BLAST/PSIBLAST alignment of GI: 254780262 and GI: 300022540 at iteration 1
>gi|300022540|ref|YP_003755151.1| ribosomal protein S10 [Hyphomicrobium denitrificans ATCC 51888] Length = 102
>gi|299524361|gb|ADJ22830.1| ribosomal protein S10 [Hyphomicrobium denitrificans ATCC 51888] Length = 102
 Score =  146 bits (368), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 85/104 (81%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD RILD+S REIV T K++G+++ GPIP P  I RFTVNRSPH+D
Sbjct: 1   MHGQNIRIR--LKAFDHRILDASTREIVNTAKRTGAEVRGPIPLPTRIERFTVNRSPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q EMR +KRLL I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 59  KKSREQFEMRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKL 102