV   G K 
Sbjct: 68  SLRGYEQERVGLAELHPEVFSTAPRLDILHQVAIWQRNFKRISYAKTKTRAEVQGGGRKP 127

Query: 65  YVQKGTGRARHSSKSVSQFRGGGKAFGPV-PIIGVHALPKKVRSLALRHALSDKFCSNDI 123
           + QKG+GR+RH S     +RGGG A GP  P    + LP KVR   L+ AL+ K   +D+
Sbjct: 128 WPQKGSGRSRHGSIRSPIWRGGGIAHGPRGPTSYYYMLPMKVRVQGLKVALTVKLAQDDL 187

Query: 124 MVIDNLVSKECKTKYL--VTRFRALDLSNALIIDGC--QLDRNFQLAARNIPNINLLPVQ 179
            ++D+L       +YL  + R+R     + L++D     + +N   A   +   NL+P  
Sbjct: 188 HIVDSLELPTSDPQYLTELARYRHWG-DSVLLVDLAYENMPQNIVAATTGLKTFNLIPAV 246

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRF 206
           G+NVY +L+   LVL+   +  LE++ 
Sbjct: 247 GLNVYSMLKHQTLVLTLQTLAFLEEKL 273


>gi|66810850|ref|XP_639132.1| hypothetical protein DDB_G0283275 [Dictyostelium discoideum AX4]
 gi|60467762|gb|EAL65778.1| hypothetical protein DDB_G0283275 [Dictyostelium discoideum AX4]
          Length = 258

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 68/207 (32%), Positives = 113/207 (54%), Gaps = 4/207 (1%)

Query: 2   IELSVRNLDGEDKGV--ISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAY 59
           IE+ V N + +   +  I +S+D+F++  +  +L R++R+Q  + + G  ++     +  
Sbjct: 49  IEVPVLNFNDKLSPIENIQLSKDVFSVPLRVDLLHRMVRYQRAKSQQGTHQALNMGRMER 108

Query: 60  TGSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFC 119
           T  K   QKG+G AR  +     FRGG + F P      H LP+KVR L L+ ALS K  
Sbjct: 109 TNKKPTRQKGSGNARKGTNHSVHFRGGARTFAPTMRSHAHDLPRKVRKLCLKVALSTKLA 168

Query: 120 SNDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
            N ++V+D    +  KTK L+++    D    L++D  ++      ++ N+  I+ LP  
Sbjct: 169 QNKLVVVDGFNLESHKTKELLSKLPK-DWGRTLLVD-SEISDFLNKSSLNVQKIDTLPQL 226

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRF 206
           G+NVY IL+   LVL+KS++EAL+ R 
Sbjct: 227 GLNVYTILQNDTLVLTKSSVEALQARL 253


>gi|297159598|gb|ADI09310.1| 50S ribosomal protein L4 [Streptomyces bingchenggensis BCW-1]
          Length = 217

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 68/202 (33%), Positives = 104/202 (51%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + + +  G+  G + +  +IF  +    ++ +V+  Q    R G  K+K R EV   
Sbjct: 1   MSTIDILSPAGDKAGTVELPAEIFDAQVSVPLIHQVVVAQLAAARQGTHKTKTRGEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K Y QKGTGRAR  S    QF GGG   GPVP       PKK+++ ALR ALSD+   
Sbjct: 61  GKKPYRQKGTGRARQGSTRAPQFAGGGVVHGPVPRDYSQRTPKKMKAAALRGALSDRARH 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           + I V+  ++  E  TK   T F  +     L++   + D    L+ARN+P +++L    
Sbjct: 121 SRIHVVTGVIEGEVSTKAAKTLFGKISERKNLLLVVERSDEAAWLSARNLPQVHILEPGQ 180

Query: 181 INVYDILRCSKLVLSKSAIEAL 202
           +N YD+L    +V +K+A E+ 
Sbjct: 181 LNTYDVLVSDDVVFTKAAFESF 202


>gi|302876533|ref|YP_003845166.1| 50S ribosomal protein L4/L1e [Clostridium cellulovorans 743B]
 gi|307687206|ref|ZP_07629652.1| 50S ribosomal protein L4 [Clostridium cellulovorans 743B]
 gi|302579390|gb|ADL53402.1| ribosomal protein L4/L1e [Clostridium cellulovorans 743B]
          Length = 206

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 63/206 (30%), Positives = 117/206 (56%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + + N +G++ G I +++++FA K  +  + +V+      KR G   +K R+EV+  
Sbjct: 1   MPTVGLFNKEGQNVGDIQLNDNVFAAKISEAAVHQVVVALLANKRQGTQSAKTRAEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+  GG  F P P     ++PK ++  A++  L+ K   
Sbjct: 61  GIKPWRQKGTGRARQGSIRSPQWIHGGIVFAPKPRDYRVSIPKSMKRTAMKSVLTSKVND 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+++V+++L     KTK  V   +A ++  AL++   + + N   + RN+  + ++PV  
Sbjct: 121 NELVVLESLAFDAPKTKEAVAMLKAFEVKKALVVV-AESNENVYKSIRNVEGVEVIPVNN 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYD+L+  K++++K A+  +E+ +
Sbjct: 180 INVYDLLKYPKVLITKDAVSKIEEVY 205


>gi|212704584|ref|ZP_03312712.1| hypothetical protein DESPIG_02646 [Desulfovibrio piger ATCC 29098]
 gi|212671983|gb|EEB32466.1| hypothetical protein DESPIG_02646 [Desulfovibrio piger ATCC 29098]
          Length = 207

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 70/207 (33%), Positives = 113/207 (54%), Gaps = 1/207 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + V + + ++ G +++S D+F ++ +  IL  V+R Q   KR G   +K R+ V+  
Sbjct: 1   MATVKVYDQNKQECGELTLSADVFEVEARPEILNLVVRAQMAAKRAGTHMAKTRAFVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     +RGG   FGP P      +  KVR+LA++ ALS +  +
Sbjct: 61  GVKPWKQKGTGRARSGSNRSPVWRGGAIVFGPQPRDYSFKVNSKVRALAMKMALSSRLAA 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            +++V+  +   E KTK+       L L+ ALI+   +       +ARNIP I L     
Sbjct: 121 ENLLVVKGIELPEAKTKHFAKVAGTLGLNKALIVT-AEESEALTRSARNIPGITLTTPDR 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRFK 207
           ++V +ILR  +LVL + A+  ++ RF+
Sbjct: 180 LSVLEILRHKQLVLLEGAVAPVQARFE 206


>gi|317153957|ref|YP_004122005.1| 50S ribosomal protein L4/L1e [Desulfovibrio aespoeensis Aspo-2]
 gi|316944208|gb|ADU63259.1| ribosomal protein L4/L1e [Desulfovibrio aespoeensis Aspo-2]
          Length = 206

 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 110/207 (53%), Gaps = 1/207 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +L V + + +  G I ++ ++F ++ Q  IL  V+R Q   KR G   +K R   +  
Sbjct: 1   MAKLQVVDQNNQKVGDIELAPEVFEVEIQPEILNLVVRAQRAAKRSGTHATKTRGMKSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     +RGG   FGP P      + KK+R LAL+ ALS +   
Sbjct: 61  GRKPWRQKGTGRARAGSSRSPLWRGGAVLFGPQPRDYSFKVNKKIRKLALQMALSSRVAE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           + + V+ ++   E KTK        L L   LI+     D N  L+ARN+P I ++    
Sbjct: 121 DKVTVVKSIDLAEIKTKAFAAVVEKLGLGKTLIVL-KDADLNLALSARNVPGIKVIEADK 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRFK 207
           +NVYD+L   +LV+ ++A + +++R K
Sbjct: 180 LNVYDVLLYPELVMFEAAAQDVQERLK 206


>gi|293364346|ref|ZP_06611072.1| 50S ribosomal protein L4 [Streptococcus oralis ATCC 35037]
 gi|307702687|ref|ZP_07639639.1| 50S ribosomal protein L4 (BL4) [Streptococcus oralis ATCC 35037]
 gi|307704066|ref|ZP_07640995.1| 50S ribosomal protein L4 (BL4) [Streptococcus mitis SK597]
 gi|291317192|gb|EFE57619.1| 50S ribosomal protein L4 [Streptococcus oralis ATCC 35037]
 gi|307622356|gb|EFO01364.1| 50S ribosomal protein L4 (BL4) [Streptococcus mitis SK597]
 gi|307623803|gb|EFO02788.1| 50S ribosomal protein L4 (BL4) [Streptococcus oralis ATCC 35037]
          Length = 207

 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 110/204 (53%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +++ +  G++ G + +++ +F ++P + ++  V+  Q    R G    K RS V+  
Sbjct: 1   MANVTLFDQTGKEAGQVVLNDAVFGIEPNESVVFDVIISQRASLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LP+KVR LAL+   S+K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYGYKLPQKVRRLALKSVYSEKVAE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N  + +D+L     KT        AL + + +++   + +    L+ARN+PN+ +     
Sbjct: 121 NKFVAVDSLEFTAPKTAEFAKVLAALSIDSKVLVILEEGNEFAALSARNLPNVKVATATT 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
            +V DI    KL+++++AI  +E+
Sbjct: 181 ASVLDIANSDKLLVTQAAISKIEE 204


>gi|323700807|ref|ZP_08112719.1| ribosomal protein L4/L1e [Desulfovibrio sp. ND132]
 gi|323460739|gb|EGB16604.1| ribosomal protein L4/L1e [Desulfovibrio desulfuricans ND132]
          Length = 206

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 112/207 (54%), Gaps = 1/207 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ V + +    G   ++ ++F ++    IL +V+R Q   +R G   +K R+  A  
Sbjct: 1   MAKIQVVDQNNTKVGDFELAPEVFEVEIMPEILNQVVRAQRASQRQGTHATKNRALKAGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S +   +RGG  AFGP P      + KKVR LAL+ ALS +   
Sbjct: 61  GRKPWRQKGTGRARAGSSNSPLWRGGAAAFGPQPRDYTFKVNKKVRKLALKMALSSRVSE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             + V+ ++   E KTK      + L L+  LI+     D    ++ARN+P+I ++    
Sbjct: 121 AKMTVVSSIDLPEIKTKAFAEVAKNLGLNKTLIV-AKDADPKLTMSARNMPHIKVIEADK 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRFK 207
           +NVYD+L   +LV+ +SA + +++R K
Sbjct: 180 LNVYDVLLYPELVMLESAAQDVQERLK 206


>gi|115376101|ref|ZP_01463346.1| ribosomal protein L4/L1 family [Stigmatella aurantiaca DW4/3-1]
 gi|310820995|ref|YP_003953353.1| 50S ribosomal protein L4 [Stigmatella aurantiaca DW4/3-1]
 gi|115366916|gb|EAU65906.1| ribosomal protein L4/L1 family [Stigmatella aurantiaca DW4/3-1]
 gi|309394067|gb|ADO71526.1| 50S ribosomal protein L4 [Stigmatella aurantiaca DW4/3-1]
          Length = 207

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 71/205 (34%), Positives = 109/205 (53%), Gaps = 2/205 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +  V +LDG+    I +S+++F  +P   +   V + Q   KR G    K  S V+  
Sbjct: 1   MAKFKVIDLDGKQVSEIELSDEVFGAEPNPHLFYEVAKMQQINKRRGTVGVKNTSLVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S   S + GGGKA  P      +  P+KVR  ALR ALS +   
Sbjct: 61  GKKPWKQKGTGRARQGSIRASHWVGGGKAMAPKARDYFYRPPRKVRRGALRAALSQRARE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRF-RALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
           N + ++D       KTK       R L L NAL++D  + + +   + RN+   ++LP +
Sbjct: 121 NALFILDGFKLDAPKTKQAFDVLTRRLKLENALVVDD-KGNNHLHRSVRNLARFDVLPPE 179

Query: 180 GINVYDILRCSKLVLSKSAIEALED 204
           GIN+  +LR  +LVL+ +A +A+++
Sbjct: 180 GINLESVLRHKQLVLTSAAAKAIQE 204


>gi|168187813|ref|ZP_02622448.1| ribosomal protein L4/L1 family [Clostridium botulinum C str.
           Eklund]
 gi|169294356|gb|EDS76489.1| ribosomal protein L4/L1 family [Clostridium botulinum C str.
           Eklund]
          Length = 206

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 65/206 (31%), Positives = 114/206 (55%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + + N +G+  G + +++ +FA++  + +L +V+  Q   KR G   +K R+EV+  
Sbjct: 1   MPTVDLYNREGQKVGDLQLADTVFAVEVNEDVLHQVVVAQLANKRQGNQSAKTRAEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+  GG  F P P     ++PK +R +A++ AL+ K   
Sbjct: 61  GKKPWRQKGTGRARQGSIRAPQWIHGGVVFAPKPRDYKMSIPKSMRRVAMKSALTSKVNE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            +++V+++L     KTK +V    A +    LI+   + +     + RNI    ++PV  
Sbjct: 121 KELVVLESLELDAPKTKEMVKMINAFESKKPLIV-VPESNEVIYKSVRNIEGATVVPVNN 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYDIL+  K +++K A+  +E+ +
Sbjct: 180 INVYDILKHDKFIITKEAVSKIEEVY 205


>gi|62857671|ref|NP_001017222.1| mitochondrial ribosomal protein L4 [Xenopus (Silurana) tropicalis]
 gi|89268693|emb|CAJ82705.1| mitochondrial ribosomal protein L4 [Xenopus (Silurana) tropicalis]
          Length = 298

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 71/205 (34%), Positives = 113/205 (55%), Gaps = 3/205 (1%)

Query: 5   SVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKM 64
           S+R+ D +  G++ +  D+F + P+  IL +V+ WQ   KRI  +K K R+EV   G K 
Sbjct: 73  SLRHPDDQPLGLVHLHPDVFTVPPRIDILHQVVTWQRNFKRISHAKVKTRAEVRGGGKKP 132

Query: 65  YVQKGTGRARHSSKSVSQFRGGGKAFGPV-PIIGVHALPKKVRSLALRHALSDKFCSNDI 123
             QKG+GRAR  S     +RGGG A GP  P    + +P K+R   L+ AL+ K   +D+
Sbjct: 133 RQQKGSGRARQGSIRSPLWRGGGVAHGPRGPTSYYYMMPMKMRVQGLKIALTAKLAQDDL 192

Query: 124 MVIDNLVSKECKTKYLVTRFRALDLSNA-LIIDGCQ-LDRNFQLAARNIPNINLLPVQGI 181
            VID+L       +YLV   +      + LI+D  + L  N   A  N+  IN++P  G+
Sbjct: 193 HVIDSLEISTPDPQYLVDLIKHRQWGESVLIVDVNENLPENLFNATVNLKKINVIPAIGL 252

Query: 182 NVYDILRCSKLVLSKSAIEALEDRF 206
           +V+ +L+   +VL+  A++ LE++ 
Sbjct: 253 SVFGMLKHDTVVLTVGAVDFLEEKL 277


>gi|312866536|ref|ZP_07726753.1| 50S ribosomal protein L4 [Streptococcus downei F0415]
 gi|311097967|gb|EFQ56194.1| 50S ribosomal protein L4 [Streptococcus downei F0415]
          Length = 207

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 63/204 (30%), Positives = 108/204 (52%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + + +  G++   + +++ +F ++P + ++  V+  Q    R G    K RS V+  
Sbjct: 1   MANVKLFDQTGKEVSTVELNDAVFGIEPNESVVFDVVISQRASLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    +  P+KVR LAL+  LS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYAYKFPQKVRRLALKSVLSAKVAE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             ++ +D L     KT       +AL + + +++   + +    L+ARN+PN+ +   + 
Sbjct: 121 EKLVAVDALSFAAPKTAEFAKVLKALSIDSKVLVVLEEGNEVAALSARNLPNVAVATAKT 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
            +V DI+   KL+++K AI  +E+
Sbjct: 181 ASVLDIMNADKLLVTKEAISTIEE 204


>gi|298531084|ref|ZP_07018485.1| ribosomal protein L4/L1e [Desulfonatronospira thiodismutans ASO3-1]
 gi|298509107|gb|EFI33012.1| ribosomal protein L4/L1e [Desulfonatronospira thiodismutans ASO3-1]
          Length = 206

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 67/206 (32%), Positives = 111/206 (53%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M+   V + D ++ G I + E++F++  +  ++ + +R      R G    K R+ ++  
Sbjct: 1   MLSAKVYSQDNQEVGEIDLQENVFSVSVKPELMHQAVRAHRAAVRSGTVGVKNRALISGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  +     +RGG    GP        L KKVR LAL+ ALS K+  
Sbjct: 61  GRKPWRQKGTGRARAGTGRSPLWRGGAVIHGPKARDYSIKLNKKVRRLALKMALSTKYAQ 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           + + ++DNL     +TK  V+    L L   LI+   +   N +L+ARN+P + ++    
Sbjct: 121 DKLQILDNLDLSRIRTKDFVSIKNNLGLKKPLIVT-AEKSNNLELSARNVPGVEVITQDS 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVY++L+  +LV+ K A+E L++R 
Sbjct: 180 INVYEVLKHQELVMDKQAVEKLQERL 205


>gi|146317732|ref|YP_001197444.1| 50S ribosomal protein L4 [Streptococcus suis 05ZYH33]
 gi|146319922|ref|YP_001199633.1| 50S ribosomal protein L4 [Streptococcus suis 98HAH33]
 gi|253750988|ref|YP_003024129.1| 50S ribosomal protein L4 [Streptococcus suis SC84]
 gi|253752888|ref|YP_003026028.1| 50S ribosomal protein L4 [Streptococcus suis P1/7]
 gi|253754713|ref|YP_003027853.1| 50S ribosomal protein L4 [Streptococcus suis BM407]
 gi|330831921|ref|YP_004400746.1| 50S ribosomal protein L4 [Streptococcus suis ST3]
 gi|166199915|sp|A4VYP4|RL4_STRS2 RecName: Full=50S ribosomal protein L4
 gi|166199917|sp|A4VSF5|RL4_STRSY RecName: Full=50S ribosomal protein L4
 gi|145688538|gb|ABP89044.1| Ribosomal protein L4 [Streptococcus suis 05ZYH33]
 gi|145690728|gb|ABP91233.1| Ribosomal protein L4 [Streptococcus suis 98HAH33]
 gi|251815277|emb|CAZ50843.1| 50S ribosomal protein L4 [Streptococcus suis SC84]
 gi|251817177|emb|CAZ54899.1| 50S ribosomal protein L4 [Streptococcus suis BM407]
 gi|251819133|emb|CAR44224.1| 50S ribosomal protein L4 [Streptococcus suis P1/7]
 gi|292557532|gb|ADE30533.1| ribosomal protein L4 [Streptococcus suis GZ1]
 gi|329306144|gb|AEB80560.1| 50S ribosomal protein L4 [Streptococcus suis ST3]
          Length = 207

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 65/204 (31%), Positives = 108/204 (52%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +++ +  G+  G + +++ IF ++P Q ++  V+  Q    R G    K RS V+  
Sbjct: 1   MANVTLFDQTGKQAGEVVLNDAIFGIEPNQAVVFDVIISQRASLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LP+KVR LAL+   S+K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYAYKLPQKVRRLALKSVYSEKVAE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N  + +++L     KT        AL + + +++   + +    L+ARNIP + +     
Sbjct: 121 NKFVAVNSLEFTAPKTAEFAKVLAALSIDSKVLVILEEGNEFAALSARNIPGVKVATATT 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
            +V DI    KL+++++AI  +E+
Sbjct: 181 ASVLDIANADKLLVTQAAISKIEE 204


>gi|148983608|ref|ZP_01816927.1| 50S ribosomal protein L4 [Streptococcus pneumoniae SP3-BS71]
 gi|194397434|ref|YP_002036911.1| 50S ribosomal protein L4 [Streptococcus pneumoniae G54]
 gi|221231114|ref|YP_002510266.1| 50S ribosomal protein L4 [Streptococcus pneumoniae ATCC 700669]
 gi|270292001|ref|ZP_06198216.1| ribosomal protein L4 [Streptococcus sp. M143]
 gi|306828784|ref|ZP_07461976.1| ribosomal protein L4/L1 family protein [Streptococcus mitis ATCC
           6249]
 gi|315612333|ref|ZP_07887246.1| ribosomal protein L4/L1 family protein [Streptococcus sanguinis
           ATCC 49296]
 gi|322375038|ref|ZP_08049552.1| ribosomal protein L4/L1 family protein [Streptococcus sp. C300]
 gi|322377229|ref|ZP_08051721.1| ribosomal protein L4/L1 family protein [Streptococcus sp. M334]
 gi|331267135|ref|YP_004326765.1| 50S ribosomal protein L4 [Streptococcus oralis Uo5]
 gi|226730730|sp|B5E6F6|RL4_STRP4 RecName: Full=50S ribosomal protein L4
 gi|254803756|sp|B8ZKF8|RL4_STRPJ RecName: Full=50S ribosomal protein L4
 gi|74267363|dbj|BAE44179.1| ribosomal protein L4 [Streptococcus pneumoniae]
 gi|147923755|gb|EDK74867.1| 50S ribosomal protein L4 [Streptococcus pneumoniae SP3-BS71]
 gi|194357101|gb|ACF55549.1| 50S ribosomal protein L4 [Streptococcus pneumoniae G54]
 gi|220673574|emb|CAR68060.1| 50S ribosomal protein L4 [Streptococcus pneumoniae ATCC 700669]
 gi|270279529|gb|EFA25371.1| ribosomal protein L4 [Streptococcus sp. M143]
 gi|301799359|emb|CBW31894.1| 50S ribosomal protein L4 [Streptococcus pneumoniae OXC141]
 gi|304428962|gb|EFM32050.1| ribosomal protein L4/L1 family protein [Streptococcus mitis ATCC
           6249]
 gi|315315314|gb|EFU63353.1| ribosomal protein L4/L1 family protein [Streptococcus sanguinis
           ATCC 49296]
 gi|321280538|gb|EFX57577.1| ribosomal protein L4/L1 family protein [Streptococcus sp. C300]
 gi|321281942|gb|EFX58950.1| ribosomal protein L4/L1 family protein [Streptococcus sp. M334]
 gi|326683807|emb|CBZ01425.1| 50S ribosomal protein L4 [Streptococcus oralis Uo5]
          Length = 207

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 109/204 (53%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +++ +  G++ G + +++ +F ++P + ++  V+  Q    R G    K RS V+  
Sbjct: 1   MANVTLFDQTGKEAGQVVLNDAVFGIEPNESVVFDVIISQRASLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LP+KVR LAL+   S+K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYGYKLPQKVRRLALKSVYSEKVAE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N  + +D L     KT        AL + + +++   + +    L+ARN+PN+ +     
Sbjct: 121 NKFVAVDALSFTAPKTAEFAKVLAALSIDSKVLVILEEGNEFAALSARNLPNVKVATATT 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
            +V DI    KL+++++AI  +E+
Sbjct: 181 ASVLDIANSDKLLVTQAAISKIEE 204


>gi|326799128|ref|YP_004316947.1| ribosomal protein L4/L1e [Sphingobacterium sp. 21]
 gi|326549892|gb|ADZ78277.1| ribosomal protein L4/L1e [Sphingobacterium sp. 21]
          Length = 209

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 69/209 (33%), Positives = 114/209 (54%), Gaps = 6/209 (2%)

Query: 2   IELSVRNLDGEDKGV-ISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           +E+ V N+ G++ G  + + E +F + P    +   ++     +R G  KSK R+E+A +
Sbjct: 1   MEVQVLNISGKETGAKVQLPEAVFGVTPNDHAIYLDVKQYLANQRQGTHKSKQRNEIAGS 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
             K++ QKGTG AR  S     F GGG+ FGP P      L KK+++LA + ALS K   
Sbjct: 61  TRKLHKQKGTGGARAGSIKSPLFNGGGRIFGPQPRDYSFKLNKKLKALARKSALSYKAQE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNA---LIIDGCQLDRNFQLAARNIPNINLLP 177
           N+I+V+D +     KTK  V     L+++N    L++    L++N  L++RN+    ++ 
Sbjct: 121 NNIVVLDEVNFDSIKTKNYVKLVNDLNVANEKTLLVLPA--LNKNVYLSSRNLKKTKVIT 178

Query: 178 VQGINVYDILRCSKLVLSKSAIEALEDRF 206
              IN YD+L   KL+L+   ++ LE+ F
Sbjct: 179 AADINTYDVLNAGKLLLTTETVKTLEEAF 207


>gi|85858147|ref|YP_460349.1| 50S ribosomal protein L4 [Syntrophus aciditrophicus SB]
 gi|109893644|sp|Q2LQA0|RL4_SYNAS RecName: Full=50S ribosomal protein L4
 gi|85721238|gb|ABC76181.1| LSU ribosomal protein L4 [Syntrophus aciditrophicus SB]
          Length = 217

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 66/191 (34%), Positives = 104/191 (54%), Gaps = 1/191 (0%)

Query: 17  ISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGTGRARHS 76
           I +++ +F  +    ++  V+R Q   +R G + +KGRS+V+  G K + QKGTGRAR  
Sbjct: 27  IELNDAVFGAEVNDAVIYDVVRMQMASRRFGTAATKGRSDVSGGGKKPWRQKGTGRARSG 86

Query: 77  SKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNLVSKECKT 136
           +     +RGGG  FGPVP    + +PKKVR  ALR  LS K+    ++V+ +    E KT
Sbjct: 87  TSRSPIWRGGGIVFGPVPRDYKYNVPKKVRKNALRSVLSLKYQGQKLVVLKDFPLDEIKT 146

Query: 137 KYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRCSKLVLSK 196
           K          L  AL +   + +   + ++RNI  I ++  +G+NVYD+L    LV+ +
Sbjct: 147 KKFKEVVDRFGLKKALFVT-EERNEFLEKSSRNIAGIKMVRSEGLNVYDVLNHEHLVIIE 205

Query: 197 SAIEALEDRFK 207
            A++ LE   K
Sbjct: 206 PAVKKLEGALK 216


>gi|237739367|ref|ZP_04569848.1| LSU ribosomal protein L1E [Fusobacterium sp. 2_1_31]
 gi|229422975|gb|EEO38022.1| LSU ribosomal protein L1E [Fusobacterium sp. 2_1_31]
          Length = 209

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 71/206 (34%), Positives = 107/206 (51%), Gaps = 2/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  L+V NL+G     + V + +F ++P + +L  VL  +    R G + +K R+ V   
Sbjct: 1   MAVLNVYNLEGNQIDTLEVKDTVFGIEPNKVVLHEVLTAELAAARQGTASTKTRAMVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S       GGG  FGP P      + KKVR+LALR ALS K  +
Sbjct: 61  GRKPFKQKGTGRARQGSIRAPHMVGGGVTFGPHPRSYEKKVNKKVRNLALRSALSAKVAA 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNA--LIIDGCQLDRNFQLAARNIPNINLLPV 178
            +++V+D       KTK +V     +D       ++     D N  L+ARN+ N  +L  
Sbjct: 121 GNVLVLDYEGIDTPKTKVIVNLVNKVDAKQKQLFVVGDLIKDYNLYLSARNLENAVILQP 180

Query: 179 QGINVYDILRCSKLVLSKSAIEALED 204
             I VY +L+  K++L+K A+  +E+
Sbjct: 181 NEIGVYWLLKQEKVILTKEALAVVEE 206


>gi|162449113|ref|YP_001611480.1| hypothetical protein sce0843 [Sorangium cellulosum 'So ce 56']
 gi|161159695|emb|CAN91000.1| rplD [Sorangium cellulosum 'So ce 56']
          Length = 207

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 71/205 (34%), Positives = 112/205 (54%), Gaps = 2/205 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++++V NL  E  G + +S+++F  + ++ +   V++ Q   +R G   +K RS VA + 
Sbjct: 1   MKVTVYNLKREQVGELDLSDEVFGTEVKEHLFYEVVKAQLASRRSGTKATKERSAVAGST 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K+Y QKGTGRAR  S       GGG A    P    +  P+KVR  AL+ ALS      
Sbjct: 61  KKLYRQKGTGRARQGSIRAPHHAGGGMAHALEPKDWSYRPPRKVRIGALKSALSLFAKEG 120

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLS-NALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            ++V+D+L   E KTK +      L     +L++D    D+  + + RN+ N   LP +G
Sbjct: 121 RLIVLDSLEVSEIKTKAIAATLTTLQADRKSLVVDTAGNDKLVK-SLRNLENHQYLPPEG 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDR 205
           +NVYD+LR   L++S+ A +ALE R
Sbjct: 180 VNVYDLLRHDHLIVSRDAAKALEAR 204


>gi|327458432|gb|EGF04788.1| 50S ribosomal protein L4 [Streptococcus sanguinis SK1]
          Length = 207

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 63/204 (30%), Positives = 108/204 (52%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + + +  G++ G + +++ +F ++P + ++  V+  Q    R G    K RS V+  
Sbjct: 1   MANVKLFDQTGKEAGEVVLNDAVFGIEPNESVVFDVIISQRASLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LP+KVR LAL+   S+K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGIVFGPTPRSYAYKLPRKVRRLALKSVYSEKVAE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N  + +D+L     KT        AL +   +++   + +    L+ARN+PN+ +     
Sbjct: 121 NKFVAVDSLSFTAPKTAEFAKVLAALSIDTKVLVILEEGNEFAALSARNLPNVKVATATT 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
            +V DI+   KL+++++ I  +E+
Sbjct: 181 ASVLDIVNSDKLLVTQAVISKIEE 204


>gi|15674080|ref|NP_268255.1| 50S ribosomal protein L4 [Lactococcus lactis subsp. lactis Il1403]
 gi|281492758|ref|YP_003354738.1| 50S ribosomal protein L1E (= L4P) [Lactococcus lactis subsp. lactis
           KF147]
 gi|46577289|sp|Q9CDW3|RL4_LACLA RecName: Full=50S ribosomal protein L4
 gi|12725152|gb|AAK06196.1|AE006438_10 50S ribosomal protein L4 [Lactococcus lactis subsp. lactis Il1403]
 gi|281376410|gb|ADA65896.1| LSU ribosomal protein L1E (= L4P) [Lactococcus lactis subsp. lactis
           KF147]
 gi|326407631|gb|ADZ64702.1| 50S ribosomal protein L4 [Lactococcus lactis subsp. lactis CV56]
          Length = 208

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 65/205 (31%), Positives = 106/205 (51%), Gaps = 1/205 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++S+   DG   G +++++ +F ++P + ++  V+  Q    R G    K RS V+  
Sbjct: 1   MAKVSLFKQDGSQAGEVTLNDSVFGIEPNESVVFDVVISQRASLRQGTHAHKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LP+KVR LAL+   S K   
Sbjct: 61  GKKPWRQKGTGRARQGSTRSPQWRGGGTVFGPNPRSYAYKLPQKVRQLALKSVYSTKVAD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNF-QLAARNIPNINLLPVQ 179
             ++ +D L     KT        AL +   +++        F +L+ARN+ N+ +    
Sbjct: 121 GKLIAVDTLDFTAPKTAEFAKVISALSIERKVLVVLPNEGNEFAELSARNLANVKVTTAN 180

Query: 180 GINVYDILRCSKLVLSKSAIEALED 204
             +V DI+   KL++ +SA+  +E+
Sbjct: 181 SASVLDIVSADKLLVVQSALTQIEE 205


>gi|322418365|ref|YP_004197588.1| 50S ribosomal protein L4/L1e [Geobacter sp. M18]
 gi|320124752|gb|ADW12312.1| ribosomal protein L4/L1e [Geobacter sp. M18]
          Length = 207

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 66/203 (32%), Positives = 109/203 (53%), Gaps = 1/203 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +L V ++     G I VS+ +F    ++ ++   ++ Q   +R G    K RS VA +
Sbjct: 1   MAKLDVFDIKNAKVGEIEVSDAVFNDDVREYLIHEAVKIQLANRRQGTVAVKNRSAVAGS 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG+AR       Q+ GGG AFGP P     ++ KK R  ALR ALS  +  
Sbjct: 61  GKKPFKQKGTGQARQGCSRAPQYPGGGVAFGPQPKTYNLSMNKKARKAALRSALSMLYKK 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           + I V++N      KTK  V    A +L   L+I     +   +L+ARN+ ++ +L  +G
Sbjct: 121 DAITVLNNFELPAVKTKGFVEVLNAFNLDKTLVITDTA-NPTLELSARNVKHVKVLGPEG 179

Query: 181 INVYDILRCSKLVLSKSAIEALE 203
           +N++DI++   +V +++A+  +E
Sbjct: 180 LNIFDIMKYQSVVFTEAAVRRVE 202


>gi|317501775|ref|ZP_07959961.1| ribosomal protein L4/L1 family protein [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|331088704|ref|ZP_08337614.1| 50S ribosomal protein L4 [Lachnospiraceae bacterium 3_1_46FAA]
 gi|316896808|gb|EFV18893.1| ribosomal protein L4/L1 family protein [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|330407227|gb|EGG86730.1| 50S ribosomal protein L4 [Lachnospiraceae bacterium 3_1_46FAA]
          Length = 206

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 68/208 (32%), Positives = 115/208 (55%), Gaps = 5/208 (2%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++SV N++G++   I +++ +F ++  + ++   +  Q    R G  K+K RSEV+  
Sbjct: 1   MAKVSVYNIEGKEVDTIELNDAVFGVEVNEHLVHMAVVNQLANNRQGTQKAKTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+ GGG  F PVP      + KK +  AL+ ALS +   
Sbjct: 61  GRKPWRQKGTGHARQGSTRAPQWTGGGVVFAPVPRDYSFKMNKKEKRAALKSALSSRVEE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALII--DGCQLDRNFQLAARNIPNINLLPV 178
           N  +V+D +   E KTK        L+++ AL++  DG   + N +++ARNI  +     
Sbjct: 121 NKFIVVDEMNFDEIKTKKFQNVLNNLNVNKALVVLEDG---NINAEISARNIAGVKTART 177

Query: 179 QGINVYDILRCSKLVLSKSAIEALEDRF 206
             INVYDIL+ + ++ +K+A+  +E+ +
Sbjct: 178 NTINVYDILKYNTVIATKAAVATIEEVY 205


>gi|116513053|ref|YP_811960.1| 50S ribosomal protein L4 [Lactococcus lactis subsp. cremoris SK11]
 gi|123125252|sp|Q02W25|RL4_LACLS RecName: Full=50S ribosomal protein L4
 gi|116108707|gb|ABJ73847.1| LSU ribosomal protein L4P [Lactococcus lactis subsp. cremoris SK11]
          Length = 208

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 65/205 (31%), Positives = 106/205 (51%), Gaps = 1/205 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++S+   DG   G +++++ +F ++P + ++  V+  Q    R G    K RS V+  
Sbjct: 1   MAKVSLFKQDGSQAGEVTLNDSVFGIEPNESVVFDVVISQRASLRQGTHAHKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LP+KVR LAL+   S K   
Sbjct: 61  GKKPWRQKGTGRARQGSTRSPQWRGGGTVFGPNPRSYAYKLPQKVRQLALKSVYSTKVAD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNF-QLAARNIPNINLLPVQ 179
             ++ +D L     KT        AL +   +++        F +L+ARN+ N+ +    
Sbjct: 121 GKLIAVDTLDFAAPKTAEFAKVISALSIERKVLVVLPNEGNEFAELSARNLENVKVTTAN 180

Query: 180 GINVYDILRCSKLVLSKSAIEALED 204
             +V DI+   KL++ +SA+  +E+
Sbjct: 181 SASVLDIVSADKLLVVQSALTQIEE 205


>gi|300857245|ref|YP_003782229.1| 50S ribosomal protein L4 [Clostridium ljungdahlii DSM 13528]
 gi|300437360|gb|ADK17127.1| 50S ribosomal protein L4 [Clostridium ljungdahlii DSM 13528]
          Length = 206

 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 65/206 (31%), Positives = 117/206 (56%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ + N +G+      +S+ +F ++  +  + +V+      KR G   +K R+EV+  
Sbjct: 1   MPKVGLFNKEGQKVEDFELSDKVFGVEVNENAVHQVVVALLANKRQGTQSAKTRAEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+  GG  F   P     +L K V+ +A++ ALS K   
Sbjct: 61  GIKPWRQKGTGRARQGSIRAPQWIHGGIVFAVKPRDYRISLTKSVKRVAMKSALSSKVAD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N+++V++NL  +  KTK +V    A +   ALI+   + ++N  ++ RNI  ++++PV  
Sbjct: 121 NEMVVLENLELETPKTKEIVKMLDAFNAKKALIVT-AESNKNVYVSGRNIQGVSVIPVNN 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVYD+L+  KL+++K A+  +E+ +
Sbjct: 180 LNVYDLLKYEKLIITKDAVSKIEEVY 205


>gi|125625142|ref|YP_001033625.1| 50S ribosomal protein L4 [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|166234678|sp|A2RNQ4|RL4_LACLM RecName: Full=50S ribosomal protein L4
 gi|124493950|emb|CAL98945.1| 50S ribosomal protein L4 (BL4) [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|300071950|gb|ADJ61350.1| 50S ribosomal protein L4 [Lactococcus lactis subsp. cremoris
           NZ9000]
          Length = 208

 Score =  112 bits (279), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 65/205 (31%), Positives = 106/205 (51%), Gaps = 1/205 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++S+   DG   G +++++ +F ++P + ++  V+  Q    R G    K RS V+  
Sbjct: 1   MAKVSLFKQDGSQAGEVTLNDSVFGIEPNESVVFDVVISQRASLRQGTHAHKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LP+KVR LAL+   S K   
Sbjct: 61  GKKPWRQKGTGRARQGSTRSPQWRGGGTVFGPNPRSYAYKLPQKVRQLALKSVYSTKVTD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNF-QLAARNIPNINLLPVQ 179
             ++ +D L     KT        AL +   +++        F +L+ARN+ N+ +    
Sbjct: 121 GKLIAVDTLDFAAPKTAEFAKVISALSIERKVLVVLPNEGNEFAELSARNLENVKVTTAN 180

Query: 180 GINVYDILRCSKLVLSKSAIEALED 204
             +V DI+   KL++ +SA+  +E+
Sbjct: 181 SASVLDIVSADKLLVVQSALTQIEE 205


>gi|189485086|ref|YP_001956027.1| 50S ribosomal protein L4 [uncultured Termite group 1 bacterium
           phylotype Rs-D17]
 gi|170287045|dbj|BAG13566.1| 50S ribosomal protein L4 [uncultured Termite group 1 bacterium
           phylotype Rs-D17]
          Length = 206

 Score =  111 bits (278), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 111/204 (54%), Gaps = 1/204 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +E +V +  GE+KG I +  D F  K    +L  V        R G  K+K R EV+++G
Sbjct: 1   METTVYDAKGEEKGKIELP-DFFGKKVSVALLHEVTMAYLNNLRAGTHKTKTRGEVSFSG 59

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
           +K + QKGTG AR   K+   +R GG  FGP P      + K+ + L+L  A S +  + 
Sbjct: 60  AKPWKQKGTGNARAGQKNSPLWRKGGIIFGPQPRNYYTKISKRKKKLSLDMAFSAQLKNG 119

Query: 122 DIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGI 181
           +I+V+D++   E KTK +    + L +    I+     D +F++AARNI N+ +  ++ I
Sbjct: 120 NIIVVDSVKVSEVKTKKVAELIKNLKVGGKKIVFAIPSDTDFKVAARNIKNVIVENIKNI 179

Query: 182 NVYDILRCSKLVLSKSAIEALEDR 205
           N Y +L   KLV++  A++ +++R
Sbjct: 180 NAYQVLWADKLVITPEAVDLIKER 203


>gi|262277095|ref|ZP_06054888.1| ribosomal protein, L4/L1 family [alpha proteobacterium HIMB114]
 gi|262224198|gb|EEY74657.1| ribosomal protein, L4/L1 family [alpha proteobacterium HIMB114]
          Length = 209

 Score =  111 bits (278), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 110/202 (54%), Gaps = 6/202 (2%)

Query: 9   LDGEDKGVISVSEDIFALKPQQGILARVLRWQSWR--KRIGCSKSKGRSEVAYTGSKMYV 66
           +DG++ G +  S+ +F +KP++ I+ +V+ WQ  R  K+ G +KS+G  EV  +  K+  
Sbjct: 8   IDGKNVGSLEASDKVFKVKPRKDIIQQVIDWQQNRMFKKTGHTKSRG--EVKGSRKKIVQ 65

Query: 67  QKGTGRARHSSKSVSQFRGGGKAFGPVP--IIGVHALPKKVRSLALRHALSDKFCSNDIM 124
           QKG+G ARH + +   F GGG A GP       V  L KKVR L L HALS K  S+ I 
Sbjct: 66  QKGSGGARHGNITAPVFVGGGIAHGPRHRGNYAVKKLNKKVRKLGLVHALSVKAKSDQIA 125

Query: 125 VIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVY 184
           + +       KTK      + +   +AL I      + F  + +NIPN   L   G NVY
Sbjct: 126 IFNEPKISGLKTKNFKDFLKNIKSKSALFIHHKDAPKEFVRSIKNIPNSKKLEDVGTNVY 185

Query: 185 DILRCSKLVLSKSAIEALEDRF 206
           D+++  K++ +K + +A+E+R 
Sbjct: 186 DLIKYEKVLFTKESFKAIEERL 207


>gi|256830537|ref|YP_003159265.1| ribosomal protein L4/L1e [Desulfomicrobium baculatum DSM 4028]
 gi|256579713|gb|ACU90849.1| ribosomal protein L4/L1e [Desulfomicrobium baculatum DSM 4028]
          Length = 206

 Score =  111 bits (278), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 113/207 (54%), Gaps = 1/207 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M    V + + ++ G IS+++DIF ++ +  +L   ++    + R G    K R  V   
Sbjct: 1   MANAKVYDQNRKEVGEISLADDIFQVEVRPEVLHLAVKSHLAKLRSGTVGVKTRGLVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     +R G    GP        + K++R LAL+ A+S +F S
Sbjct: 61  GKKPWRQKGTGRARAGSSRSPLWRSGAVIHGPQARDYSFKINKQIRKLALKMAISSRFTS 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            +++V++ L   E KTK  V     L L  ALI+   + D N  L+ARN+P I +L  Q 
Sbjct: 121 ENMLVVNKLQFDEIKTKNFVACKDTLGLKKALIVV-AEKDTNLALSARNVPGILVLDPQS 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRFK 207
           INVY+IL+  ++VL + A+ AL++R K
Sbjct: 180 INVYEILKYPQMVLDQGAVLALQERLK 206


>gi|238928154|ref|ZP_04659914.1| ribosomal protein L4 [Selenomonas flueggei ATCC 43531]
 gi|238884114|gb|EEQ47752.1| ribosomal protein L4 [Selenomonas flueggei ATCC 43531]
          Length = 207

 Score =  111 bits (278), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 70/206 (33%), Positives = 105/206 (50%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  ++V ++     G IS+S++ F ++   G+L + +  Q   +R+G   +K R  V   
Sbjct: 1   MANVAVYDMSHNQVGEISLSDEFFNVEMNAGLLHQAVVLQLASQRLGTHATKTRGLVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     + GGG  FGP P      +P+K R LAL+ ALSDK  +
Sbjct: 61  GRKPWRQKGTGRARAGSTRSPLWVGGGTVFGPHPRKYGFTMPRKQRRLALKCALSDKVRT 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            D +V+D L     KTK  V       ++   +        N + +  NIP +  +   G
Sbjct: 121 GDFIVLDQLDFGAPKTKAAVKLLSDFGVNAKSLFITADEAVNVERSTSNIPGVKAITASG 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INV+DIL   KL ++K AI  +E+ F
Sbjct: 181 INVFDILHHDKLFITKDAITRIEEVF 206


>gi|22536244|ref|NP_687095.1| 50S ribosomal protein L4 [Streptococcus agalactiae 2603V/R]
 gi|25010134|ref|NP_734529.1| 50S ribosomal protein L4 [Streptococcus agalactiae NEM316]
 gi|76787912|ref|YP_328785.1| 50S ribosomal protein L4 [Streptococcus agalactiae A909]
 gi|76798215|ref|ZP_00780465.1| ribosomal protein L4/L1 family [Streptococcus agalactiae 18RS21]
 gi|77406989|ref|ZP_00784004.1| ribosomal protein L4/L1 family [Streptococcus agalactiae H36B]
 gi|77412287|ref|ZP_00788603.1| ribosomal protein L4/L1 family [Streptococcus agalactiae CJB111]
 gi|77414565|ref|ZP_00790708.1| ribosomal protein L4/L1 family [Streptococcus agalactiae 515]
 gi|46577261|sp|Q8E2D0|RL4_STRA5 RecName: Full=50S ribosomal protein L4
 gi|46577263|sp|Q8E7T7|RL4_STRA3 RecName: Full=50S ribosomal protein L4
 gi|109893642|sp|Q3K3W8|RL4_STRA1 RecName: Full=50S ribosomal protein L4
 gi|22533064|gb|AAM98967.1|AE014194_12 ribosomal protein L4 [Streptococcus agalactiae 2603V/R]
 gi|23094485|emb|CAD45704.1| ribosomal protein L4 [Streptococcus agalactiae NEM316]
 gi|76562969|gb|ABA45553.1| ribosomal protein L4 [Streptococcus agalactiae A909]
 gi|76586424|gb|EAO62932.1| ribosomal protein L4/L1 family [Streptococcus agalactiae 18RS21]
 gi|77159363|gb|EAO70531.1| ribosomal protein L4/L1 family [Streptococcus agalactiae 515]
 gi|77161677|gb|EAO72672.1| ribosomal protein L4/L1 family [Streptococcus agalactiae CJB111]
 gi|77174394|gb|EAO77248.1| ribosomal protein L4/L1 family [Streptococcus agalactiae H36B]
 gi|319743994|gb|EFV96374.1| 50S ribosomal protein L4 [Streptococcus agalactiae ATCC 13813]
          Length = 207

 Score =  111 bits (278), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 107/203 (52%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + + +  G++   + ++E IF ++P + ++  V+  Q    R G    K RS V+  
Sbjct: 1   MANVKLFDQTGKEVSSVELNEAIFGIEPNESVVFDVVISQRASLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LP+KVR LAL+   S K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYGYKLPQKVRRLALKSVYSAKVAE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           +  + ++NL     KT    +   AL + + +++   + +    L+ARN+PN+ +     
Sbjct: 121 DKFVAVENLSFAAPKTAEFASVLSALSIDSKVLVILEEGNEFAALSARNLPNVTVATATT 180

Query: 181 INVYDILRCSKLVLSKSAIEALE 203
            +V DI+   KL+++K AI  +E
Sbjct: 181 ASVLDIVNADKLLVTKEAISTIE 203


>gi|297623275|ref|YP_003704709.1| 50S ribosomal protein L4/L1e [Truepera radiovictrix DSM 17093]
 gi|297164455|gb|ADI14166.1| ribosomal protein L4/L1e [Truepera radiovictrix DSM 17093]
          Length = 216

 Score =  111 bits (278), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 65/169 (38%), Positives = 96/169 (56%), Gaps = 5/169 (2%)

Query: 27  KPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGTGRARHSSKSVSQFRGG 86
           +P+  +L  V+ WQ  ++R G + +K R  V+ T +KMY QKGTGRARH S     F GG
Sbjct: 20  EPKVSVLHEVVSWQLSKRRRGTAATKTRGTVSGTTAKMYPQKGTGRARHGSYKAPIFVGG 79

Query: 87  GKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNL-VSKECKTKYLVTRFRA 145
           G AFGP P    + LPK+VR L L+ AL+ +   N + +++   +    K      +   
Sbjct: 80  GIAFGPQPRSYEYTLPKRVRRLGLKMALAARAQDNKLTLVEAFGIGGRTKEFVAWAKDHG 139

Query: 146 LDLSN-ALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRCSKLV 193
            D S   L++   +L R    AARN+P +++LP +G+NVYDILR   +V
Sbjct: 140 FDGSERVLLVTDDELARR---AARNLPWVSVLPSRGLNVYDILRHDHVV 185


>gi|325280967|ref|YP_004253509.1| ribosomal protein L4/L1e [Odoribacter splanchnicus DSM 20712]
 gi|324312776|gb|ADY33329.1| ribosomal protein L4/L1e [Odoribacter splanchnicus DSM 20712]
          Length = 211

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 72/208 (34%), Positives = 120/208 (57%), Gaps = 3/208 (1%)

Query: 2   IELSVRNLDGEDKGVISVSED-IFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           +ELSV N+ G++ G   V +D IF ++P +  +   ++      R G  KSK R+E++ +
Sbjct: 1   MELSVLNIAGQETGRKIVLDDAIFGIQPNEHAIYLDVKQFLANNRQGTHKSKQRNEISGS 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
             K+  QKGTG AR  S    +FRGGG+ FGPVP      L KK++ LA + AL+ K  +
Sbjct: 61  TKKLKKQKGTGGARAGSIKNPEFRGGGRIFGPVPRDYSFKLNKKLKKLARKSALAVKASA 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNA--LIIDGCQLDRNFQLAARNIPNINLLPV 178
           N + V+++   +  KTK +V     L ++N   L++ G  ++ N  L+ARN+ N+ ++ V
Sbjct: 121 NAVKVVEDFTFEAPKTKQMVALMNNLQVNNGRLLLVLGNGVNENVLLSARNLQNVEVMRV 180

Query: 179 QGINVYDILRCSKLVLSKSAIEALEDRF 206
             I  Y++++   LVL +S++E L + F
Sbjct: 181 SDIATYNVMKAKNLVLVESSVEGLNEMF 208


>gi|242014210|ref|XP_002427784.1| mitochondrial 50S ribosomal protein L4, putative [Pediculus humanus
           corporis]
 gi|212512253|gb|EEB15046.1| mitochondrial 50S ribosomal protein L4, putative [Pediculus humanus
           corporis]
          Length = 286

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 68/210 (32%), Positives = 114/210 (54%), Gaps = 6/210 (2%)

Query: 3   ELSVRNLDG---EDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAY 59
           E+ V N+D    + +G++ ++  IF   P+  ++   ++WQS   R+    +K R+E+  
Sbjct: 65  EVWVENVDSIKEQKRGLVQLNPSIFGTIPRLDLIYYNIKWQSLYSRVILYSAKTRAEMKG 124

Query: 60  TGSKMYVQKGTGRARHSSKSVSQFRGGGKAFGP-VPIIGVHALPKKVRSLALRHALSDKF 118
           +G K + QKGTGRAR  S+   Q +GGG   GP  P      +P   +   L   LS K 
Sbjct: 125 SGRKPHPQKGTGRARLGSRRAPQVKGGGTCHGPRNPTSYYFRIPLYKKIHGLTSTLSAKL 184

Query: 119 CSNDIMVIDNLVSKECKTKYLVTRFRALDL-SNALIIDGCQ-LDRNFQLAARNIPNINLL 176
             ND+ V+DN+      ++Y++   +  +  S+ LI+D    + RN  +A  +I  I L+
Sbjct: 185 AQNDLHVVDNINIPTDDSQYMIDLMKERNWGSSVLIVDSDDIMPRNISIATDSIGYITLM 244

Query: 177 PVQGINVYDILRCSKLVLSKSAIEALEDRF 206
           PV G+NVY +L+   LVL+ SA++ LE++ 
Sbjct: 245 PVYGLNVYGMLKHDTLVLTLSALDELENKL 274


>gi|157108533|ref|XP_001650271.1| 50S ribosomal protein L4 [Aedes aegypti]
 gi|108884031|gb|EAT48256.1| 50S ribosomal protein L4 [Aedes aegypti]
          Length = 279

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 107/207 (51%), Gaps = 6/207 (2%)

Query: 6   VRNLDGEDK---GVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGS 62
           + NLD  ++   G+  +S ++F   P+  I+ + + WQ   + +  S SK R+EV   G 
Sbjct: 53  IENLDTIEEQKLGIQQLSSEVFGAAPRIDIVHQNIEWQRKYRFVSFSHSKTRNEVRGGGR 112

Query: 63  KMYVQKGTGRARHSSKSVSQFRGGGKAFGP-VPIIGVHALPKKVRSLALRHALSDKFCSN 121
           K + QKG GRARH S     +RGGG A GP  P    + LP   R L L   LS K   +
Sbjct: 113 KPWPQKGLGRARHGSIRSPLWRGGGIAHGPRSPTTHFYMLPFFSRVLGLVSTLSIKLAQD 172

Query: 122 DIMVIDNLVSKECKTKYL--VTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
           D+ ++ +L       +YL  + + RA   S   I     + RN    A  I +INL+PV 
Sbjct: 173 DLHIVRDLDIPTEDPQYLRDLVQERAWGPSVLFIDSSDIMPRNISAGADEIDHINLMPVY 232

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRF 206
           G+NVY +L+   LVL+KSA E +E + 
Sbjct: 233 GLNVYSMLKHDTLVLTKSAAEEIESKL 259


>gi|302336381|ref|YP_003801588.1| LSU ribosomal protein L4P [Olsenella uli DSM 7084]
 gi|301320221|gb|ADK68708.1| LSU ribosomal protein L4P [Olsenella uli DSM 7084]
          Length = 208

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 65/205 (31%), Positives = 109/205 (53%), Gaps = 1/205 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ V+N++G+  G + +S+ +F + P   ++ +V+       R G   +K RS V+  
Sbjct: 1   MSKIEVKNVEGKAAGEVELSDSVFGITPNIPVMHQVVVAYEASMRQGTHSTKNRSSVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G+K Y QKGTGRAR  +    Q+ GGG  FGP P      +  K + LA+R ALS K   
Sbjct: 61  GAKPYRQKGTGRARQGTIRAPQWVGGGVVFGPTPRSHAKRVNNKEKKLAMRSALSGKLAD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNA-LIIDGCQLDRNFQLAARNIPNINLLPVQ 179
           ++++++D L  KE KTK  V   +AL +    + I     D    LA RN+P ++++   
Sbjct: 121 SELILVDELYFKEPKTKLAVAALKALGIEGKRVTIVVADDDVITYLAFRNLPKVSIIAAS 180

Query: 180 GINVYDILRCSKLVLSKSAIEALED 204
             N  +++    LV+S +  + LE+
Sbjct: 181 EANTRNLVDNGALVMSTAVAKQLEE 205


>gi|260807182|ref|XP_002598388.1| hypothetical protein BRAFLDRAFT_128122 [Branchiostoma floridae]
 gi|229283660|gb|EEN54400.1| hypothetical protein BRAFLDRAFT_128122 [Branchiostoma floridae]
          Length = 264

 Score =  111 bits (277), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 66/202 (32%), Positives = 106/202 (52%), Gaps = 3/202 (1%)

Query: 8   NLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQ 67
           ++  E  G++ +  D+FA  P+  IL R +RWQ   ++I    ++ R+E+   G K + Q
Sbjct: 35  DIKDEKLGMVELHPDVFATHPRMDILHRCVRWQYLYRKINYDFARTRAEMRGGGRKPWPQ 94

Query: 68  KGTGRARHSSKSVSQFRGGGKAFGPV-PIIGVHALPKKVRSLALRHALSDKFCSNDIMVI 126
           KGTGRARH S     +  GGK  GP  P      LP K R+L L+ AL+ K    D+ ++
Sbjct: 95  KGTGRARHGSIRSPLWHMGGKCHGPRGPYSYYQYLPLKYRALGLKVALTVKHSQGDLHIV 154

Query: 127 DNLVSKECKTKYL--VTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVY 184
           D L       +YL  + R+R    S  L+     +  N   A+  +  IN++P+ G+NVY
Sbjct: 155 DRLEIPTTDPEYLEDLVRYRNWGKSVLLVDMNEDIAENVCEASAQLNTINVMPLVGLNVY 214

Query: 185 DILRCSKLVLSKSAIEALEDRF 206
            +L+   LVL+   ++ LE++ 
Sbjct: 215 SMLKHDTLVLTLPCVQKLENKL 236


>gi|154498884|ref|ZP_02037262.1| hypothetical protein BACCAP_02876 [Bacteroides capillosus ATCC
           29799]
 gi|150271724|gb|EDM98950.1| hypothetical protein BACCAP_02876 [Bacteroides capillosus ATCC
           29799]
          Length = 206

 Score =  111 bits (277), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 64/206 (31%), Positives = 113/206 (54%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M + +V ++ G+  G + +S+ IF ++P   ++   ++      R G   +  R+EV+  
Sbjct: 1   MPKATVVDMTGKKVGEVDLSDAIFGIEPNVSVVHEAVKNHLANCRQGTQSALTRAEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+  GG  F P P    + L KKV+ LAL+ ALS K   
Sbjct: 61  GIKPWRQKGTGRARQGSTRAPQWTHGGVVFAPKPRDYSYTLNKKVKRLALKSALSAKAAE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            +++V+D L     KTK +     A++   A+++   +++ N  L+ARNIP +     + 
Sbjct: 121 GNVIVVDGLNLDAVKTKNMAAFLGAVESKKAVLVTN-EVNENVVLSARNIPGVVTTTAKL 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           ++VYDI+  ++ ++ K+A+  +E+ F
Sbjct: 180 LSVYDIVNANQFIVDKAALAVIEEVF 205


>gi|309812335|ref|ZP_07706090.1| 50S ribosomal protein L4 [Dermacoccus sp. Ellin185]
 gi|308433640|gb|EFP57517.1| 50S ribosomal protein L4 [Dermacoccus sp. Ellin185]
          Length = 214

 Score =  111 bits (277), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 69/205 (33%), Positives = 108/205 (52%), Gaps = 5/205 (2%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + + + +G+  G + +  DIF +     ++ +V+  Q    R G  K+K R EV   
Sbjct: 1   MTTVDILSPEGKTSGSVELPADIFDVATNVPLIHQVVVAQLAAARQGTHKTKTRGEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K Y QKGTGRAR  S    QF GGG   GP P       PKK+++ ALR ALSD+   
Sbjct: 61  GRKPYRQKGTGRARQGSTRAPQFAGGGTVHGPQPRDYSQRTPKKMKAAALRGALSDRARF 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRAL--DLSNAL-IIDGCQLDRNFQLAARNIPNINLLP 177
             I V++++V+ E  +     +F     D  N L +ID  ++D   +L+ RN+PN+++L 
Sbjct: 121 ERIHVLESVVAGEAPSTKAAAKFLGTLSDRKNLLVVID--RMDSVSELSVRNLPNVHVLW 178

Query: 178 VQGINVYDILRCSKLVLSKSAIEAL 202
              +N YD+L    +  +K+A +A 
Sbjct: 179 SDQLNTYDVLCADDIAFTKAAFDAF 203


>gi|188995731|ref|YP_001929983.1| 50S ribosomal protein L4 [Porphyromonas gingivalis ATCC 33277]
 gi|226730705|sp|B2RLZ1|RL4_PORG3 RecName: Full=50S ribosomal protein L4
 gi|188595411|dbj|BAG34386.1| 50S ribosomal protein L4 [Porphyromonas gingivalis ATCC 33277]
          Length = 209

 Score =  111 bits (277), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 75/214 (35%), Positives = 118/214 (55%), Gaps = 14/214 (6%)

Query: 2   IELSVRNLDGEDKGVISVSED-IFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           +ELSV N+ GED G   V +D IFA++P    +   ++     +R G  K+K RSE++ +
Sbjct: 1   MELSVYNIKGEDTGKKVVLDDSIFAIEPNDHAIYLDVKQYMANQRQGTHKAKERSELSGS 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
             K+  QKG+G AR    +     GG + FGP P      L KK+++LA R ALS K  +
Sbjct: 61  TRKLIRQKGSGGARRGDINSPLLSGGARVFGPRPRNYTFKLNKKLKALARRSALSYKAKN 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDG-------CQLDRNFQLAARNIPNI 173
           N+I+V+++      KTK     F+A  +S AL +D         ++++N  L+ARN+PN 
Sbjct: 121 NEIIVVEDFNFDAPKTK----AFKA--ISAALKVDEKKVLYVLPEVNKNVYLSARNLPNT 174

Query: 174 NLLPVQGINVYDILRCSKLVLSKSAIEALEDRFK 207
           NL+    IN Y +L    LVL++ ++  + + FK
Sbjct: 175 NLILANLINTYTVLASKNLVLTERSVAVVNELFK 208


>gi|167771266|ref|ZP_02443319.1| hypothetical protein ANACOL_02624 [Anaerotruncus colihominis DSM
           17241]
 gi|167666517|gb|EDS10647.1| hypothetical protein ANACOL_02624 [Anaerotruncus colihominis DSM
           17241]
          Length = 207

 Score =  111 bits (277), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 67/207 (32%), Positives = 113/207 (54%), Gaps = 2/207 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQ-GILARVLRWQSWRKRIGCSKSKGRSEVAY 59
           M ++ V ++ G+    I +S+ +F + P    + A V+ + +  +R G   +  R+EV+ 
Sbjct: 1   MPKVQVFDMAGKAVSEIELSDAVFGITPNPVAVHACVVNYLA-NQRQGTQSTLTRTEVSG 59

Query: 60  TGSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFC 119
            G K + QKGTG AR  S    Q+R GG A GP P    + L KK++ LA++   SDK  
Sbjct: 60  GGRKPWRQKGTGHARQGSIRAPQWRKGGIALGPKPRSYRYTLNKKLKRLAIKSVFSDKVA 119

Query: 120 SNDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
            ++++V+D++  +  KTK +V   +AL      +I   +LD+    +A NIP +    V 
Sbjct: 120 GSNLIVVDSIALEGFKTKAVVEMLKALGADKKALILMPELDQKLVKSAANIPGVKTALVN 179

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRF 206
            INVYD++ C K ++ K A+  LE+ +
Sbjct: 180 TINVYDLVNCDKFIVCKDAVAKLEEVY 206


>gi|325848833|ref|ZP_08170343.1| 50S ribosomal protein L4 [Anaerococcus hydrogenalis ACS-025-V-Sch4]
 gi|325480477|gb|EGC83539.1| 50S ribosomal protein L4 [Anaerococcus hydrogenalis ACS-025-V-Sch4]
          Length = 207

 Score =  110 bits (276), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 74/209 (35%), Positives = 111/209 (53%), Gaps = 6/209 (2%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ V N+ GE+ G I ++E +FA    +  +   ++ Q   KR G   +K RSEV   
Sbjct: 1   MPKVEVLNIKGENVGEIELNETLFAADIAETAVYDTVKNQLANKRQGTQSAKTRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     + GGG  F P P    + +P+K++  AL   L+ K   
Sbjct: 61  GRKPFRQKGTGRARQGSIRAPHYTGGGIVFAPKPRDYSYKIPRKMKRKALYSVLTSKVND 120

Query: 121 NDIMVIDNLVSKECKTK---YLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLP 177
           N+++V+D L     KTK    ++T  +A D    ++I   + D     + RNI   N+  
Sbjct: 121 NELVVLDELKLDSYKTKEANEILTNIKA-DKKAYVVI--AENDDKVYRSFRNIEGCNVEK 177

Query: 178 VQGINVYDILRCSKLVLSKSAIEALEDRF 206
              INVYD+LR +KLV++K AI  LE+ F
Sbjct: 178 ANLINVYDLLRHNKLVITKEAIAKLEEVF 206


>gi|313677121|ref|YP_004055117.1| LSU ribosomal protein l4p [Marivirga tractuosa DSM 4126]
 gi|312943819|gb|ADR23009.1| LSU ribosomal protein L4P [Marivirga tractuosa DSM 4126]
          Length = 208

 Score =  110 bits (276), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 69/208 (33%), Positives = 111/208 (53%), Gaps = 2/208 (0%)

Query: 2   IELSVRNLDGEDKG-VISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           +ELS+    GED G  +S+S+ IF ++P    +   ++ +    R G  KSK R+E++ +
Sbjct: 1   MELSILKHTGEDTGRKVSLSDAIFDIEPNDHAIYLDVKQKMANARQGTHKSKERAEISGS 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
             K+  QKGTG AR  S     F+GGG+ FGP P      L KK++++A + AL+ K   
Sbjct: 61  TRKIKKQKGTGTARAGSIKSPIFKGGGRVFGPRPKDYSFKLNKKLKAVARKSALTYKAKD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDL-SNALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
             I V++     E KTK        L L S   ++   ++D+N  L+ RNI N  +  V 
Sbjct: 121 QMISVLEGFTFNEVKTKNYTDMLNKLSLDSKKTLLVLPEVDKNIVLSGRNIKNTQVTTVD 180

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRFK 207
            +N YD+L   +L+  + ++E +E+ FK
Sbjct: 181 SLNTYDVLHADQLLFVEGSLEKIENLFK 208


>gi|312899044|ref|ZP_07758428.1| ribosomal protein L4/L1 family protein [Megasphaera micronuciformis
           F0359]
 gi|310619829|gb|EFQ03405.1| ribosomal protein L4/L1 family protein [Megasphaera micronuciformis
           F0359]
          Length = 207

 Score =  110 bits (276), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 62/204 (30%), Positives = 108/204 (52%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++S  N+ G   G + +++ +F ++  + ++ + +  Q   +R+G   +K R  V   
Sbjct: 1   MPKVSTYNIAGAQTGEMELNDSVFGVEVNEAVMRQAVLRQLANERLGTHATKTRGLVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     + GGG  FGP P      +P+K R LA++ ALSDK  +
Sbjct: 61  GRKPWKQKGTGRARVGSTRSPLWVGGGTVFGPQPRSYEQKMPRKARRLAVKSALSDKVNT 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N++ V+D +V    KTK +V        S   ++     D      ARN+  +  +  + 
Sbjct: 121 NELFVLDEIVLAAPKTKEVVKVVDNFKFSGEKVLFITDGDEVMARCARNLQGVKSVSTEN 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
           +N++D+L  +KL ++KSA+  +E+
Sbjct: 181 MNIFDLLHYTKLFITKSAVAKIEE 204


>gi|323340375|ref|ZP_08080632.1| 50S ribosomal protein L4 [Lactobacillus ruminis ATCC 25644]
 gi|323092151|gb|EFZ34766.1| 50S ribosomal protein L4 [Lactobacillus ruminis ATCC 25644]
          Length = 207

 Score =  110 bits (276), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 107/195 (54%)

Query: 10  DGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKG 69
           DG   G + +++ +F ++P   ++   +  Q    R G    K RS V   G K + QKG
Sbjct: 10  DGTQNGDVQLNDAVFGIEPNNNVVFDAVIMQRASLRQGTHAVKNRSAVRGGGKKPWRQKG 69

Query: 70  TGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNL 129
           TGRAR  S    Q+ GGG  FGP P    + LP+KVR LA++  LS K   N ++V+D L
Sbjct: 70  TGRARQGSIRSPQWVGGGTVFGPTPRSYAYKLPRKVRRLAIKSVLSQKVLDNSLVVVDAL 129

Query: 130 VSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRC 189
             +  KTK        LD+ + +++     ++   LAARN+ N+ ++P +G+NV D++  
Sbjct: 130 TFEAPKTKAFAEVLNNLDVKSKVLVVLEDDNKTAALAARNLANVTVIPAKGLNVLDVVNN 189

Query: 190 SKLVLSKSAIEALED 204
            KLV++K A+  +E+
Sbjct: 190 DKLVITKGALSQVEE 204


>gi|292669859|ref|ZP_06603285.1| 50S ribosomal protein L4 [Selenomonas noxia ATCC 43541]
 gi|292648656|gb|EFF66628.1| 50S ribosomal protein L4 [Selenomonas noxia ATCC 43541]
          Length = 207

 Score =  110 bits (276), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 69/206 (33%), Positives = 105/206 (50%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  ++V ++     G IS++++ F ++   G+L + +  Q   +R+G   +K R  V   
Sbjct: 1   MANVAVYDMSHNQVGEISLNDEFFNVEMNAGLLHQAVVLQLASQRLGTHSTKTRGLVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     + GGG  FGP P      +P+K R LAL+ ALSDK  +
Sbjct: 61  GRKPWRQKGTGRARAGSTRSPLWVGGGTVFGPHPRKYGFTMPRKQRRLALKCALSDKVRT 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            D +V+D L     KTK  V       ++   +        N + +  NIP +  +   G
Sbjct: 121 GDFIVLDQLDFDAPKTKAAVKLLSDFGVNAKSLFITADEAVNVERSTSNIPGVKAITASG 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INV+DIL   KL ++K AI  +E+ F
Sbjct: 181 INVFDILHHDKLFITKDAITRIEEVF 206


>gi|262038243|ref|ZP_06011633.1| ribosomal protein, L4/L1 family [Leptotrichia goodfellowii F0264]
 gi|261747710|gb|EEY35159.1| ribosomal protein, L4/L1 family [Leptotrichia goodfellowii F0264]
          Length = 214

 Score =  110 bits (276), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 69/211 (32%), Positives = 111/211 (52%), Gaps = 7/211 (3%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  L+   LDG   G + V E+IF ++P + ++  VL  +    R G + +K R+EV   
Sbjct: 1   MPVLNTYKLDGSKAGTVEVKEEIFGIEPNKTVMHEVLVAELAGAREGNASTKTRAEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S       GGG   GP P      + KKVR LALR AL+ K  +
Sbjct: 61  GRKPFRQKGTGRARQGSTRAPHMVGGGVVHGPKPRDYTKKVNKKVRRLALRSALATKINN 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNA---LIID--GCQLDR--NFQLAARNIPNI 173
            D++V+D+      KTK  V   +AL+ +      I D  G   +R  N + + RN+  +
Sbjct: 121 GDLIVLDDFTLDVPKTKTFVQFAKALNFAGEKQLFIADYNGETFNRDINLEYSVRNLEKV 180

Query: 174 NLLPVQGINVYDILRCSKLVLSKSAIEALED 204
             L  + ++++ +++  K+V++K A+  +E+
Sbjct: 181 MTLDSRSLSIFWLIKQDKIVVTKEALATIEE 211


>gi|229825320|ref|ZP_04451389.1| hypothetical protein GCWU000182_00674 [Abiotrophia defectiva ATCC
           49176]
 gi|229790692|gb|EEP26806.1| hypothetical protein GCWU000182_00674 [Abiotrophia defectiva ATCC
           49176]
          Length = 206

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 67/206 (32%), Positives = 110/206 (53%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +SV N++G++ G + +++ IFA++ ++ ++ R +  Q    R G   +K R+ V   
Sbjct: 1   MANISVLNMEGKEVGSLELNDAIFAVEVKEHLMHRAVVLQLANNRQGTQSAKTRAAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+RGGG  F P P      + +K +  A+  AL+ K   
Sbjct: 61  GRKPWRQKGTGHARQGSIRSPQWRGGGVVFAPQPRDYSFKMNRKEKQAAICSALTTKLNE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N ++V+D     E KTK        +  + ALI+ G + + N  L+ARN+ ++       
Sbjct: 121 NKLIVLDEFKLGEIKTKAAKKVLEDIKANKALIVLG-EKEENVILSARNLESVETTLTNS 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYDIL    LV++K A+  +E+ +
Sbjct: 180 INVYDILNHDSLVMTKDAVSKIEEVY 205


>gi|325678593|ref|ZP_08158203.1| 50S ribosomal protein L4 [Ruminococcus albus 8]
 gi|324109643|gb|EGC03849.1| 50S ribosomal protein L4 [Ruminococcus albus 8]
          Length = 207

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 64/206 (31%), Positives = 110/206 (53%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +++V ++ G       +++ IF ++P + ++  ++      +R G   +  R+EV   
Sbjct: 1   MSQIAVVDMTGNKVADTELNDAIFGIEPNKALMHAMVVNYLANQRQGTQSTLTRTEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+  GG A GP P    ++L KK R LA++ ALS K   
Sbjct: 61  GRKPWRQKGTGHARQGSIRAPQWVHGGIALGPKPRDYSYSLNKKERRLAMKSALSTKVID 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           ++++V++ + +KE KTK +V   +A+      +I    +D     +A NIP +    V  
Sbjct: 121 SNLIVVNEIETKEYKTKVMVDMLKAIGAEGKALIVTADVDAKVVKSAANIPGVKTATVNT 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVYDIL   K V+S  A++ +E+ +
Sbjct: 181 LNVYDILNYDKFVVSSDAVKKIEEVY 206


>gi|317575759|ref|NP_001187653.1| mitochondrial 39S ribosomal protein l4 [Ictalurus punctatus]
 gi|308323607|gb|ADO28939.1| mitochondrial 39S ribosomal protein l4 [Ictalurus punctatus]
          Length = 312

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 108/205 (52%), Gaps = 3/205 (1%)

Query: 5   SVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKM 64
           S+ + + E  GV+ +  D+F++  +  IL  V  WQ   KRI  +K K R+EV   G K 
Sbjct: 87  SLGSYESEPLGVVDLHPDVFSVPVRLDILHAVEVWQRNFKRISNAKVKSRAEVRGGGGKP 146

Query: 65  YVQKGTGRARHSSKSVSQFRGGGKAFGPV-PIIGVHALPKKVRSLALRHALSDKFCSNDI 123
           + QKG+GRARH S     +RGGG A GP  P    + LP KVR   L+ AL+ K   + +
Sbjct: 147 WKQKGSGRARHGSIRSPIWRGGGVAHGPRGPTSYYYMLPMKVRVQGLKIALTAKLAQDYL 206

Query: 124 MVIDNLVSKECKTKYLVTRFRALDLSNA-LIID-GCQLDRNFQLAARNIPNINLLPVQGI 181
            VID L        YL    +     ++ LI+D G +   N   A  N+  +N++P  G+
Sbjct: 207 HVIDTLEIPTPDPHYLEELLKHRQWGDSVLIVDVGEEFSHNVLQATANLKTVNIIPAIGL 266

Query: 182 NVYDILRCSKLVLSKSAIEALEDRF 206
           NV+ +L+   LVL+  A++ LE + 
Sbjct: 267 NVHSMLKHESLVLTLEAVKFLEKKL 291


>gi|225707434|gb|ACO09563.1| Mitochondrial 39S ribosomal protein L4 [Osmerus mordax]
          Length = 302

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 106/200 (53%), Gaps = 3/200 (1%)

Query: 10  DGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKG 69
           + E  G++ +  D+FAL  +  IL  V  WQ   KRI  + +K RSEV   G K + QKG
Sbjct: 82  ESEPLGLVDLHPDVFALPARIDILHEVELWQRNYKRISHANTKVRSEVRGGGKKPWNQKG 141

Query: 70  TGRARHSSKSVSQFRGGGKAFGPV-PIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDN 128
           +GRARH S     +RGGG + GP  P    + +P KVR   L+ ALS K   N + V+D+
Sbjct: 142 SGRARHGSIRSPIWRGGGVSHGPRGPTSYYYMIPIKVRVQGLKIALSSKLAQNYLHVVDS 201

Query: 129 LVSKECKTKYLV--TRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDI 186
           L       +YLV   R+R    S  L+     L  N   A   +  +N++P  G+NV+ +
Sbjct: 202 LNIPTPDPQYLVDLIRYRYCGESVLLVDATDNLPDNILQATAGLKTVNVIPAIGLNVHSM 261

Query: 187 LRCSKLVLSKSAIEALEDRF 206
           L+   LVL+  A++ LE++ 
Sbjct: 262 LKHEVLVLTLEAVKFLENKL 281


>gi|271962633|ref|YP_003336829.1| 50S ribosomal protein L4 [Streptosporangium roseum DSM 43021]
 gi|270505808|gb|ACZ84086.1| 50S ribosomal protein L4 [Streptosporangium roseum DSM 43021]
          Length = 215

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 106/207 (51%), Gaps = 1/207 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + V ++ G   G + +  DIF  K    ++ +V+  Q   +R G  K+K R EV+  
Sbjct: 1   MSTIDVLDVSGAKTGTVDLPGDIFDAKVNIPLIHQVVVAQLAARRQGTHKAKTRGEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K Y QKGTGRAR  S    QF GGG   GP+P       PKK+++ ALR ALSD+   
Sbjct: 61  GKKPYRQKGTGRARQGSTRAPQFAGGGIVHGPLPRDYSQKTPKKMKAAALRGALSDRANG 120

Query: 121 NDIMVIDNLVSKEC-KTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
             + V+  LV  E  KTK  +   R +  + ++++   + D    L+ RN P ++LL   
Sbjct: 121 GRVHVVSALVQGETPKTKAALESLRKITQTRSVLVVVDEGDELTWLSLRNAPEVHLLDAG 180

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRF 206
            +N YD+L    +V ++ A + +  R 
Sbjct: 181 QLNTYDVLCYDDVVFTQEAYDQVVTRL 207


>gi|229823534|ref|ZP_04449603.1| hypothetical protein GCWU000282_00832 [Catonella morbi ATCC 51271]
 gi|229786978|gb|EEP23092.1| hypothetical protein GCWU000282_00832 [Catonella morbi ATCC 51271]
          Length = 207

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 106/206 (51%), Gaps = 4/206 (1%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++S+   DG   G I ++  +F ++P + ++   +  Q    R G    K RS V   
Sbjct: 1   MTKVSLFKQDGSQIGEIELNAAVFGVEPNEDVIFDAVIMQRASLRQGTHAVKNRSAVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+ GGG  FGP P    + LPKKVR LAL+  LS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWVGGGTVFGPTPRSYSYKLPKKVRRLALQSVLSQKVLE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRAL--DLSNALIIDGCQLDRNFQLAARNIPNINLLPV 178
             ++V+D L      TK   +    L  D    L+++G   +  F  +ARN+ N+ ++  
Sbjct: 121 GKLVVVDELSFAAPSTKEFKSVLNNLKVDAKTLLVLEGTNANAYF--SARNLANVKVIDE 178

Query: 179 QGINVYDILRCSKLVLSKSAIEALED 204
             +NV D++    LV++K+A+  +E+
Sbjct: 179 GNVNVLDVVNYDTLVITKAALSTVEE 204


>gi|212697254|ref|ZP_03305382.1| hypothetical protein ANHYDRO_01822 [Anaerococcus hydrogenalis DSM
           7454]
 gi|212675703|gb|EEB35310.1| hypothetical protein ANHYDRO_01822 [Anaerococcus hydrogenalis DSM
           7454]
          Length = 207

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 74/209 (35%), Positives = 111/209 (53%), Gaps = 6/209 (2%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ V N+ GE+ G I ++E +FA    +  +   ++ Q   KR G   +K RSEV   
Sbjct: 1   MPKVEVLNIKGENVGEIELNETLFAADIAETAVYDTVKNQLANKRQGTQSAKTRSEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     + GGG  F P P    + +PKK++  AL   L+ K   
Sbjct: 61  GRKPFRQKGTGRARQGSIRAPHYTGGGIVFAPKPRDYSYKIPKKMKRKALYSVLTSKVND 120

Query: 121 NDIMVIDNLVSKECKTK---YLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLP 177
           N+++V+D L     KTK    ++T  +A D    ++I   + D     + RNI   ++  
Sbjct: 121 NELVVLDELKLDSYKTKEANEILTNIKA-DKKAYVVI--AENDDKVYRSFRNIEGCDVEK 177

Query: 178 VQGINVYDILRCSKLVLSKSAIEALEDRF 206
              INVYD+LR +KLV++K AI  LE+ F
Sbjct: 178 ANLINVYDLLRHNKLVITKEAIAKLEEVF 206


>gi|257790718|ref|YP_003181324.1| 50S ribosomal protein L4/L1e [Eggerthella lenta DSM 2243]
 gi|317488571|ref|ZP_07947116.1| ribosomal protein L4/L1 family protein [Eggerthella sp. 1_3_56FAA]
 gi|325832045|ref|ZP_08165142.1| 50S ribosomal protein L4 [Eggerthella sp. HGA1]
 gi|257474615|gb|ACV54935.1| ribosomal protein L4/L1e [Eggerthella lenta DSM 2243]
 gi|316912313|gb|EFV33877.1| ribosomal protein L4/L1 family protein [Eggerthella sp. 1_3_56FAA]
 gi|325486366|gb|EGC88818.1| 50S ribosomal protein L4 [Eggerthella sp. HGA1]
          Length = 207

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 66/208 (31%), Positives = 105/208 (50%), Gaps = 8/208 (3%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQ--SWRKRIGCSKSKGRSEVA 58
           M  + +++  G+  G   ++  +F ++P   ++ +V+R Q  SWR+  G   +K R +V 
Sbjct: 1   MTTIEIKDASGKKAGTADLAASVFGIEPNVPVMHQVVRAQRASWRQ--GTHDTKTRGQVR 58

Query: 59  YTGSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKF 118
             G K + QKGTGRAR  +    Q+ GGG  FGP P      +  K   LA+R ALS K 
Sbjct: 59  GGGKKPWRQKGTGRARQGTIRAPQWAGGGTVFGPHPRSYAFRVNNKEVKLAMRSALSAKL 118

Query: 119 CSNDIMVID--NLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLL 176
              ++ V+D  N      K      +   L+    L+ID    D N  L+ RNIP +N+L
Sbjct: 119 ADGELFVVDAFNFEKPSTKAAVAALKALGLERRTTLVID--DEDVNTYLSFRNIPTVNIL 176

Query: 177 PVQGINVYDILRCSKLVLSKSAIEALED 204
           PV   N Y+++    LV +  A++ +E+
Sbjct: 177 PVSAANTYELIDNKALVFTADALKRIEE 204


>gi|312144246|ref|YP_003995692.1| ribosomal protein L4/L1e [Halanaerobium sp. 'sapolanicus']
 gi|311904897|gb|ADQ15338.1| ribosomal protein L4/L1e [Halanaerobium sp. 'sapolanicus']
          Length = 209

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 109/195 (55%), Gaps = 1/195 (0%)

Query: 11  GEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGT 70
           G +  ++ +++ +F  K  + ++ +V+  Q   +R G + +K R+ V   G K + QKGT
Sbjct: 11  GNELDMVDLNDSVFNNKINEHVVHQVVNAQLAARRSGTASTKNRANVRGGGRKPWRQKGT 70

Query: 71  GRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNLV 130
           GRARH S     + GGG  FGP P      L KK++ LAL+  L+DK   ++++++D + 
Sbjct: 71  GRARHGSIRSPLWVGGGVTFGPSPRSYDKKLTKKMKRLALKSVLTDKVNRDEVVLVDKIA 130

Query: 131 SKECKTKYLVTRFRALDLSN-ALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRC 189
             E KTK ++     L+L +  ++I   + D N  L+ARNIPN+  L    IN YD+L  
Sbjct: 131 LSEPKTKAVIKILADLNLEDKKVLIVMPEKDDNLYLSARNIPNVKTLLAGSINAYDLLDN 190

Query: 190 SKLVLSKSAIEALED 204
             ++  + A++ +E+
Sbjct: 191 EMIIFIEEAVKMIEE 205


>gi|153952862|ref|YP_001393627.1| 50S ribosomal protein L4 [Clostridium kluyveri DSM 555]
 gi|219853527|ref|YP_002470649.1| hypothetical protein CKR_0184 [Clostridium kluyveri NBRC 12016]
 gi|189029496|sp|A5N4P8|RL4_CLOK5 RecName: Full=50S ribosomal protein L4
 gi|254803727|sp|B9DYB0|RL4_CLOK1 RecName: Full=50S ribosomal protein L4
 gi|146345743|gb|EDK32279.1| RplD [Clostridium kluyveri DSM 555]
 gi|219567251|dbj|BAH05235.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 206

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 66/199 (33%), Positives = 111/199 (55%), Gaps = 1/199 (0%)

Query: 8   NLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQ 67
           N +G+      +S+ +F ++  Q ++ +V+      KR G   +K R+EV+  G K + Q
Sbjct: 8   NKEGQKITDFELSDKVFGVEVNQYVMHQVVVALLANKRQGTQSAKTRAEVSGGGIKPWRQ 67

Query: 68  KGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVID 127
           KGTGRAR  S    Q+  GG  F   P     ++PK  R LA++ ALS K   N I+V++
Sbjct: 68  KGTGRARQGSIRSPQWIHGGVVFAVKPRSYRISVPKSARRLAMKSALSSKVEENQIVVLE 127

Query: 128 NLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDIL 187
           +L     KTK +V    A +    LI+   + ++N   +ARNI  ++++PV  +NVYD+L
Sbjct: 128 SLEMDTPKTKEVVKILDAFEAKKTLIVT-AESNQNVYKSARNIQGVSVIPVNNLNVYDLL 186

Query: 188 RCSKLVLSKSAIEALEDRF 206
           +  KL+++K A+  +E+ +
Sbjct: 187 KFDKLIITKDAVSKIEEVY 205


>gi|284049256|ref|YP_003399595.1| ribosomal protein L4/L1e [Acidaminococcus fermentans DSM 20731]
 gi|283953477|gb|ADB48280.1| ribosomal protein L4/L1e [Acidaminococcus fermentans DSM 20731]
          Length = 209

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 70/208 (33%), Positives = 111/208 (53%), Gaps = 6/208 (2%)

Query: 1   MIELSVRNLDGEDKGV-ISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAY 59
           M +++V ++ G+  G  I + + +F ++  + ++ + +  Q   +R G   +K R  V  
Sbjct: 1   MPKVAVYDITGKQTGEEIELMDYVFGVEFNEAVVHQAVVMQQANERQGTHATKTRGMVRG 60

Query: 60  TGSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFC 119
            G K + QKGTGRAR  S     + GGG  FGP P      +P+K R LA+R ALS K  
Sbjct: 61  GGRKPWKQKGTGRARAGSVRSPLWVGGGTVFGPAPRSHAKDMPRKARRLAIRCALSAKVA 120

Query: 120 SNDIMVIDNLVSKECKTK---YLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLL 176
              ++V+DNL     KTK    ++T F A D    +I DG   + N + ++RNI  +  L
Sbjct: 121 EGALVVVDNLTFDAPKTKDAVAMLTGFEAADKKALIITDG--ENENVEKSSRNIEKVKAL 178

Query: 177 PVQGINVYDILRCSKLVLSKSAIEALED 204
               +NVYDIL   K++L+K A+  +E+
Sbjct: 179 SNDCLNVYDILNAEKVLLAKDAVARIEE 206


>gi|291460719|ref|ZP_06600109.1| ribosomal protein L4/L1 family protein [Oribacterium sp. oral taxon
           078 str. F0262]
 gi|291416678|gb|EFE90397.1| ribosomal protein L4/L1 family protein [Oribacterium sp. oral taxon
           078 str. F0262]
          Length = 206

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 69/209 (33%), Positives = 114/209 (54%), Gaps = 7/209 (3%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +SV ++ G++ G + +++ +FA    + +L   +  Q   +R G  K+  R+EV+  
Sbjct: 1   MAIVSVFDMQGKEVGKMELNDAVFAAPINEHLLHLAVVAQLANRRQGTKKALTRAEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q++GGG  F P P      L KK +  AL+ ALS+    
Sbjct: 61  GRKPWRQKGTGHARQGSIRAPQWKGGGVVFAPTPRDYRKDLNKKEKRAALKAALSNAVAD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQ---LAARNIPNINLLP 177
             ++V+D++   E KTK       AL L  A ++    LD+N +   L+ARNI ++    
Sbjct: 121 QKLVVVDSIHFDEIKTKKFQAMLDALKLKKAFVL----LDQNDEKTILSARNIEDVKTAQ 176

Query: 178 VQGINVYDILRCSKLVLSKSAIEALEDRF 206
           V  INVYD+++   ++ +K+A+E LE+ +
Sbjct: 177 VNEINVYDVMKYGTVLATKAALEKLEEVY 205


>gi|307328031|ref|ZP_07607212.1| ribosomal protein L4/L1e [Streptomyces violaceusniger Tu 4113]
 gi|306886336|gb|EFN17341.1| ribosomal protein L4/L1e [Streptomyces violaceusniger Tu 4113]
          Length = 217

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 67/202 (33%), Positives = 102/202 (50%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + + +  G+  G + +  +IF  +    ++ +V+  Q    R G  K+K R EV   
Sbjct: 1   MSTIDILSPAGDKAGTVELPAEIFDTQVSIPLIHQVVVAQLAAARQGTHKTKTRGEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K Y QKGTGRAR  S    QF GGG   GPVP       PKK+++ ALR ALSD+   
Sbjct: 61  GKKPYRQKGTGRARQGSTRAPQFAGGGVVHGPVPRDYSQRTPKKMKAAALRGALSDRARH 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             I V+  +V  +  TK   T    +     L++   + D    L+ARN+P +++L    
Sbjct: 121 ERIHVVTGVVDGDISTKAAKTLLGKISERKNLLLVAERSDEAAWLSARNLPQVHILEPGQ 180

Query: 181 INVYDILRCSKLVLSKSAIEAL 202
           +N YD+L    +V +K+A E+ 
Sbjct: 181 LNTYDVLVSDDVVFTKAAFESF 202


>gi|160894755|ref|ZP_02075530.1| hypothetical protein CLOL250_02306 [Clostridium sp. L2-50]
 gi|156863689|gb|EDO57120.1| hypothetical protein CLOL250_02306 [Clostridium sp. L2-50]
          Length = 206

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 63/206 (30%), Positives = 109/206 (52%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + V +++G++   + +++ +F ++  + ++   +  Q    R G   +K RSEV+  
Sbjct: 1   MASVKVYDIEGKEVETLELNDSVFGVEINEHLMHLAVVGQQANSRQGTQSAKTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+ GGG  F P P      + KK + LA++ ALS K   
Sbjct: 61  GRKPWRQKGTGHARQGSTRSPQWTGGGVVFAPKPRDYSVKMNKKEKQLAMKSALSAKLAE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           + ++V+D +  +E KT         L    +L++   + D+   L+A NIP +       
Sbjct: 121 DKLVVVDKIELEEVKTSVFAKILANLKAPKSLVVTKDKNDK-VVLSANNIPTVKTTATNS 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           ++VYDIL+  KLVL+K A+ A+E+ +
Sbjct: 180 LSVYDILKYDKLVLTKDAVAAIEEVY 205


>gi|302871499|ref|YP_003840135.1| ribosomal protein L4/L1e [Caldicellulosiruptor obsidiansis OB47]
 gi|312135495|ref|YP_004002833.1| 50S ribosomal protein L4/L1e [Caldicellulosiruptor owensensis OL]
 gi|302574358|gb|ADL42149.1| ribosomal protein L4/L1e [Caldicellulosiruptor obsidiansis OB47]
 gi|311775546|gb|ADQ05033.1| ribosomal protein L4/L1e [Caldicellulosiruptor owensensis OL]
          Length = 208

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 72/208 (34%), Positives = 113/208 (54%), Gaps = 3/208 (1%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ V N++G+  G I +++ IF +     +L + +      +R G   +K R+EV   
Sbjct: 1   MAKVPVYNIEGQQIGEIELNDSIFNVPINTHVLHQAVVAHLANRRQGTFAAKTRAEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     +R GG  F   P      LPKKVR LAL+ ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRAPTWRKGGVVFAKKPRDFSIDLPKKVRRLALKCALSSKVKE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSN--ALIIDGCQLDRNFQLAARNIPNINLLPV 178
           N+++V+D     + KTK ++   + L L N  ALI+   + +   Q + RNIP +  L V
Sbjct: 121 NNLIVLDRWDMNQYKTKEVLRVLKNLGLENQKALIVI-PEKNEYLQKSTRNIPEVKTLQV 179

Query: 179 QGINVYDILRCSKLVLSKSAIEALEDRF 206
             +NV+DIL+  K V+ + A++ +E+ +
Sbjct: 180 GNLNVFDILKYDKFVILQDAVKKVEEVY 207


>gi|307170893|gb|EFN63004.1| 39S ribosomal protein L4, mitochondrial [Camponotus floridanus]
          Length = 285

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 68/210 (32%), Positives = 111/210 (52%), Gaps = 6/210 (2%)

Query: 3   ELSVRNLDG-EDK--GVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAY 59
           ++ + NLD  E+K  G+I++   I+A  P+  I+ + +RWQ   + +  + +K R+EV  
Sbjct: 55  QVWLENLDTVEEKKLGLITLHPHIYAAAPRIDIIHQNVRWQKMYRWVCYAHTKTRAEVRG 114

Query: 60  TGSKMYVQKGTGRARHSSKSVSQFRGGGKAFGP-VPIIGVHALPKKVRSLALRHALSDKF 118
            G K + QKGTGRARH S     +RGGG A GP  P    + LP   R   L   LS K 
Sbjct: 115 GGRKPWPQKGTGRARHGSIRSPLWRGGGIAHGPRSPTTHFYMLPFYTRVAGLTSTLSVKL 174

Query: 119 CSNDIMVIDNLVSKECKTKYLVTRFRALDL-SNALIIDGCQ-LDRNFQLAARNIPNINLL 176
             +D+ +++ L     +  Y+       +   + L +D    +  N  LA   I ++NL+
Sbjct: 175 AQDDLHIVNELEIPTSEPSYIEQLIEKRNWGPSVLFVDSYDIMPTNITLATDEIKHVNLM 234

Query: 177 PVQGINVYDILRCSKLVLSKSAIEALEDRF 206
           PV G+NVY +L+ + LVL++ A   +E++ 
Sbjct: 235 PVYGLNVYSMLKHNTLVLTEKAARLIEEKL 264


>gi|319900925|ref|YP_004160653.1| LSU ribosomal protein L4P [Bacteroides helcogenes P 36-108]
 gi|319415956|gb|ADV43067.1| LSU ribosomal protein L4P [Bacteroides helcogenes P 36-108]
          Length = 208

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 118/205 (57%), Gaps = 2/205 (0%)

Query: 2   IELSVRNLDGEDKG-VISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           +E++V N+ GED G  ++++E IF ++P    +   ++     +R G  KSK RSE++ +
Sbjct: 1   MEVNVYNIKGEDTGRKVTLNESIFGIEPNDHAIYLDVKQFMANQRQGTHKSKERSEISGS 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
             K+  QKG G AR    +     GGG+ FGP P      L KKV++LA + ALS K  +
Sbjct: 61  TRKIGRQKGGGGARRGDMNSPVLVGGGRVFGPKPRDYYFKLNKKVKALARKSALSYKAQN 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSN-ALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
           N I+V+++      KTK  +   + L +S+  L++   + ++N  L+ARN+ + N+  V 
Sbjct: 121 NAIVVVEDFTFATPKTKDFIEMTKNLKVSDKKLLVVLPEANKNVYLSARNVKSANVQAVS 180

Query: 180 GINVYDILRCSKLVLSKSAIEALED 204
           G+N Y +L    +VL++SA+ A+++
Sbjct: 181 GLNTYRVLDAGIIVLAESALSAIDN 205


>gi|260905720|ref|ZP_05914042.1| LSU ribosomal protein L4P [Brevibacterium linens BL2]
          Length = 217

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 105/197 (53%), Gaps = 9/197 (4%)

Query: 11  GEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGT 70
           G   G + +  +IF ++    ++ +V+  Q    R G  K+K RSEV   G K Y QKGT
Sbjct: 14  GAKTGSVELPAEIFGVQTNVPLIHQVVVAQLAAARQGTHKTKTRSEVRGGGRKPYRQKGT 73

Query: 71  GRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNLV 130
           G AR  S    Q+ GGG   GPVP       PKK+++ ALR ALSD+   + + V+ NL+
Sbjct: 74  GNARQGSIRAPQYNGGGVVHGPVPRDYSQRTPKKMKAAALRGALSDRARLDQVFVVKNLI 133

Query: 131 SKEC-KTKYLVTRFRAL-DLSNALIIDGCQLDRNFQL---AARNIPNINLLPVQGINVYD 185
           + E   TK        L D  N L++    LDR+ +L   + RN+P++++L    +N YD
Sbjct: 134 TGEAPSTKQAKLALAGLSDRKNTLVV----LDRDDELTERSVRNLPHVHVLTSDQLNTYD 189

Query: 186 ILRCSKLVLSKSAIEAL 202
           +L    +V ++SA+E  
Sbjct: 190 VLIADDIVFTESALETF 206


>gi|197294630|ref|YP_001799171.1| 50S ribosomal protein L4 [Candidatus Phytoplasma australiense]
 gi|226730703|sp|B1VAE7|RL4_PHYAS RecName: Full=50S ribosomal protein L4
 gi|171853957|emb|CAM11920.1| 50S ribosomal protein L4 [Candidatus Phytoplasma australiense]
          Length = 207

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 68/207 (32%), Positives = 106/207 (51%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M + +V N  G+      +  ++F ++P Q  L  V+  Q    R G   +K R+ V+  
Sbjct: 1   MPKYNVINQLGDLISTKDLKSNVFDIQPHQQALYDVINAQRAAMRQGTHATKTRAFVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRARH S     +RGGG  FGP P      + +KV  LAL+ ALS  F  
Sbjct: 61  GKKPWRQKGTGRARHGSIRSPLWRGGGVVFGPSPRNYSVKVNQKVSHLALKSALSSHFRQ 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N ++++D+      K+K      + L++++  +I     +RN  LA+RN+P + L     
Sbjct: 121 NQLILVDDFNLDTHKSKDFQKTLQKLNVTSKALIIVTNSNRNLTLASRNLPYVTLETAAH 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRFK 207
            +VY IL C  L+L+  A+   E+  K
Sbjct: 181 ASVYQILNCKNLILTLDAVAYFEEVLK 207


>gi|53715465|ref|YP_101457.1| 50S ribosomal protein L4 [Bacteroides fragilis YCH46]
 gi|60683437|ref|YP_213581.1| 50S ribosomal protein L4 [Bacteroides fragilis NCTC 9343]
 gi|253566671|ref|ZP_04844124.1| 50S ribosomal protein L4 [Bacteroides sp. 3_2_5]
 gi|255011647|ref|ZP_05283773.1| 50S ribosomal protein L4 [Bacteroides fragilis 3_1_12]
 gi|265767549|ref|ZP_06095215.1| ribosomal protein L4/L1 [Bacteroides sp. 2_1_16]
 gi|313149483|ref|ZP_07811676.1| 50S ribosomal protein L4 [Bacteroides fragilis 3_1_12]
 gi|81313515|sp|Q5L8B0|RL4_BACFN RecName: Full=50S ribosomal protein L4
 gi|81608233|sp|Q64NK9|RL4_BACFR RecName: Full=50S ribosomal protein L4
 gi|52218330|dbj|BAD50923.1| 50S ribosomal protein L4 [Bacteroides fragilis YCH46]
 gi|60494871|emb|CAH09678.1| putative 50S ribosomal protein L4 [Bacteroides fragilis NCTC 9343]
 gi|251944843|gb|EES85318.1| 50S ribosomal protein L4 [Bacteroides sp. 3_2_5]
 gi|263252854|gb|EEZ24366.1| ribosomal protein L4/L1 [Bacteroides sp. 2_1_16]
 gi|301164922|emb|CBW24483.1| putative 50S ribosomal protein L4 [Bacteroides fragilis 638R]
 gi|313138250|gb|EFR55610.1| 50S ribosomal protein L4 [Bacteroides fragilis 3_1_12]
          Length = 208

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 118/205 (57%), Gaps = 2/205 (0%)

Query: 2   IELSVRNLDGEDKG-VISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           +E++V N+ GED G  ++++E IF ++P    +   ++     +R G  KSK RSE++ +
Sbjct: 1   MEVNVYNIKGEDTGRKVTLNESIFGIEPNDHAIYLDVKQFMANQRQGTHKSKERSEISGS 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
             K+  QKG G AR    +     GGG+ FGP P      L KKV++LA + ALS K   
Sbjct: 61  TRKIGRQKGGGGARRGDMNSPVLVGGGRVFGPKPRDYYFKLNKKVKTLARKSALSYKAQD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSN-ALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
           N I+V+++   +  KTK  V   + L +S+  L++   + ++N  L+ARNI   N+  + 
Sbjct: 121 NAIVVVEDFNFEAPKTKVFVEMTKNLKVSDKKLLVVLPEANKNVYLSARNIEGANVQTIS 180

Query: 180 GINVYDILRCSKLVLSKSAIEALED 204
           G+N Y +L    +VL++S+++A+++
Sbjct: 181 GLNTYRVLNAGVVVLTESSLKAIDN 205


>gi|237821420|ref|ZP_04597265.1| 50S ribosomal protein L4 [Streptococcus pneumoniae CCRI 1974M2]
          Length = 207

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 108/204 (52%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +++ +  G++ G + +S+ +F ++P + ++  V+  Q    R G    K RS V+  
Sbjct: 1   MANVTLFDQTGKEAGQVVLSDAVFGIEPNESVVFDVIISQRASLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGT RAR  S    Q+RGGG  FGP P    + LP+KVR LAL+   S+K   
Sbjct: 61  GRKPWRQKGTRRARQGSIRSPQWRGGGVVFGPTPRSYGYKLPQKVRRLALKSVYSEKVAE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N  + +D L     KT        AL + + +++   + +    L+ARN+PN+ +     
Sbjct: 121 NKFVAVDALSFTAPKTAEFAKVLAALSIDSKVLVILEEGNEFAALSARNLPNVKVATATT 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
            +V DI    KL+++++AI  +E+
Sbjct: 181 ASVLDIANSDKLLVTQAAISKIEE 204


>gi|309389932|gb|ADO77812.1| LSU ribosomal protein L4P [Halanaerobium praevalens DSM 2228]
          Length = 209

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 114/205 (55%), Gaps = 1/205 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +++  N  G++   + ++E +F  K  + ++ +V+  Q   +R G + +K R +V   
Sbjct: 1   MPQVTKFNQSGKELEKVELNESVFNDKINKHVVHQVVNAQLAARRGGNASTKTRGKVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRARH S     + GGG  FGP P      L KK+R LALR  L+DK   
Sbjct: 61  GRKPWRQKGTGRARHGSIRSPLWVGGGITFGPSPRSYDKKLTKKMRRLALRSVLTDKVER 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSN-ALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
           ++++++D L   + KTK +V     L+L +  ++I   + D+N  L+ARNIP +  L   
Sbjct: 121 DELILVDKLELDQPKTKAVVNILADLNLEDKKVVIVMPEKDKNLYLSARNIPKVKTLLAG 180

Query: 180 GINVYDILRCSKLVLSKSAIEALED 204
            IN YD+L    ++  + A++ +E+
Sbjct: 181 SINAYDLLDNEMVIFIEEAVKMVEE 205


>gi|326436109|gb|EGD81679.1| hypothetical protein PTSG_02393 [Salpingoeca sp. ATCC 50818]
          Length = 243

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 68/189 (35%), Positives = 100/189 (52%), Gaps = 11/189 (5%)

Query: 15  GVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGTGRAR 74
           G++ +   +F    ++ IL RV+ +Q    R G +K+K RSEV   G K + QKGTGRAR
Sbjct: 38  GMMELDPTVFGEDLRKDILQRVVVFQRASWRAGTAKTKTRSEVRGGGKKPWQQKGTGRAR 97

Query: 75  HSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNLVSKEC 134
            SS     FRGGG   GP P      LPKKV+ + +R ALS K   ND++++D+L     
Sbjct: 98  ASSIRSPLFRGGGTVHGPTPKDWSIKLPKKVQRMGVRVALSAKLAQNDLLIVDSLNLPSS 157

Query: 135 KTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRCSKLVL 194
             +         DL  AL  +   L  N   AA  + ++ ++P + INVYD+L    L++
Sbjct: 158 NEE---------DLLEALFSN--SLPPNLSAAAEGLDDVTVMPQRDINVYDMLNHPTLIM 206

Query: 195 SKSAIEALE 203
           S  A+  +E
Sbjct: 207 SMDAVREVE 215


>gi|317123096|ref|YP_004103099.1| 50S ribosomal protein L4P [Thermaerobacter marianensis DSM 12885]
 gi|315593076|gb|ADU52372.1| LSU ribosomal protein L4P [Thermaerobacter marianensis DSM 12885]
          Length = 212

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 115/212 (54%), Gaps = 12/212 (5%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILAR-VLRWQSWRKRIGCSKSKGRSEVAY 59
           M  ++V N  GE  G I +SE +F    ++ ++ + V+R+ + ++R G + +K R  V+ 
Sbjct: 1   MPRVAVYNTRGERVGEIELSETVFGAPVREALMHQAVVRYLANQRR-GTAATKTRGMVSG 59

Query: 60  TGSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFC 119
            G K + QKGTGRAR  S     +R GG  FGP P     ALPKK R  ALR ALS K  
Sbjct: 60  GGRKPWRQKGTGRARQGSIRAPHWRKGGIVFGPQPRDYSQALPKKARRAALRSALSAKVA 119

Query: 120 SNDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDG-------CQLDRNFQLAARNIPN 172
             +++V++ L  KE   +   TR  A  L   L +DG        + D    L+ARN+P 
Sbjct: 120 DGELIVLEGL--KELGLERPRTREVAA-LIERLDLDGKRPLFVLAEPDPTLYLSARNLPG 176

Query: 173 INLLPVQGINVYDILRCSKLVLSKSAIEALED 204
           ++   V  +NVY +LR   +VL++ A++ +E+
Sbjct: 177 VDTETVDRLNVYKVLRHGHVVLAREAVDRVEE 208


>gi|302536252|ref|ZP_07288594.1| 50S ribosomal protein L4 [Streptomyces sp. C]
 gi|302445147|gb|EFL16963.1| 50S ribosomal protein L4 [Streptomyces sp. C]
          Length = 216

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 66/202 (32%), Positives = 103/202 (50%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + + +  G+  G + +  +IF  K    ++ +V+  Q    R G  K+K R EV   
Sbjct: 1   MSTIDILSPAGDKAGTVELPAEIFDAKTSVPLIHQVVVAQLAAARQGTHKTKTRGEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K Y QKGTGRAR  S    QF GGG   GP P       PKK+++ ALR ALSD+   
Sbjct: 61  GKKPYRQKGTGRARQGSTRAPQFAGGGVVHGPQPRDYSQRTPKKMKAAALRGALSDRARH 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           + I V+  +V     TK   T F  +     L++   + D    L+ARN+P +++L    
Sbjct: 121 SRIHVVTGVVEGAASTKAAKTLFGKISERKNLLLVAERSDELAWLSARNLPQVHILEPGQ 180

Query: 181 INVYDILRCSKLVLSKSAIEAL 202
           +N YD++    +V +++A+E+ 
Sbjct: 181 LNTYDVIVSDDVVFTQAALESF 202


>gi|21223083|ref|NP_628862.1| 50S ribosomal protein L4 [Streptomyces coelicolor A3(2)]
 gi|256785822|ref|ZP_05524253.1| 50S ribosomal protein L4 [Streptomyces lividans TK24]
 gi|289769714|ref|ZP_06529092.1| 50S ribosomal protein L4/L1 [Streptomyces lividans TK24]
 gi|46577292|sp|Q9L0D9|RL4_STRCO RecName: Full=50S ribosomal protein L4
 gi|7321293|emb|CAB82071.1| 50S ribosomal protein L4 [Streptomyces coelicolor A3(2)]
 gi|289699913|gb|EFD67342.1| 50S ribosomal protein L4/L1 [Streptomyces lividans TK24]
          Length = 219

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 106/204 (51%), Gaps = 2/204 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFAL-KPQQGILARVLRWQSWRKRIGCSKSKGRSEVAY 59
           M  + + +  GE  G + +  +IF + K    ++ +V+  Q+   R G  K+K R EV  
Sbjct: 1   MSTVDILSPAGEKTGSVELPAEIFGVEKISIPLIHQVVVAQNAAARQGTHKTKRRGEVRG 60

Query: 60  TGSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFC 119
            G K Y QKGTGRAR  S    QF GGG   GP P       PKK+++ ALRHAL+D+  
Sbjct: 61  GGKKPYRQKGTGRARQGSTRAPQFAGGGVVHGPQPRDYSQRTPKKMKAAALRHALTDRAR 120

Query: 120 SNDIMVIDNLVSKE-CKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPV 178
            N I V+  ++  E   TK   T F  +     L++   + D    L+ARN+P I++L  
Sbjct: 121 HNRIHVVTGVIEGENPSTKAARTLFGKISERKNLLLVVDRADEAAWLSARNLPQIHILEP 180

Query: 179 QGINVYDILRCSKLVLSKSAIEAL 202
             +N YD+L    +V +++A E+ 
Sbjct: 181 GQLNTYDVLVSDDVVFTQAAFESF 204


>gi|294814468|ref|ZP_06773111.1| 50S ribosomal protein L4 [Streptomyces clavuligerus ATCC 27064]
 gi|326442857|ref|ZP_08217591.1| 50S ribosomal protein L4 [Streptomyces clavuligerus ATCC 27064]
 gi|294327067|gb|EFG08710.1| 50S ribosomal protein L4 [Streptomyces clavuligerus ATCC 27064]
          Length = 216

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 67/202 (33%), Positives = 102/202 (50%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + + +  G+  G + +  +IF  K    ++ +V+  Q    R G  K K R EV   
Sbjct: 1   MSTIDILSPAGDKTGTVELPAEIFDAKVSVPLIHQVVVAQLAAARQGTHKVKTRGEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K Y QKGTGRAR  S    QF GGG   GPVP       PKK+++ ALR AL+D+  +
Sbjct: 61  GKKPYRQKGTGRARQGSTRAPQFAGGGVVHGPVPRDYSQRTPKKMKAAALRGALTDRARN 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             I V+  +V     TK   T F  +     L++   + D    L+ARN+P +++L    
Sbjct: 121 ARIHVVTGVVEGGISTKAARTLFGKISERKNLLLVVERSDEAAWLSARNLPQVHILEPGQ 180

Query: 181 INVYDILRCSKLVLSKSAIEAL 202
           +N YD++R   +V +++A E  
Sbjct: 181 LNTYDVIRSEDVVFTQAAFETF 202


>gi|254391392|ref|ZP_05006595.1| 50S ribosomal protein L4 [Streptomyces clavuligerus ATCC 27064]
 gi|197705082|gb|EDY50894.1| 50S ribosomal protein L4 [Streptomyces clavuligerus ATCC 27064]
          Length = 219

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 67/202 (33%), Positives = 102/202 (50%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + + +  G+  G + +  +IF  K    ++ +V+  Q    R G  K K R EV   
Sbjct: 4   MSTIDILSPAGDKTGTVELPAEIFDAKVSVPLIHQVVVAQLAAARQGTHKVKTRGEVRGG 63

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K Y QKGTGRAR  S    QF GGG   GPVP       PKK+++ ALR AL+D+  +
Sbjct: 64  GKKPYRQKGTGRARQGSTRAPQFAGGGVVHGPVPRDYSQRTPKKMKAAALRGALTDRARN 123

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             I V+  +V     TK   T F  +     L++   + D    L+ARN+P +++L    
Sbjct: 124 ARIHVVTGVVEGGISTKAARTLFGKISERKNLLLVVERSDEAAWLSARNLPQVHILEPGQ 183

Query: 181 INVYDILRCSKLVLSKSAIEAL 202
           +N YD++R   +V +++A E  
Sbjct: 184 LNTYDVIRSEDVVFTQAAFETF 205


>gi|326334544|ref|ZP_08200755.1| 50S ribosomal protein L4 [Capnocytophaga sp. oral taxon 338 str.
           F0234]
 gi|325693313|gb|EGD35241.1| 50S ribosomal protein L4 [Capnocytophaga sp. oral taxon 338 str.
           F0234]
          Length = 209

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 113/205 (55%), Gaps = 4/205 (1%)

Query: 2   IELSVRNLDGEDKG-VISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           +E++V N+ G++ G  +++SE +F ++P    +   ++     +R G  KSK R+EVA +
Sbjct: 1   MEVAVLNIQGKETGRKVTLSEAVFGIEPNNHTIYLDIKQYLANQRQGTHKSKERNEVAGS 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
             K+  QKGTG AR  S     F GGG+ FGP P      L KKV+ LA R  LS K   
Sbjct: 61  TRKIKKQKGTGTARAGSVKSPVFVGGGRVFGPRPKDYTQKLNKKVKRLARRSVLSQKAQQ 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSN--ALIIDGCQLDRNFQLAARNIPNINLLPV 178
             I+V+++   +  KTK       AL + +  +L +     ++N  L++RNIP++N +  
Sbjct: 121 GAIIVLEDFNFETPKTKDFTQILAALGIQDKKSLFVL-ADTNKNVYLSSRNIPSVNTVTA 179

Query: 179 QGINVYDILRCSKLVLSKSAIEALE 203
             +N YD+   + +VL +SA+E ++
Sbjct: 180 YELNTYDVANATNVVLLESAVEVIQ 204


>gi|145596433|ref|YP_001160730.1| ribosomal protein L4/L1e [Salinispora tropica CNB-440]
 gi|145305770|gb|ABP56352.1| LSU ribosomal protein L4P [Salinispora tropica CNB-440]
          Length = 216

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 67/201 (33%), Positives = 103/201 (51%), Gaps = 1/201 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + V  ++G   G + +  DIF  +    ++ +V+  Q    R G  K+K R EVA  
Sbjct: 1   MTTVDVLTVEGTKAGSVELPADIFDAQANIALMHQVVVAQLAAARQGTHKTKTRGEVAGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K Y QKGTGRAR  S    QF GGG   GPVP       PKK+++ ALR ALSD+  +
Sbjct: 61  GKKPYKQKGTGRARQGSIRAPQFAGGGVVHGPVPRDYSQRTPKKMKAAALRGALSDRARA 120

Query: 121 NDIMVIDNLVSKE-CKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
           + + V++  V+ E   TK  +     L  +  +++     D    ++ RN P ++L+   
Sbjct: 121 DKVHVVEAFVAGEKPSTKAALATLAKLTEARRVLVVLSSTDELNWVSLRNEPRVHLIESG 180

Query: 180 GINVYDILRCSKLVLSKSAIE 200
            +N YD+L    +V +K A+E
Sbjct: 181 QLNTYDVLLADDVVFTKEALE 201


>gi|218245139|ref|YP_002370510.1| 50S ribosomal protein L4 [Cyanothece sp. PCC 8801]
 gi|257058164|ref|YP_003136052.1| 50S ribosomal protein L4 [Cyanothece sp. PCC 8802]
 gi|226730649|sp|B7K334|RL4_CYAP8 RecName: Full=50S ribosomal protein L4
 gi|218165617|gb|ACK64354.1| ribosomal protein L4/L1e [Cyanothece sp. PCC 8801]
 gi|256588330|gb|ACU99216.1| ribosomal protein L4/L1e [Cyanothece sp. PCC 8802]
          Length = 211

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 72/211 (34%), Positives = 114/211 (54%), Gaps = 8/211 (3%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M+   ++N  GE+ G  ++   +   +    I+ R L  Q    R G + +K R+EV   
Sbjct: 1   MVNCIIKNWQGEEVGQATLELKVAKEENAAHIVHRALVRQQTNARQGTASTKTRAEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     +RGGG  FGP P      + +K R LALR AL  +   
Sbjct: 61  GRKPWRQKGTGRARAGSIRSPLWRGGGVTFGPKPKDFNVKMNRKERRLALRTALDSRI-- 118

Query: 121 NDIMVIDNLVSK--ECKTKYLV---TRFRALDLSNALIIDGCQLDRNFQLAARNIPNINL 175
            D++V++N   +  + KTK LV   TR+  +D +  +++   ++  N QL+ARN+P I L
Sbjct: 119 EDLIVVENFAEQLTQPKTKELVSALTRW-GIDGNQKVVLIVSEITDNIQLSARNVPYIKL 177

Query: 176 LPVQGINVYDILRCSKLVLSKSAIEALEDRF 206
           L   G+NVYD+L   K+V +  A+  +++ +
Sbjct: 178 LKADGLNVYDLLVADKIVATAEALSKVQEVY 208


>gi|156405170|ref|XP_001640605.1| predicted protein [Nematostella vectensis]
 gi|156227740|gb|EDO48542.1| predicted protein [Nematostella vectensis]
          Length = 299

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 67/197 (34%), Positives = 107/197 (54%), Gaps = 2/197 (1%)

Query: 10  DGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKG 69
           D +  G+I +++ +F   P+  IL RV+ WQ  ++R G +  K RSEV   G K + QKG
Sbjct: 93  DDKSLGMIELNDFVFGENPRIDILHRVVVWQRAKRRAGTACVKDRSEVRGGGRKPWPQKG 152

Query: 70  TGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNL 129
             +AR  S     FRGGG   GP P    + LPKKVR + LR ALS +    D+ ++++ 
Sbjct: 153 LNKARQGSIRAPHFRGGGVVHGPKPRSYEYTLPKKVRRMGLRVALSVRLAQGDLHIVESF 212

Query: 130 VSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRC 189
              E   + L+         +A+++DG   +R F+ AA ++  +++   + +NVY IL  
Sbjct: 213 DDIE-DDQDLMPILDQRGWQSAVLVDGSPNERLFEAAA-DLDKVDVFYSENVNVYSILLR 270

Query: 190 SKLVLSKSAIEALEDRF 206
             L+LS  A++ LE+R 
Sbjct: 271 HNLILSLDAVKQLEERL 287


>gi|50364939|ref|YP_053364.1| 50S ribosomal protein L4 [Mesoplasma florum L1]
 gi|81612930|sp|Q6F1Z3|RL4_MESFL RecName: Full=50S ribosomal protein L4
 gi|50363495|gb|AAT75480.1| 50S ribosomal protein L4 [Mesoplasma florum L1]
          Length = 208

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 70/208 (33%), Positives = 114/208 (54%), Gaps = 10/208 (4%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           +EL V N+ G++   IS+++ ++ + P +  +   +  Q    R G  K+K R+EV   G
Sbjct: 1   MELKVLNVQGQEVKTISLNDSVWNVAPHKQAIYDTVISQQAALRQGTKKTKTRAEVRGGG 60

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGV-HALPKKVRSLALRHALSDKFCS 120
            K + QKGTGRAR  S     +RGGG  FGP P I    ++ KKVR+LA + ALS K   
Sbjct: 61  KKPWRQKGTGRARQGSIRAPHWRGGGVTFGPTPDINYKKSVNKKVRALAFKSALSIKASE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSN--ALIIDGCQLDRNFQL---AARNIPNINL 175
            +++++D     +  TK +++  + L + +   LII       N +L   ++ NI  +  
Sbjct: 121 QNLVIVDKFDFAKPSTKEMISVMKNLQIDDQKTLII----TKENEELVIKSSSNIKGVKT 176

Query: 176 LPVQGINVYDILRCSKLVLSKSAIEALE 203
           LP   +NV+DIL  +KLV+++ A  A+E
Sbjct: 177 LPSIKLNVFDILNATKLVMTEEAAMAVE 204


>gi|218131326|ref|ZP_03460130.1| hypothetical protein BACEGG_02937 [Bacteroides eggerthii DSM 20697]
 gi|317476355|ref|ZP_07935604.1| ribosomal protein L4/L1 family protein [Bacteroides eggerthii
           1_2_48FAA]
 gi|217986258|gb|EEC52595.1| hypothetical protein BACEGG_02937 [Bacteroides eggerthii DSM 20697]
 gi|316907381|gb|EFV29086.1| ribosomal protein L4/L1 family protein [Bacteroides eggerthii
           1_2_48FAA]
          Length = 208

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 69/205 (33%), Positives = 117/205 (57%), Gaps = 2/205 (0%)

Query: 2   IELSVRNLDGEDKG-VISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           +E++V N+ GED G  I+++E IF ++P    +   ++     +R G  KSK RSE++ +
Sbjct: 1   MEVNVYNIKGEDTGRKITLNESIFGIEPNDHAIYLDVKQFMANQRQGTHKSKERSEISGS 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
             K+  QKG G AR    +     GGG+ FGP P      L KKV++LA + ALS K  +
Sbjct: 61  TRKIGRQKGGGGARRGDMNSPVLVGGGRVFGPKPRDYFFKLNKKVKALARKSALSYKAQN 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSN-ALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
           N I+V+++   +  KTK  V   + L +S+  L++   + ++N  L+ARN+   N+  V 
Sbjct: 121 NGIIVVEDFNFEAPKTKDFVVMTKNLKVSDKKLLVILPEANKNVYLSARNVKGANVQTVS 180

Query: 180 GINVYDILRCSKLVLSKSAIEALED 204
           G+N Y +L    +V ++SA+ A+++
Sbjct: 181 GLNTYRVLDAGVVVFAESALSAIDN 205


>gi|187934984|ref|YP_001884474.1| 50S ribosomal protein L4 [Clostridium botulinum B str. Eklund 17B]
 gi|188589298|ref|YP_001919673.1| 50S ribosomal protein L4 [Clostridium botulinum E3 str. Alaska E43]
 gi|251779469|ref|ZP_04822389.1| 50S ribosomal protein L4 [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
 gi|226730642|sp|B2UYB1|RL4_CLOBA RecName: Full=50S ribosomal protein L4
 gi|226730643|sp|B2TIH6|RL4_CLOBB RecName: Full=50S ribosomal protein L4
 gi|187723137|gb|ACD24358.1| 50S ribosomal protein L4 [Clostridium botulinum B str. Eklund 17B]
 gi|188499579|gb|ACD52715.1| 50S ribosomal protein L4 [Clostridium botulinum E3 str. Alaska E43]
 gi|243083784|gb|EES49674.1| 50S ribosomal protein L4 [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
          Length = 206

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 65/206 (31%), Positives = 114/206 (55%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + + N +G+  G I ++ ++F ++  +  L +V+      KR G   +K R+EV   
Sbjct: 1   MPTVGLFNQEGKQVGDIQLNANVFEVEVNKHALHQVVVALLANKRQGTQSAKTRTEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+  GG  F P P     ++PK +R +A++ AL+ K   
Sbjct: 61  GIKPWRQKGTGRARQGSIRAPQWIKGGIVFAPKPRDYRVSIPKSMRRVAMKSALTSKVND 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
             ++V+++L  +  KTK  +    A +    LII     +  ++ +ARNI  ++++PV  
Sbjct: 121 GQMVVLESLSFEAPKTKQFIEMLSAFNAKKTLIITAESNEAVYK-SARNIQGVSVIPVNN 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYD+L+  KL+++K A+  +E+ +
Sbjct: 180 INVYDLLKFEKLIITKDAVSKIEEVY 205


>gi|29348135|ref|NP_811638.1| 50S ribosomal protein L4 [Bacteroides thetaiotaomicron VPI-5482]
 gi|253569591|ref|ZP_04847001.1| 50S ribosomal protein L4 [Bacteroides sp. 1_1_6]
 gi|298386182|ref|ZP_06995739.1| ribosomal protein L4/L1 family protein [Bacteroides sp. 1_1_14]
 gi|46576805|sp|Q8A477|RL4_BACTN RecName: Full=50S ribosomal protein L4
 gi|29340038|gb|AAO77832.1| 50S ribosomal protein L4 [Bacteroides thetaiotaomicron VPI-5482]
 gi|251841610|gb|EES69691.1| 50S ribosomal protein L4 [Bacteroides sp. 1_1_6]
 gi|298261410|gb|EFI04277.1| ribosomal protein L4/L1 family protein [Bacteroides sp. 1_1_14]
          Length = 208

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 67/205 (32%), Positives = 119/205 (58%), Gaps = 2/205 (0%)

Query: 2   IELSVRNLDGEDKG-VISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           +E++V N+ GED G  ++++E IF ++P    +   ++     +R G  KSK RSE++ +
Sbjct: 1   MEVNVYNIKGEDTGRKVTLNESIFGIEPNDHAIYLDVKQFMANQRQGTHKSKERSEISGS 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
             K+  QKG G AR    +     GG + FGP P      L KKV++LA + ALS K  +
Sbjct: 61  TRKIGRQKGGGGARRGDMNSPVLVGGARVFGPKPRDYFFKLNKKVKTLARKSALSYKVQN 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSN-ALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
           N ++V+++ V +  KTK  V   + L +S+  L++   + ++N  L+ARNI   N+  V 
Sbjct: 121 NALIVVEDFVFEAPKTKDFVAMTKNLKVSDKKLLVILPEANKNVYLSARNIEGANVQTVS 180

Query: 180 GINVYDILRCSKLVLSKSAIEALED 204
           G+N Y +L    +VL++++++A+++
Sbjct: 181 GLNTYRVLNAGVVVLTENSLKAIDN 205


>gi|313895056|ref|ZP_07828613.1| 50S ribosomal protein L4 [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|312975951|gb|EFR41409.1| 50S ribosomal protein L4 [Selenomonas sp. oral taxon 137 str.
           F0430]
          Length = 207

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 104/206 (50%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  ++V ++  +  G I +S+D F ++   G+L + +  Q   +R+G   +K R  V   
Sbjct: 1   MANVAVYDMSHKQVGEIDLSDDFFNVEMNAGLLHQAVVLQLASQRLGTHATKTRGLVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     + GGG  FGP P      +P+K R LAL+ ALSDK  +
Sbjct: 61  GKKPWRQKGTGRARAGSTRSPLWVGGGTVFGPHPRKYGFTMPRKQRRLALKCALSDKVRT 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            D +V+++L     KTK  V       +    +        N   +  NIP +  +   G
Sbjct: 121 GDFIVLESLDFDAPKTKQAVKLLNDFGVDAKSLFITADEAVNVARSTSNIPGVKAITAAG 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INV+DIL   KL ++K A+  +E+ F
Sbjct: 181 INVFDILHHDKLFITKDAVTRIEEVF 206


>gi|302553543|ref|ZP_07305885.1| ribosomal protein L4/L1 [Streptomyces viridochromogenes DSM 40736]
 gi|302471161|gb|EFL34254.1| ribosomal protein L4/L1 [Streptomyces viridochromogenes DSM 40736]
          Length = 218

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 106/204 (51%), Gaps = 2/204 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFAL-KPQQGILARVLRWQSWRKRIGCSKSKGRSEVAY 59
           M  + + +  G+  G + +  +IF + K    ++ +V+  Q    R G  K+K R EV  
Sbjct: 1   MSTVDILSPAGDKAGSVELPAEIFDVEKVSIPLIHQVVVAQLAAARQGTHKTKTRGEVRG 60

Query: 60  TGSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFC 119
            G K Y QKGTGRAR  S    QF GGG   GPVP       PKK+++ ALRHAL+D+  
Sbjct: 61  GGKKPYRQKGTGRARQGSTRAPQFAGGGVVHGPVPRDYSQRTPKKMKAAALRHALTDRAR 120

Query: 120 SNDIMVIDNLVSKE-CKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPV 178
            N I V+  +V  E   TK   T F  +     L++   + D    L+ARN+P +++L  
Sbjct: 121 HNRIHVVSGVVEGENPSTKSAKTLFGKISERKNLLLVVDRADEAAWLSARNLPQVHILEP 180

Query: 179 QGINVYDILRCSKLVLSKSAIEAL 202
             +N YD+L    +V +++A E+ 
Sbjct: 181 GQLNTYDVLVSDDVVFTQAAFESF 204


>gi|223936427|ref|ZP_03628339.1| ribosomal protein L4/L1e [bacterium Ellin514]
 gi|223894945|gb|EEF61394.1| ribosomal protein L4/L1e [bacterium Ellin514]
          Length = 208

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 67/210 (31%), Positives = 109/210 (51%), Gaps = 10/210 (4%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFAL----KPQQGILARVLRWQS-WRKRIGCSKSKGRSE 56
           ++L ++++ G  +G + V    F+L    +  Q +   V+ +++  R    C+K+ G  E
Sbjct: 1   MKLKIQDIKGNSQGEMDVK---FSLVTNGRGTQAVHDAVVAYRAAQRSGTACAKTVG--E 55

Query: 57  VAYTGSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSD 116
           VA +  K + QKGTGRAR  S     +RGGG  FGP P      + +  + LA R AL++
Sbjct: 56  VAGSNKKPWKQKGTGRARAGSVRSPLWRGGGVVFGPRPRDFSKKISRSTKQLAFRKALTE 115

Query: 117 KFCSNDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLL 176
           +  + D++V+DN      KTK  V    AL +    ++    LD N   A+RN+  + + 
Sbjct: 116 RLNAGDVLVVDNFKLASAKTKEFVGVLTALKVEGTALVVADALDANLSRASRNVAKVEVA 175

Query: 177 PVQGINVYDILRCSKLVLSKSAIEALEDRF 206
               +N Y ILR  KLV ++SA E +E+R 
Sbjct: 176 TSDSVNTYQILRSDKLVFTRSAFEKVEERL 205


>gi|313903150|ref|ZP_07836544.1| LSU ribosomal protein L4P [Thermaerobacter subterraneus DSM 13965]
 gi|313466652|gb|EFR62172.1| LSU ribosomal protein L4P [Thermaerobacter subterraneus DSM 13965]
          Length = 212

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 70/209 (33%), Positives = 113/209 (54%), Gaps = 6/209 (2%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILAR-VLRWQSWRKRIGCSKSKGRSEVAY 59
           M  ++V N  GE  G I +S+ +F    ++ ++ + V+R+ + ++R G + +K R  V+ 
Sbjct: 1   MPRVAVYNTQGERVGEIELSDAVFGAPVREALMHQAVVRYLANQRR-GTAATKTRGMVSG 59

Query: 60  TGSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFC 119
            G K + QKGTGRAR  S    Q+R GG  FGP P      LPKK R  ALR ALS K  
Sbjct: 60  GGRKPWRQKGTGRARQGSIRAPQWRKGGIVFGPQPRDYTQDLPKKARRAALRSALSAKVA 119

Query: 120 SNDIMV---IDNLVSKECKTKYLVTRFRALDLSNA-LIIDGCQLDRNFQLAARNIPNINL 175
             +++V   +D+L  +  +T+ +    R LDL     +    + ++   L+ RN+P  + 
Sbjct: 120 DGELIVLEGLDDLGLERPRTREMAALIRRLDLEGKRPLFVLAEPNKTLYLSVRNLPGADT 179

Query: 176 LPVQGINVYDILRCSKLVLSKSAIEALED 204
             V  +NVY +LR   +VL++ A+E  E+
Sbjct: 180 ETVDRLNVYQVLRHGHVVLAREAVERAEE 208


>gi|114778823|ref|ZP_01453630.1| 50S ribosomal protein L4 [Mariprofundus ferrooxydans PV-1]
 gi|114550954|gb|EAU53518.1| 50S ribosomal protein L4 [Mariprofundus ferrooxydans PV-1]
          Length = 207

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 72/207 (34%), Positives = 110/207 (53%), Gaps = 2/207 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M E+++ N   ++ G   ++  +F L      + RV    +  +R G SK K RSEV+  
Sbjct: 1   MAEITIVNQSNKEVGKRELNPAVFGLDADAAFVHRVYAALASAQRGGTSKVKDRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHA-LPKKVRSLALRHALSDKFC 119
           G K + QKGTGRAR  S   +Q+R GG A GP         + KK R  AL  ALSD   
Sbjct: 61  GKKPWKQKGTGRARAGSSRQAQWRHGGTAHGPSADTSFATRINKKERRRALCLALSDCLR 120

Query: 120 SNDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
              + V+D L   E KTK  V    AL   + LI+ G + +   +L+ RN+PN  ++   
Sbjct: 121 EGKLTVVDKLELAEIKTKAFVDTLGALGADSGLIVLG-ESNNAVELSGRNVPNTRIVLDG 179

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRF 206
            +N++D+L+  ++VL+ +AI+ LE+R 
Sbjct: 180 QVNLHDLLKSKRVVLTSAAIDNLEERL 206


>gi|261367802|ref|ZP_05980685.1| ribosomal protein L4/L1 family protein [Subdoligranulum variabile
           DSM 15176]
 gi|282570600|gb|EFB76135.1| ribosomal protein L4/L1 family protein [Subdoligranulum variabile
           DSM 15176]
          Length = 206

 Score =  108 bits (271), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 65/206 (31%), Positives = 105/206 (50%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +  V +++G+    + +S+ +F + P +  +   +      +R G   +K R EV   
Sbjct: 1   MAQFDVVDMNGKKVSTVELSDAVFGITPNEKAVHEAVVNFLANQRQGTQNTKIRKEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+  GG A GP P    + + KKV+ LAL  ALSDK  +
Sbjct: 61  GKKPWRQKGTGHARQGSIRAPQWTHGGVALGPKPRSYYYTINKKVKRLALLSALSDKAAN 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            +++++D + +   KTK +V    A+      +I    LD  F  +A NIP +      G
Sbjct: 121 GNLIIVDKIAADAYKTKTVVAFLAAVGAGKKNLIVNDALDEKFVKSAANIPGVK-TAATG 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +N YD++   KL+LS  A + LE+ +
Sbjct: 180 VNTYDVVNADKLILSVDAAKKLEEVY 205


>gi|317054767|ref|YP_004103234.1| 50S ribosomal protein L4/L1e [Ruminococcus albus 7]
 gi|315447036|gb|ADU20600.1| ribosomal protein L4/L1e [Ruminococcus albus 7]
          Length = 207

 Score =  108 bits (271), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 64/207 (30%), Positives = 112/207 (54%), Gaps = 2/207 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGIL-ARVLRWQSWRKRIGCSKSKGRSEVAY 59
           M +++V ++ G       +++ IF ++P + ++ A V+ + +  +R G   +  R+EV  
Sbjct: 1   MSKIAVVDMTGNKVADTELNDAIFGIEPNKALMHAMVVNFLA-NQRQGTQSTLTRTEVQG 59

Query: 60  TGSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFC 119
            G K + QKGTG AR  S    Q+  GG A GP P    ++L KK + LA++ A S K  
Sbjct: 60  GGRKPWRQKGTGHARQGSIRAPQWVHGGIALGPKPRDYSYSLNKKEKRLAMKSAFSTKVI 119

Query: 120 SNDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
            N+++V++ + +KE KTK +V   +A+      +I    +D     +A NIP +    V 
Sbjct: 120 DNNLIVVNEIETKEYKTKVMVDMLKAIGAQGKALIVTADVDAKVVKSAANIPGVKTATVN 179

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRF 206
            +NVYDIL   K ++S  A++ +E+ +
Sbjct: 180 TLNVYDILNYDKFIVSSEAVKKIEEVY 206


>gi|304438363|ref|ZP_07398304.1| ribosomal protein L4/L1 family protein [Selenomonas sp. oral taxon
           149 str. 67H29BP]
 gi|304368729|gb|EFM22413.1| ribosomal protein L4/L1 family protein [Selenomonas sp. oral taxon
           149 str. 67H29BP]
          Length = 207

 Score =  108 bits (271), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 69/206 (33%), Positives = 104/206 (50%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  ++V ++     G IS+++  F ++   G+L + +  Q   +R+G   +K R  V   
Sbjct: 1   MANVAVYDMAHNQVGEISLNDAFFNVEMNAGLLHQAVVLQLASQRLGTHATKTRGLVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     + GGG  FGP P      +P+K R LAL+ ALSDK  +
Sbjct: 61  GRKPWRQKGTGRARAGSTRSPLWVGGGTVFGPHPRKYGFTMPRKQRRLALKCALSDKVRT 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            D +V+D+L     KTK  V       +    +        N + +  NIP +  +   G
Sbjct: 121 GDFIVLDHLDFDAPKTKAAVKLLSDFGVDAKSLFITADEAVNVERSTSNIPGVKAITASG 180

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INV+DIL   KL ++K AI  +E+ F
Sbjct: 181 INVFDILHHDKLFITKDAITRIEEVF 206


>gi|158297277|ref|XP_317543.4| AGAP007937-PA [Anopheles gambiae str. PEST]
 gi|157015117|gb|EAA12669.4| AGAP007937-PA [Anopheles gambiae str. PEST]
          Length = 224

 Score =  108 bits (271), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 65/195 (33%), Positives = 102/195 (52%), Gaps = 3/195 (1%)

Query: 15  GVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGTGRAR 74
           G++ +   +F   P+  I+ + + WQ   + +  + +K R+EV   G K + QKG GRAR
Sbjct: 10  GIVELDNAVFGASPRIDIVHQNIEWQRKYRFVSFAHTKTRNEVRGGGRKPWPQKGLGRAR 69

Query: 75  HSSKSVSQFRGGGKAFGP-VPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNLVSKE 133
           H S     +RGGG A GP  P    + LP   R L L   LS K   +D+ V+ NL    
Sbjct: 70  HGSIRSPLWRGGGIAHGPRSPTTHFYMLPFFNRVLGLVSTLSIKLAQDDLHVVKNLEIPT 129

Query: 134 CKTKYLVTRFRALDL-SNALIIDGCQ-LDRNFQLAARNIPNINLLPVQGINVYDILRCSK 191
              +YL     A     + L +D    L RN  ++A NI +INL+P  G+NVY +L+ + 
Sbjct: 130 DDPQYLQDLVAARQWGPSVLFVDATDVLSRNISISAENIDHINLMPTYGLNVYSMLKHNT 189

Query: 192 LVLSKSAIEALEDRF 206
           +VL++ A+ ++E + 
Sbjct: 190 VVLTEDAVRSVESKL 204


>gi|225376410|ref|ZP_03753631.1| hypothetical protein ROSEINA2194_02052 [Roseburia inulinivorans DSM
           16841]
 gi|225211786|gb|EEG94140.1| hypothetical protein ROSEINA2194_02052 [Roseburia inulinivorans DSM
           16841]
          Length = 206

 Score =  108 bits (271), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 66/206 (32%), Positives = 108/206 (52%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  ++V N++G++ G + +++ IF ++  + ++   +  Q    R G  K+K RSEV+  
Sbjct: 1   MANVAVYNMEGKEVGSLELNDAIFGVEVNEHLVHMAVLQQLANNRQGTQKAKTRSEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  S    Q+  GG  F PVP      L KK +  AL+ AL+ +   
Sbjct: 61  GRKPWRQKGTGHARQGSTRAPQWTHGGVVFAPVPRDYSFKLNKKEKRAALKSALTSRVNE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           +  +V+D L   E KTK  V     L +  AL++     D N   +A N+  +       
Sbjct: 121 SKFVVVDELKLDEIKTKKFVEVMNNLKVEKALVVLNDN-DVNVIKSASNLATVKTAQTNE 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           INVYDIL+   +V++K A++ +E+ +
Sbjct: 180 INVYDILKYDTVVVTKDAVKTIEEVY 205


>gi|238061120|ref|ZP_04605829.1| 50S ribosomal protein L4 rplD [Micromonospora sp. ATCC 39149]
 gi|57547708|gb|AAW52547.1| RplD [Micromonospora sp. ATCC 39149]
 gi|237882931|gb|EEP71759.1| 50S ribosomal protein L4 rplD [Micromonospora sp. ATCC 39149]
          Length = 216

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 67/202 (33%), Positives = 105/202 (51%), Gaps = 3/202 (1%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + V N++G   G + +   IF ++    ++ +V+  Q    R G  K+K R EVA  
Sbjct: 1   MTTVDVLNVEGAKSGSVELPAGIFDVQANIALMHQVVVAQLAAARQGTHKAKTRGEVAGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K Y QKGTGRAR  S    QF GGG   GPVP       PKK+++ ALR ALSD+  +
Sbjct: 61  GKKPYKQKGTGRARQGSIRAPQFAGGGVVHGPVPRDYSQRTPKKMKAAALRGALSDRARA 120

Query: 121 NDIMVIDNLVSKECKTK--YLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPV 178
             + V++  VS E  +    L T  +  +    L++     + N+ ++ RN P ++L+  
Sbjct: 121 GQVHVVEAFVSGEKPSTKAALATLAKLTEAPRVLVVLSSSDELNW-VSLRNEPRVHLIEA 179

Query: 179 QGINVYDILRCSKLVLSKSAIE 200
             +N YD+L    +V +K A++
Sbjct: 180 GQLNTYDVLVADDVVFTKDALD 201


>gi|34541540|ref|NP_906019.1| 50S ribosomal protein L4 [Porphyromonas gingivalis W83]
 gi|46577171|sp|Q7MTL4|RL4_PORGI RecName: Full=50S ribosomal protein L4
 gi|34397857|gb|AAQ66918.1| ribosomal protein L4 [Porphyromonas gingivalis W83]
          Length = 209

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 71/208 (34%), Positives = 114/208 (54%), Gaps = 2/208 (0%)

Query: 2   IELSVRNLDGEDKGVISVSED-IFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           +ELSV N+ GED G   V +D IFA++P    +   ++     +R G  K+K RSE++ +
Sbjct: 1   MELSVYNIKGEDTGKKVVLDDSIFAIEPNDHAIYLDVKQYMANQRQGTHKAKERSELSGS 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
             K+  QKG+G AR    +     GG + FGP P      L KK+++LA R ALS K  +
Sbjct: 61  TRKLIRQKGSGGARRGDINSPLLSGGARVFGPRPRNYSFKLNKKLKALARRSALSYKAKN 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGC-QLDRNFQLAARNIPNINLLPVQ 179
           N+I+V+++      KTK       AL +    ++    ++++N  L+ARN+PN NL+   
Sbjct: 121 NEIIVVEDFNFDAPKTKAFKAISAALKVGEKKVLYVLPEVNKNVYLSARNLPNTNLILAN 180

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRFK 207
            IN Y +L    LVL++ ++  + + FK
Sbjct: 181 LINTYTVLASKNLVLTERSVAVVNELFK 208


>gi|312127227|ref|YP_003992101.1| 50S ribosomal protein L4/L1e [Caldicellulosiruptor hydrothermalis
           108]
 gi|312793938|ref|YP_004026861.1| 50S ribosomal protein L4/L1e [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312877366|ref|ZP_07737331.1| ribosomal protein L4/L1e [Caldicellulosiruptor lactoaceticus 6A]
 gi|311777246|gb|ADQ06732.1| ribosomal protein L4/L1e [Caldicellulosiruptor hydrothermalis 108]
 gi|311795840|gb|EFR12204.1| ribosomal protein L4/L1e [Caldicellulosiruptor lactoaceticus 6A]
 gi|312181078|gb|ADQ41248.1| ribosomal protein L4/L1e [Caldicellulosiruptor kristjanssonii
           177R1B]
          Length = 208

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 71/208 (34%), Positives = 113/208 (54%), Gaps = 3/208 (1%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ V N++G+  G I +++ IF +     +L + +      +R G   +K R+EV   
Sbjct: 1   MAKVPVYNIEGQQIGEIELNDSIFNVPINTHVLHQAVVAHLANRRQGTFAAKTRAEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     +R GG  F   P      LPKKV+ LAL+ ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRAPTWRKGGVVFAKKPRDFSIDLPKKVKRLALKCALSSKVKE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSN--ALIIDGCQLDRNFQLAARNIPNINLLPV 178
           N+++V+D     + KTK ++   + L L N  ALI+   + +   Q + RNIP +  L V
Sbjct: 121 NNLIVLDRWDMNQYKTKEVLRVLKNLGLENQKALIVI-PEKNEYLQKSTRNIPEVKTLQV 179

Query: 179 QGINVYDILRCSKLVLSKSAIEALEDRF 206
             +NV+DIL+  K V+ + A++ +E+ +
Sbjct: 180 GNLNVFDILKYDKFVILQDAVKKVEEVY 207


>gi|239929513|ref|ZP_04686466.1| 50S ribosomal protein L4 [Streptomyces ghanaensis ATCC 14672]
 gi|291437838|ref|ZP_06577228.1| 50S ribosomal protein L4 [Streptomyces ghanaensis ATCC 14672]
 gi|291340733|gb|EFE67689.1| 50S ribosomal protein L4 [Streptomyces ghanaensis ATCC 14672]
          Length = 219

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 105/204 (51%), Gaps = 2/204 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFAL-KPQQGILARVLRWQSWRKRIGCSKSKGRSEVAY 59
           M  + + +  G+  G + +  +IF + K    ++ +V+  Q    R G  K+K R EV  
Sbjct: 1   MSTVDILSPAGDKAGTVELPAEIFGVEKVSVPLIHQVVVAQLAAARQGTHKTKTRGEVRG 60

Query: 60  TGSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFC 119
            G K Y QKGTGRAR  S    QF GGG   GP P       PKK+++ ALRHAL+D+  
Sbjct: 61  GGKKPYRQKGTGRARQGSTRAPQFAGGGIVHGPQPRDYSQRTPKKMKAAALRHALTDRAR 120

Query: 120 SNDIMVIDNLVSKECK-TKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPV 178
            N I V+  +V  E   TK   + F  +     L++   + D    L+ARN+P +++L  
Sbjct: 121 HNRIHVVTGVVEGETPSTKAAKSLFGKISERKNLLLVVDRADEAAWLSARNLPQVHILEP 180

Query: 179 QGINVYDILRCSKLVLSKSAIEAL 202
             +N YD+L    +V +K+A E+ 
Sbjct: 181 GQLNTYDVLVSDDVVFTKAAFESF 204


>gi|120402317|ref|YP_952146.1| 50S ribosomal protein L4 [Mycobacterium vanbaalenii PYR-1]
 gi|119955135|gb|ABM12140.1| LSU ribosomal protein L4P [Mycobacterium vanbaalenii PYR-1]
          Length = 219

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 67/201 (33%), Positives = 102/201 (50%), Gaps = 3/201 (1%)

Query: 3   ELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGS 62
           ++ VR   G+  G I +  ++F ++P   ++ +V+  Q   KR G   +K R EV+  G 
Sbjct: 7   KIPVRTPAGKTDGSIELPAELFDVEPNIALMHQVVNAQLAAKRQGTHSTKTRGEVSGGGK 66

Query: 63  KMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSND 122
           K Y QKGTGRAR  S    QF GGG   GP P       PKK+   ALR ALSD+  ++ 
Sbjct: 67  KPYRQKGTGRARQGSTRAPQFTGGGIVHGPKPRDYSERTPKKMIRAALRGALSDRARNDR 126

Query: 123 IMVIDNLVSKECKTKYLVTRFRA--LDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           I  I  +V  +  +      F A   D    L++ G + D    L+ RN+P ++++    
Sbjct: 127 IHAITEIVEGQTPSTKSAKSFLATLTDRRQVLVVIG-RADEASALSVRNLPGVHVISPDQ 185

Query: 181 INVYDILRCSKLVLSKSAIEA 201
           +N YD+L+   +V S  A+ A
Sbjct: 186 LNTYDVLKADDVVFSVEALNA 206


>gi|239905859|ref|YP_002952598.1| 50S ribosomal protein L4 [Desulfovibrio magneticus RS-1]
 gi|259491554|sp|C4XLX4|RL4_DESMR RecName: Full=50S ribosomal protein L4
 gi|239795723|dbj|BAH74712.1| 50S ribosomal protein L4 [Desulfovibrio magneticus RS-1]
          Length = 210

 Score =  108 bits (270), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 108/206 (52%), Gaps = 1/206 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + + N   ++ G + ++ ++F ++ Q  +L  V+R Q   KR G    K R+ V+  
Sbjct: 1   MANVKLFNQGCQEIGTVDLAPEVFEVEVQPELLHLVVRAQLAAKRAGTHSVKTRAFVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     +RGG    GP P      + +KVR LALR ALS K   
Sbjct: 61  GKKPWRQKGTGRARAGSTRSPLWRGGAVVHGPQPRDYTFKVNRKVRQLALRMALSAKLVE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           + ++++D +   E KTK +           ALI+   + D N +L+ARN+P I ++    
Sbjct: 121 DQLVLLDAIAFPEVKTKLMAKVVSDFSWKKALIVL-PESDNNLELSARNLPGIKVVRQDM 179

Query: 181 INVYDILRCSKLVLSKSAIEALEDRF 206
           +NVYD+L    +V+ K A   +++R 
Sbjct: 180 LNVYDVLLHDHVVMMKDAALKVQERL 205


>gi|296268551|ref|YP_003651183.1| 50S ribosomal protein L4/L1e [Thermobispora bispora DSM 43833]
 gi|296091338|gb|ADG87290.1| ribosomal protein L4/L1e [Thermobispora bispora DSM 43833]
          Length = 216

 Score =  108 bits (270), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 67/207 (32%), Positives = 108/207 (52%), Gaps = 7/207 (3%)

Query: 4   LSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSK 63
           + V + +G   G + + E+IF  K    ++ +V+  Q   +R G   +K R +V+  G K
Sbjct: 5   IDVLDANGAKAGTVELPEEIFGAKVNVPLMHQVVVAQLAARRQGTHATKTRGDVSGGGKK 64

Query: 64  MYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDI 123
            Y QKGTGRAR  S    QF GGG   GP P       PKK+++ ALR ALSD+     +
Sbjct: 65  PYRQKGTGRARQGSIRAPQFTGGGTVHGPQPRSYDQRTPKKMKAAALRGALSDRASCGRV 124

Query: 124 MVIDNLVSKEC-KTKYLVTRFRALDLSNALIIDGCQLDRNFQL---AARNIPNINLLPVQ 179
            V+ NL++ +  KTK  +   R +  +  +++    +D N +L   + RN+P ++LL   
Sbjct: 125 HVVTNLITGDTPKTKVALAALRKVTQAPRVLV---VVDENDELTWRSLRNVPEVHLLDAG 181

Query: 180 GINVYDILRCSKLVLSKSAIEALEDRF 206
            +N YD+L    +V ++ A E +  R 
Sbjct: 182 QLNTYDVLVNDDVVFTREAFEQVVARL 208


>gi|95931441|ref|ZP_01314147.1| ribosomal protein L4/L1e [Desulfuromonas acetoxidans DSM 684]
 gi|95132509|gb|EAT14202.1| ribosomal protein L4/L1e [Desulfuromonas acetoxidans DSM 684]
          Length = 206

 Score =  108 bits (270), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 109/204 (53%), Gaps = 3/204 (1%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M +++V ++         ++E +F  + +  ++  ++R+Q   +R G S  K R+ VA  
Sbjct: 1   MAKVTVYDMQKNQVSERELNEVVFDAEVRPYLVHDMVRYQLAARRQGTSACKNRAAVAGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTG AR  + +     GGG AFGP P      L +KV+ LAL  ALS +F  
Sbjct: 61  GKKPFKQKGTGNARQGTVTAPNHVGGGVAFGPTPRNYAFKLNRKVKKLALCSALSSRFQE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNAL-IIDGCQLDRNFQLAARNIPNINLLPVQ 179
             + V+  L      TK         +L +AL +ID    +   +L+ARN+ N+ +L   
Sbjct: 121 QKLTVLSELKLDSISTKSFKQVVDRFELKDALVVIDAANPE--VELSARNLRNVKVLRAD 178

Query: 180 GINVYDILRCSKLVLSKSAIEALE 203
           G+NVYD+++ S LVL++ A+E LE
Sbjct: 179 GVNVYDVMKYSNLVLTEGAVEQLE 202


>gi|297564038|ref|YP_003683011.1| ribosomal protein L4/L1e [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
 gi|296848487|gb|ADH70505.1| ribosomal protein L4/L1e [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
          Length = 223

 Score =  108 bits (270), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 62/201 (30%), Positives = 107/201 (53%), Gaps = 3/201 (1%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ V+N +G  KG + + + +FA +    ++ +V+  Q    R G   +K R +V   
Sbjct: 1   MAQIEVKNPEGGTKGSVELPDTVFAQQVSIPLIHQVVNAQLAAGRQGTHATKTRGDVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K Y QKGTGRAR  S    Q+ GGG   GP P       PKK+++ ALR ALSD+   
Sbjct: 61  GKKPYRQKGTGRARQGSIRAPQYTGGGTVHGPQPRDYSQRTPKKMKAAALRGALSDRARH 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRAL---DLSNALIIDGCQLDRNFQLAARNIPNINLLP 177
             I V+   V+++ ++K+  T  +AL     S+ +++   + D + + A RN+  +++L 
Sbjct: 121 GRIHVVSQFVAEDLESKFTQTALKALRQVTESDKVLVVLARDDEHNRRALRNVEEVHILD 180

Query: 178 VQGINVYDILRCSKLVLSKSA 198
              +N YD+L    +V +++ 
Sbjct: 181 ADQVNTYDVLYSDDVVFTEAG 201


>gi|319757242|gb|ADV69184.1| 50S ribosomal protein L4 [Streptococcus suis JS14]
          Length = 207

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 107/204 (52%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  +++ +  G+  G + +++ IF ++P Q ++  V+  Q    R G    K RS V+  
Sbjct: 1   MANVTLFDQTGKQAGEVVLNDAIFGIEPNQAVVFDVIISQRASLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FG  P    + LP+KVR LAL+   S+K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGVVFGTTPRSYAYKLPQKVRRLALKSVYSEKVAE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           N  + +++L     KT        AL + + +++   + +    L+ARNIP + +     
Sbjct: 121 NKFVAVNSLEFTAPKTAEFAKVLAALSIDSKVLVILEEGNEFAALSARNIPGVKVATATT 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
            +V DI    KL+++++AI  +E+
Sbjct: 181 ASVLDIANADKLLVTQAAISKIEE 204


>gi|317507410|ref|ZP_07965144.1| ribosomal protein L4/L1 family protein [Segniliparus rugosus ATCC
           BAA-974]
 gi|316254295|gb|EFV13631.1| ribosomal protein L4/L1 family protein [Segniliparus rugosus ATCC
           BAA-974]
          Length = 218

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 64/207 (30%), Positives = 103/207 (49%), Gaps = 1/207 (0%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           + +++   DG+  G   +  +IF       +L +V+  Q    R G  K+K R EV+  G
Sbjct: 3   LTVTIHAADGKSAGTFDLPAEIFDAPANISLLHQVVTAQLAAARQGTHKAKTRGEVSGGG 62

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K Y QKGTGRAR  S     F GGG   GPVP       PKK+++ ALR ALSD+    
Sbjct: 63  KKPYKQKGTGRARQGSTRAPHFTGGGTVHGPVPRDYSQRTPKKMKAAALRGALSDRARGE 122

Query: 122 DIMVIDNLVSKECKTKYLVTRF-RALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
            I ++D LV+ +  +    + F  ++ +   L++   + D     + RN+P+ ++L    
Sbjct: 123 RIHIVDELVAGQTPSTKKASAFLDSISIRPRLLVVLGRADEAGLKSVRNLPHAHILTPDQ 182

Query: 181 INVYDILRCSKLVLSKSAIEALEDRFK 207
           +N YD+L+   +V S  A+    +  K
Sbjct: 183 LNTYDVLKSDDIVFSLEALTTFIEHHK 209


>gi|332018616|gb|EGI59197.1| 39S ribosomal protein L4, mitochondrial [Acromyrmex echinatior]
          Length = 286

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 62/195 (31%), Positives = 103/195 (52%), Gaps = 3/195 (1%)

Query: 15  GVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGTGRAR 74
           G++++   I+A  P+  I+ + +RWQ   + +  + +K R+EV   G K + QKGTGRAR
Sbjct: 71  GLVTLHPHIYAAAPRIDIIHQNIRWQRMYRWVSYAHTKTRAEVRGGGRKPWPQKGTGRAR 130

Query: 75  HSSKSVSQFRGGGKAFGP-VPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNLVSKE 133
           H S     +RGGG A GP  P    + LP   R   L   LS K   +D+ ++D L    
Sbjct: 131 HGSIRSPLWRGGGVAHGPRSPTPHFYMLPFYTRIAGLTATLSVKLAQDDLHIVDELEIPT 190

Query: 134 CKTKYLVTRFRALDLSNA-LIIDGCQ-LDRNFQLAARNIPNINLLPVQGINVYDILRCSK 191
            +  Y+       +   + L++D    +  N  LA   I ++N++PV G+NVY +L+ + 
Sbjct: 191 SEPSYVEQLIEERNWGPSILLVDSYDIMPTNITLATDKIKHVNIMPVYGLNVYSMLKHNT 250

Query: 192 LVLSKSAIEALEDRF 206
           LVL++ A   +E++ 
Sbjct: 251 LVLTEKAARLIEEKL 265


>gi|329938231|ref|ZP_08287682.1| 50S ribosomal protein L4 [Streptomyces griseoaurantiacus M045]
 gi|329302720|gb|EGG46610.1| 50S ribosomal protein L4 [Streptomyces griseoaurantiacus M045]
          Length = 219

 Score =  108 bits (269), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 106/204 (51%), Gaps = 2/204 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFAL-KPQQGILARVLRWQSWRKRIGCSKSKGRSEVAY 59
           M  + + +  GE  G + +  +IF + K    ++ +V+  Q+   R G  K+K R EV  
Sbjct: 1   MSTVDILSPAGEKTGSVELPAEIFGVEKISIPLIHQVVVAQNAAARQGTHKTKRRGEVRG 60

Query: 60  TGSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFC 119
            G K Y QKGTGRAR  S    QF GGG   GP P       PKK+++ ALRHAL+D+  
Sbjct: 61  GGKKPYRQKGTGRARQGSTRAPQFAGGGVVHGPQPRDYSQRTPKKMKAAALRHALTDRAR 120

Query: 120 SNDIMVIDNLVSKE-CKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPV 178
            + I V+  +V  E   TK   T F  +     L++   + D    L+ARN+P +++L  
Sbjct: 121 HDRIHVVTGVVEGETASTKAARTLFGKISERKNLLLVIDRADEAAWLSARNLPQVHILEP 180

Query: 179 QGINVYDILRCSKLVLSKSAIEAL 202
             +N YD+L    +V +++A E+ 
Sbjct: 181 GQLNTYDVLVSDDVVFTQAAFESF 204


>gi|329117498|ref|ZP_08246215.1| 50S ribosomal protein L4 [Streptococcus parauberis NCFD 2020]
 gi|326907903|gb|EGE54817.1| 50S ribosomal protein L4 [Streptococcus parauberis NCFD 2020]
          Length = 207

 Score =  108 bits (269), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 106/204 (51%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + + +  G++   + ++E IF ++P + ++  V+  Q    R G    K RS V+  
Sbjct: 1   MANVKLFDQTGKEVSSVELNEAIFGIEPNESVVFDVVISQRASLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LP+KVR LAL+   S K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYGYKLPQKVRRLALKSVYSAKVAD 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
              + +++L     KT        AL + + +++   + +    L+ARN+PN+ +     
Sbjct: 121 EKFVAVESLSFAAPKTAEFAKVLSALSIDSKVLVIVEEGNEFAALSARNLPNVKVATATT 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
            +V DI+   KL+++K AI  +E+
Sbjct: 181 ASVLDIVNSDKLLVTKEAISTIEE 204


>gi|322410859|gb|EFY01767.1| 50S ribosomal protein L4 [Streptococcus dysgalactiae subsp.
           dysgalactiae ATCC 27957]
          Length = 207

 Score =  108 bits (269), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 106/204 (51%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + + +  G++   + +++ IF ++P + ++  V+  Q    R G    K RS V+  
Sbjct: 1   MANVKLFDQTGKEVSSVELNDAIFGIEPNESVVFDVVISQRASLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LP+KVR LAL+   S K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYGYKLPQKVRRLALKSVYSAKVAE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           +  + ++ L     KT        AL +   +++   + +    L+ARN+PN+ +     
Sbjct: 121 DKFVAVEGLSFAAPKTAEFAKVLSALGIDTKVLVLIEEGNEFAALSARNLPNVTVATAAT 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
            +V DI+   KL+++K AI A+E+
Sbjct: 181 ASVLDIVNADKLLVTKEAISAIEE 204


>gi|227832220|ref|YP_002833927.1| 50S ribosomal protein L4 [Corynebacterium aurimucosum ATCC 700975]
 gi|262183925|ref|ZP_06043346.1| 50S ribosomal protein L4 [Corynebacterium aurimucosum ATCC 700975]
 gi|254803728|sp|C3PKQ3|RL4_CORA7 RecName: Full=50S ribosomal protein L4
 gi|227453236|gb|ACP31989.1| 50S ribosomal protein L4 [Corynebacterium aurimucosum ATCC 700975]
          Length = 220

 Score =  108 bits (269), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 67/206 (32%), Positives = 103/206 (50%), Gaps = 3/206 (1%)

Query: 2   IELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTG 61
           ++L V+  DG+  G + +  ++F  +    ++ +V+  Q    R G  K+K R EV   G
Sbjct: 4   LKLDVQTADGKTNGTVELPAELFDTEASIALMHQVVNAQLAAARQGTHKTKTRGEVRGGG 63

Query: 62  SKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSN 121
            K + QKGTGRAR  S     + GGG   GPVP       PK++   AL  ALSD+  + 
Sbjct: 64  RKPFRQKGTGRARQGSIRAPHYTGGGTVHGPVPRDYSQRTPKRMIKAALYGALSDRARNE 123

Query: 122 DIMVIDNLVSKECKTKYLVTRF--RALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
            I VI+ LV  +  +      F  R  D  N L++ G + D N + +A N+PN+ +L   
Sbjct: 124 RIHVIEELVPGQTPSTKQAKAFIERLTDRKNVLLVIGRE-DINARRSANNLPNVQILDAG 182

Query: 180 GINVYDILRCSKLVLSKSAIEALEDR 205
            +N YD+L    +V S  A+    +R
Sbjct: 183 QLNTYDVLYSDDVVFSVEALHTFVER 208


>gi|225869537|ref|YP_002745484.1| 50S ribosomal protein L4 [Streptococcus equi subsp. equi 4047]
 gi|254803754|sp|C0M6G6|RL4_STRE4 RecName: Full=50S ribosomal protein L4
 gi|225698941|emb|CAW91969.1| 50S ribosomal protein L4 [Streptococcus equi subsp. equi 4047]
          Length = 207

 Score =  108 bits (269), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 107/204 (52%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + + +  G++   + +++DIF ++P + ++  V+  Q    R G    K RS V+  
Sbjct: 1   MANVKLFDQTGKEVSTVELNDDIFGIEPNESVVFDVVISQRASLRQGTHAVKNRSAVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S    Q+RGGG  FGP P    + LP+KVR LAL+   S K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYGYKLPQKVRRLALKSVYSAKVAE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180
           +  + +++L     KT        AL +   +++   + +    L+ARN+PN+ +     
Sbjct: 121 DKFVAVESLSFAAPKTAEFAKVLSALSIDTKVLVLVEEGNEFAALSARNLPNVAVATAAT 180

Query: 181 INVYDILRCSKLVLSKSAIEALED 204
            +V DI+   KL+++K AI  +E+
Sbjct: 181 ASVLDIVNADKLLVTKEAISTIEE 204


>gi|330470172|ref|YP_004407915.1| 50S ribosomal protein L4 [Verrucosispora maris AB-18-032]
 gi|328813143|gb|AEB47315.1| 50S ribosomal protein L4 [Verrucosispora maris AB-18-032]
          Length = 216

 Score =  108 bits (269), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 66/201 (32%), Positives = 104/201 (51%), Gaps = 1/201 (0%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M  + V N +G   G + +  DIF ++    ++ +V+  Q    R G  K+K R EV+  
Sbjct: 1   MTTVDVLNSEGTKTGSVELPGDIFDVQANVPLMHQVVVAQLAAARQGTHKTKTRGEVSGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K Y QKGTGRAR  S    QF GGG   GPVP       PKK+++ ALR ALSD+  +
Sbjct: 61  GKKPYKQKGTGRARQGSIRAPQFAGGGVVHGPVPRDYSQRTPKKMKAAALRGALSDRARA 120

Query: 121 NDIMVIDNLVSKE-CKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQ 179
             + V++  VS E   TK  +     +  +  +++    +D    ++ RN P ++L+   
Sbjct: 121 GQVHVVEAFVSGEKPSTKAALAALTKVTEARRVLVVLSSVDELNWVSLRNEPRVHLIEAG 180

Query: 180 GINVYDILRCSKLVLSKSAIE 200
            +N YD+L    +V +K A++
Sbjct: 181 QLNTYDVLVADDVVFTKEALD 201


>gi|312622046|ref|YP_004023659.1| 50S ribosomal protein L4/L1e [Caldicellulosiruptor kronotskyensis
           2002]
 gi|312202513|gb|ADQ45840.1| ribosomal protein L4/L1e [Caldicellulosiruptor kronotskyensis 2002]
          Length = 208

 Score =  108 bits (269), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 70/208 (33%), Positives = 113/208 (54%), Gaps = 3/208 (1%)

Query: 1   MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60
           M ++ V N++G+  G I +++ IF +     +L + +      +R G   +K R+EV   
Sbjct: 1   MAKVPVYNIEGQQIGEIELNDSIFNVPINNHVLHQAVVAHLANRRQGTFAAKTRAEVRGG 60

Query: 61  GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120
           G K + QKGTGRAR  S     +R GG  F   P      LPKKV+ LAL+ ALS K   
Sbjct: 61  GRKPWRQKGTGRARQGSIRAPTWRKGGVVFAKKPRDFSIELPKKVKRLALKCALSSKVKE 120

Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSN--ALIIDGCQLDRNFQLAARNIPNINLLPV 178
           N+++V+D     + KTK ++   + L L N  ALI+   + +   Q + +NIP +  L V
Sbjct: 121 NNLIVLDRWDMNQYKTKEVLRVLKNLGLENQKALIVI-PEKNEYLQKSTKNIPEVKTLQV 179

Query: 179 QGINVYDILRCSKLVLSKSAIEALEDRF 206
             +NV+DIL+  K V+ + A++ +E+ +
Sbjct: 180 GNLNVFDILKYDKFVILQDAVKKVEEVY 207


>gi|225027479|ref|ZP_03716671.1| hypothetical protein EUBHAL_01735 [Eubacterium hallii DSM 3353]
 gi|224955214|gb|EEG36423.1| hypothetical protein EUBHAL_01735 [Eubacterium hallii DSM 3353]
          Length = 198

 Score =  108 bits (269), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 66/198 (33%), Positives = 104/198 (52%), Gaps = 1/198 (0%)

Query: 9   LDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQK 68
           ++G   G I +S+ IFA+   + +