BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780260|ref|YP_003064673.1| 50S ribosomal protein L4 [Candidatus Liberibacter asiaticus str. psy62] (207 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780260|ref|YP_003064673.1| 50S ribosomal protein L4 [Candidatus Liberibacter asiaticus str. psy62] Length = 207 Score = 422 bits (1085), Expect = e-120, Method: Compositional matrix adjust. Identities = 207/207 (100%), Positives = 207/207 (100%) Query: 1 MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60 MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT Sbjct: 1 MIELSVRNLDGEDKGVISVSEDIFALKPQQGILARVLRWQSWRKRIGCSKSKGRSEVAYT 60 Query: 61 GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120 GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS Sbjct: 61 GSKMYVQKGTGRARHSSKSVSQFRGGGKAFGPVPIIGVHALPKKVRSLALRHALSDKFCS 120 Query: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG Sbjct: 121 NDIMVIDNLVSKECKTKYLVTRFRALDLSNALIIDGCQLDRNFQLAARNIPNINLLPVQG 180 Query: 181 INVYDILRCSKLVLSKSAIEALEDRFK 207 INVYDILRCSKLVLSKSAIEALEDRFK Sbjct: 181 INVYDILRCSKLVLSKSAIEALEDRFK 207 >gi|254780917|ref|YP_003065330.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 596 Score = 21.9 bits (45), Expect = 7.7, Method: Compositional matrix adjust. Identities = 9/18 (50%), Positives = 13/18 (72%) Query: 91 GPVPIIGVHALPKKVRSL 108 GP+ I+GV L K+VR + Sbjct: 183 GPLCILGVRILVKRVRHI 200 >gi|254780163|ref|YP_003064576.1| ATP-dependent Clp protease ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 798 Score = 21.9 bits (45), Expect = 8.0, Method: Compositional matrix adjust. Identities = 10/25 (40%), Positives = 15/25 (60%) Query: 135 KTKYLVTRFRALDLSNALIIDGCQL 159 K K LV RF+ +D+S I D ++ Sbjct: 351 KDKALVRRFQKIDVSEPSIEDAIEI 375 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.321 0.137 0.397 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 126,510 Number of Sequences: 1233 Number of extensions: 4904 Number of successful extensions: 14 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 8 Number of HSP's gapped (non-prelim): 7 length of query: 207 length of database: 328,796 effective HSP length: 70 effective length of query: 137 effective length of database: 242,486 effective search space: 33220582 effective search space used: 33220582 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 36 (18.5 bits)