BLAST/PSIBLAST alignment of GI: 254780262 and GI: 154245622 at iteration 1
>gi|154245622|ref|YP_001416580.1| ribosomal protein S10 [Xanthobacter autotrophicus Py2] Length = 102
>gi|158424179|ref|YP_001525471.1| 30S ribosomal protein S10 [Azorhizobium caulinodans ORS 571] Length = 102
>gi|172047986|sp|A8IAS9|RS10_AZOC5 RecName: Full=30S ribosomal protein S10 Length = 102
>gi|226708310|sp|A7IFY0|RS10_XANP2 RecName: Full=30S ribosomal protein S10 Length = 102
>gi|154159707|gb|ABS66923.1| ribosomal protein S10 [Xanthobacter autotrophicus Py2] Length = 102
>gi|158331068|dbj|BAF88553.1| ribosomal protein S10 [Azorhizobium caulinodans ORS 571] Length = 102
 Score =  147 bits (371), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 85/104 (81%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD RILD+S REIV T K++G+Q+ GPIP P  I +FTVNRSPH+D
Sbjct: 1   MNGQNIRIR--LKAFDHRILDASTREIVATAKRTGAQVRGPIPLPTRIEKFTVNRSPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q EMR +KRLL I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 59  KKSREQFEMRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKL 102