RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780260|ref|YP_003064673.1| 50S ribosomal protein L4 [Candidatus Liberibacter asiaticus str. psy62] (207 letters) >gnl|CDD|144240 pfam00573, Ribosomal_L4, Ribosomal protein L4/L1 family. This family includes Ribosomal L4/L1 from eukaryotes and archaebacteria and L4 from eubacteria. L4 from yeast has been shown to bind rRNA. Length = 190 Score = 201 bits (514), Expect = 1e-52 Identities = 78/191 (40%), Positives = 113/191 (59%), Gaps = 3/191 (1%) Query: 17 ISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGTGRARHS 76 + + +F + + +L RV+ Q +R G + +K RSEV+ G K + QKGTGRAR Sbjct: 1 VELPPAVFGAEIRPDLLHRVVVAQLANRRQGTASTKTRSEVSGGGKKPWRQKGTGRARAG 60 Query: 77 SKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCSNDIMVIDNLVSKECKT 136 S +RGGG AFGP P + L KKVR LALR ALS K ++V+D+ + KT Sbjct: 61 SIRSPLWRGGGVAFGPKPRDYSYKLNKKVRRLALRSALSAKAREGKLVVVDDFELEIPKT 120 Query: 137 KYLVTRFRALDLSN--ALIIDGCQLDRNFQLAARNIPNINLLPVQGINVYDILRCSKLVL 194 K V + L L LI+ + D N L+ARN+P ++++ V G+NVYD+L K+V+ Sbjct: 121 KEAVKLLKNLGLKGKSVLIVVDEK-DENLYLSARNLPGVDVVTVDGLNVYDLLPADKVVI 179 Query: 195 SKSAIEALEDR 205 +KSA+E LE+R Sbjct: 180 TKSALEKLEER 190 >gnl|CDD|30437 COG0088, RplD, Ribosomal protein L4 [Translation, ribosomal structure and biogenesis]. Length = 214 Score = 176 bits (449), Expect = 3e-45 Identities = 80/211 (37%), Positives = 116/211 (54%), Gaps = 4/211 (1%) Query: 1 MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60 M++L V +LDGE+ G + + ++F + + ++ R + Q +R G +K R EV+ Sbjct: 1 MMKLKVYDLDGEEVGEVELLPEVFGPERNEDLIHRAVLAQLANRRQGTHSTKTRGEVSGG 60 Query: 61 GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVH-ALPKKVRSLALRHALSDKFC 119 G K + QKGTGRAR S Q+RGGG A GP P L KK R LALR ALS K Sbjct: 61 GKKPWGQKGTGRARQGSIRSPQWRGGGVAHGPKPERDYSQKLNKKERRLALRSALSAKAR 120 Query: 120 SNDIMVIDNL-VSKECKTKYLVTRFRALDLSN-ALIIDGCQLDRNFQLAARNIPNIN-LL 176 + ++V+ KTK LV + L L L+I + D N +L+ARN+ N+ +L Sbjct: 121 AGKLVVVRGHVFEDAPKTKELVEFLKKLGLDVKRLLIVKGERDGNGKLSARNLKNVKVVL 180 Query: 177 PVQGINVYDILRCSKLVLSKSAIEALEDRFK 207 V G+ V D+LR KLV++K A +E+R Sbjct: 181 VVGGLPVVDVLRADKLVITKLAPGKIEERLT 211 >gnl|CDD|36837 KOG1624, KOG1624, KOG1624, Mitochondrial/chloroplast ribosomal protein L4 [Translation, ribosomal structure and biogenesis]. Length = 290 Score = 164 bits (415), Expect = 2e-41 Identities = 80/207 (38%), Positives = 117/207 (56%), Gaps = 4/207 (1%) Query: 4 LSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYTGSK 63 + + E G++ + D+FA P++ IL R + WQ +R+G + +K R+EV G K Sbjct: 56 EPLDFFELEKVGLVDLHPDVFAEPPRRDILHRAVVWQLDNRRVGTASTKTRAEVRGGGRK 115 Query: 64 MYVQKGTGRARHSSKSVSQFRGGGKAFGP-VPIIGVHALPKKVRSLALRHALSDKFCSND 122 + QKGTGRAR S Q RGGG A GP P + LP KVRSL L+ ALS K +D Sbjct: 116 PWPQKGTGRARVGSLRSPQRRGGGVAHGPRGPRDYSYKLPSKVRSLGLKIALSAKLAQDD 175 Query: 123 IMVIDNLVSKECKTKYLVTRFRALDLS-NALIIDGC--QLDRNFQLAARNIPNINLLPVQ 179 + ++D L K KYL+ + + L +D + D N LA+R + +NL+PV Sbjct: 176 LHIVDELGLPTGKPKYLLNLLAQRNWGTSVLFVDEDHFEFDENLALASRRLGYLNLIPVG 235 Query: 180 GINVYDILRCSKLVLSKSAIEALEDRF 206 G+NV+ IL+ LVL++ A+E LE+R Sbjct: 236 GLNVFSILKHDTLVLTREAVEFLEERL 262 >gnl|CDD|177068 CHL00147, rpl4, ribosomal protein L4; Validated. Length = 215 Score = 99.3 bits (248), Expect = 6e-22 Identities = 68/214 (31%), Positives = 110/214 (51%), Gaps = 16/214 (7%) Query: 2 IELSVRNLDGEDKGVISVSEDIFALKPQQG----ILARVLRWQSWRKRIGCSKSKGRSEV 57 + V +L G++K L + +L R L Q+ +R G + +K RSEV Sbjct: 7 LNYPVIDLTGKEKS----ETIKLKLNVLEKSGNYLLHRALVRQNNNQRQGTASTKTRSEV 62 Query: 58 AYTGSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDK 117 G K + QKGTGRAR S ++GGG FGP P + L KK R LALR L +K Sbjct: 63 RGGGRKPWKQKGTGRARAGSNRSPLWKGGGVIFGPKPKTYSNKLNKKERRLALRTLLYNK 122 Query: 118 FCSNDIMVIDNLVS--KECKTKYLVTRFRALDLS---NALIIDGCQLDRNFQLAARNIPN 172 SN+I V++N S KTK + + L+++ LII + N L+ RN+ N Sbjct: 123 --SNNITVVENFESSITNPKTKAFINLLKKLNINLDQKILIIVP-EKTENLYLSTRNLKN 179 Query: 173 INLLPVQGINVYDILRCSKLVLSKSAIEALEDRF 206 + L+ +N+ +L+ +++++K A++ +E+ + Sbjct: 180 VELISADTLNIKSLLKAKQIIITKEALKIIEEVY 213 >gnl|CDD|173842 cd01153, ACAD_fadE5, Putative acyl-CoA dehydrogenases similar to fadE5. Putative acyl-CoA dehydrogenase (ACAD). Mitochondrial acyl-CoA dehydrogenases (ACAD) catalyze the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. The mitochondrial ACD's are generally homotetramers and have an active site glutamate at a conserved position. Length = 407 Score = 28.9 bits (65), Expect = 0.93 Identities = 20/72 (27%), Positives = 26/72 (36%), Gaps = 15/72 (20%) Query: 43 RKRIGCSKSKGRSEVAYTGSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALP 102 R +G + G +E AY + Y +K Q KA V II H P Sbjct: 249 RLGVGT-QGTGLAEAAYLNALAY-----------AKERKQGGDLIKAAPAVTII-HH--P 293 Query: 103 KKVRSLALRHAL 114 RSL + A Sbjct: 294 DVRRSLMTQKAY 305 >gnl|CDD|163630 cd07387, MPP_PolD2_C, PolD2 (DNA polymerase delta, subunit 2), C-terminal domain. PolD2 (DNA polymerase delta, subunit 2) is an auxiliary subunit of the eukaryotic DNA polymerase delta (PolD) complex thought to play a regulatory role and to serve as a scaffold for PolD assembly by interacting simultaneously with all of the other three subunits. PolD2 is catalytically inactive and lacks the active site residues required for phosphoesterase activity in other members of this superfamily. PolD2 is also involved in the recruitment of several proteins regulating DNA metabolism, including p21, PDIP1, PDIP38, PDIP46, and WRN. Human PolD consists of four subunits: p125 (PolD1), p50 (PolD2), p66(PolD3), and p12(PolD4). PolD is one of three major replicases in eukaryotes. PolD also plays an essential role in translesion DNA synthesis, homologous recombination, and DNA repair. Within the PolD complex, PolD2 tightly associates with PolD3. PolD2 belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 257 Score = 28.0 bits (63), Expect = 1.7 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 3/34 (8%) Query: 170 IPNINLLPVQGINVYDILRCSKLVLSKSAIEALE 203 I + +L G NV DIL+ S L +S ++ LE Sbjct: 141 IDGVRVLGTSGQNVDDILKYSSL---ESRLDILE 171 >gnl|CDD|173952 cd08193, HVD, 5-hydroxyvalerate dehydrogenase (HVD) catalyzes the oxidation of 5-hydroxyvalerate to 5-oxovalerate with NAD+ as cofactor. 5-hydroxyvalerate dehydrogenase (HVD) is an iron-containing (type III) NAD-dependent alcohol dehydrogenase. It plays a role in the cyclopentanol metabolism biochemical pathway. It catalyzes the oxidation of 5-hydroxyvalerate to 5-oxovalerate with NAD+ as cofactor. This cyclopentanol (cpn) degradation pathway is present in some bacteria which can use cyclopentanol as sole carbon source. In Comamonas sp. strain NCIMB 9872, this enzyme is encoded by the CpnD gene. Length = 376 Score = 27.5 bits (62), Expect = 2.8 Identities = 8/16 (50%), Positives = 10/16 (62%) Query: 86 GGKAFGPVPIIGVHAL 101 G+AF P+ VHAL Sbjct: 245 AGQAFANAPVAAVHAL 260 >gnl|CDD|36161 KOG0943, KOG0943, KOG0943, Predicted ubiquitin-protein ligase/hyperplastic discs protein, HECT superfamily [Posttranslational modification, protein turnover, chaperones]. Length = 3015 Score = 27.1 bits (59), Expect = 3.9 Identities = 11/71 (15%), Positives = 18/71 (25%), Gaps = 9/71 (12%) Query: 35 RVLRWQSWRKRIGCSKSKGRSEVAYTGSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVP 94 Q+ G S S A + + GR S P Sbjct: 131 LAAAGQAGVGGSGGGNSGRSSAGARDSRRATRRIRGGRDLGEGLLGSL---------GAP 181 Query: 95 IIGVHALPKKV 105 I +P+++ Sbjct: 182 RIPASNIPEEL 192 >gnl|CDD|153203 cd04931, ACT_PAH, ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH). ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH). PAH catalyzes the hydroxylation of L-Phe to L-Tyr, the first step in the catabolic degradation of L-Phe. In PAH, an autoregulatory sequence, N-terminal of the ACT domain, extends across the catalytic domain active site and regulates the enzyme by intrasteric regulation. It appears that the activation by L-Phe induces a conformational change that converts the enzyme to a high-affinity and high-activity state. Modulation of activity is achieved through inhibition by BH4 and activation by phosphorylation of serine residues of the autoregulatory region. The molecular basis for the cooperative activation process is not fully understood yet. Members of this CD belong to the superfamily of ACT regulatory domains. Length = 90 Score = 26.3 bits (58), Expect = 6.7 Identities = 14/24 (58%), Positives = 18/24 (75%), Gaps = 3/24 (12%) Query: 15 GVISVSEDIFALKPQQGILARVLR 38 GVIS+ IF+LK + G LA+VLR Sbjct: 13 GVISL---IFSLKEEVGALAKVLR 33 >gnl|CDD|48434 cd00728, malate_synt_G, Malate synthase G (MSG), monomeric enzyme present in some bacteria. In general, malate synthase catalyzes the Claisen condensation of glyoxylate and acetyl-CoA to malyl-CoA , which hydrolyzes to malate and CoA. This reaction is part of the glyoxylate cycle, which allows certain organisms to derive their carbon requirements from two-carbon compounds, by bypassing the two carboxylation steps of the citric acid cycle.. Length = 712 Score = 26.0 bits (57), Expect = 7.0 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 2/21 (9%) Query: 30 QGILARVLRWQSWRKRIGCSK 50 QGIL V+RW + IGCSK Sbjct: 593 QGILGYVVRWVD--QGIGCSK 611 >gnl|CDD|37454 KOG2243, KOG2243, KOG2243, Ca2+ release channel (ryanodine receptor) [Signal transduction mechanisms]. Length = 5019 Score = 25.8 bits (56), Expect = 9.0 Identities = 14/45 (31%), Positives = 20/45 (44%) Query: 156 GCQLDRNFQLAARNIPNINLLPVQGINVYDILRCSKLVLSKSAIE 200 GC L L A+ P+I P++G D LR + +S E Sbjct: 2283 GCGLQSCPMLLAKGYPDIGWNPIEGERYLDFLRFAVFCNGESVEE 2327 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.321 0.137 0.397 Gapped Lambda K H 0.267 0.0746 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,382,109 Number of extensions: 116408 Number of successful extensions: 234 Number of sequences better than 10.0: 1 Number of HSP's gapped: 223 Number of HSP's successfully gapped: 14 Length of query: 207 Length of database: 6,263,737 Length adjustment: 89 Effective length of query: 118 Effective length of database: 4,340,536 Effective search space: 512183248 Effective search space used: 512183248 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 55 (24.9 bits)