BLAST/PSIBLAST alignment of GI: 254780262 and GI: 299135258 at iteration 1
>gi|299135258|ref|ZP_07028449.1| ribosomal protein S10 [Afipia sp. 1NLS2] Length = 110
>gi|298590235|gb|EFI50439.1| ribosomal protein S10 [Afipia sp. 1NLS2] Length = 110
 Score =  148 bits (373), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 85/104 (81%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD RILD+S REIV T K++G+Q+ GPIP P  I +FTVNRSPHVD
Sbjct: 9   MNGQNIRIR--LKAFDHRILDTSTREIVNTAKRTGAQVRGPIPLPTRIEKFTVNRSPHVD 66

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q EMR +KRLL I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 67  KKSREQFEMRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKL 110