HHsearch alignment for GI: 254780262 and conserved domain: PRK12271

>PRK12271 rps10p 30S ribosomal protein S10P; Reviewed.
Probab=100.00  E-value=1.1e-38  Score=246.71  Aligned_cols=98  Identities=28%  Similarity=0.460  Sum_probs=95.6

Q ss_pred             EEEEEEEEEECHHHHHHHHHHHHHHHHHHCCEECCCCCCCCEEEEEEEECCCCCC-CCCHHHHHEEEEEEEEEEECCCHH
Q ss_conf             4899999971688999999999999997188011564898213699873067898-631423522334457879769989
Q gi|254780262|r    6 IRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD-KKSRDQLEMRIYKRLLYIIKPTPQ   84 (104)
Q Consensus         6 ~kirIkl~s~d~~~Ld~~~~~i~~~a~~~g~~v~GpipLPtk~~~~tvlrSPhv~-KksreqfE~r~hkRlI~i~~~~~~   84 (104)
T Consensus         2 qkiRIkL~S~d~~~Ld~~~~~I~~~ak~tg~~v~GPipLPTk~~~~tv~rSPh~~~k~sre~fE~RiHKRlIdi-~~~~~   80 (102)
T PRK12271          2 QKARIRLSGTNPEDLDGVCNQIKEIAEKTGVKMSGPIPLPTKRLVVPTRKSPDGEGTATWDHWEMRVHKRLIDI-DADER   80 (102)
T ss_pred             CEEEEEEEECCHHHHHHHHHHHHHHHHHCCCEEECCCCCCCCEEEEEEEECCCCCCCCCHHHEEEEEEEEEEEE-CCCHH
T ss_conf             43999999778889999999999999973997856526998358985442787589853555387877799983-19889


Q ss_pred             HHHHHHCCCCCCCCEEEEEC
Q ss_conf             99998647899984589989
Q gi|254780262|r   85 TVDALMKLDIAAGVNVVIKL  104 (104)
Q Consensus        85 ~~~~l~~~~lp~gV~i~i~~  104 (104)
T Consensus        81 ~v~~l~~l~lp~gV~ieik~  100 (102)
T PRK12271         81 ALRQLMRIRVPDDVQIEIEL  100 (102)
T ss_pred             HHHHHHCCCCCCCCEEEEEE
T ss_conf             99998678899996899999