BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780262|ref|YP_003064675.1| 30S ribosomal protein S10
[Candidatus Liberibacter asiaticus str. psy62]
         (104 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done


Results from round 1


>gi|254780262|ref|YP_003064675.1| 30S ribosomal protein S10 [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254039939|gb|ACT56735.1| 30S ribosomal protein S10 [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 104

 Score =  209 bits (533), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 104/104 (100%), Positives = 104/104 (100%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD
Sbjct: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL
Sbjct: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104


>gi|315122819|ref|YP_004063308.1| 30S ribosomal protein S10 [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313496221|gb|ADR52820.1| 30S ribosomal protein S10 [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 104

 Score =  175 bits (444), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 89/104 (85%), Positives = 96/104 (92%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           MTS+NIRI I LKAFDS ILD+S+REIV T KKSGS+IVGPIPFPRSIRRFTVNRSPHVD
Sbjct: 1   MTSQNIRIRISLKAFDSWILDASVREIVSTAKKSGSRIVGPIPFPRSIRRFTVNRSPHVD 60

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSRDQLE+RI+KRLLYIIKPT  TV ALMKLDIAAGV+VVIKL
Sbjct: 61  KKSRDQLEIRIHKRLLYIIKPTQDTVAALMKLDIAAGVSVVIKL 104


>gi|90424938|ref|YP_533308.1| 30S ribosomal protein S10 [Rhodopseudomonas palustris BisB18]
 gi|118597198|sp|Q211E7|RS10_RHOPB RecName: Full=30S ribosomal protein S10
 gi|90106952|gb|ABD88989.1| SSU ribosomal protein S10P [Rhodopseudomonas palustris BisB18]
          Length = 102

 Score =  148 bits (373), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 85/104 (81%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD RILDSS REIV T K++G+Q+ GPIP P  I +FTVNRSPHVD
Sbjct: 1   MNGQNIRIR--LKAFDHRILDSSTREIVNTAKRTGAQVRGPIPLPTRIEKFTVNRSPHVD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q EMR +KRLL I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 59  KKSREQFEMRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKL 102


>gi|299135258|ref|ZP_07028449.1| ribosomal protein S10 [Afipia sp. 1NLS2]
 gi|298590235|gb|EFI50439.1| ribosomal protein S10 [Afipia sp. 1NLS2]
          Length = 110

 Score =  148 bits (373), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 85/104 (81%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD RILD+S REIV T K++G+Q+ GPIP P  I +FTVNRSPHVD
Sbjct: 9   MNGQNIRIR--LKAFDHRILDTSTREIVNTAKRTGAQVRGPIPLPTRIEKFTVNRSPHVD 66

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q EMR +KRLL I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 67  KKSREQFEMRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKL 110


>gi|170738704|ref|YP_001767359.1| 30S ribosomal protein S10 [Methylobacterium sp. 4-46]
 gi|220921898|ref|YP_002497199.1| 30S ribosomal protein S10 [Methylobacterium nodulans ORS 2060]
 gi|226705594|sp|B0UHX0|RS10_METS4 RecName: Full=30S ribosomal protein S10
 gi|254809972|sp|B8IS84|RS10_METNO RecName: Full=30S ribosomal protein S10
 gi|168192978|gb|ACA14925.1| ribosomal protein S10 [Methylobacterium sp. 4-46]
 gi|219946504|gb|ACL56896.1| ribosomal protein S10 [Methylobacterium nodulans ORS 2060]
          Length = 102

 Score =  147 bits (372), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 85/104 (81%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD RILDSS REIV T K++G+Q+ GPIP P  I RFTVNRSPH+D
Sbjct: 1   MNGQNIRIR--LKAFDHRILDSSTREIVSTAKRTGAQVRGPIPLPTRIERFTVNRSPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q EMR +KR+L I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 59  KKSREQFEMRTHKRVLDIVDPTPQTVDALMKLDLAAGVDVEIKL 102


>gi|298291437|ref|YP_003693376.1| ribosomal protein S10 [Starkeya novella DSM 506]
 gi|296927948|gb|ADH88757.1| ribosomal protein S10 [Starkeya novella DSM 506]
          Length = 102

 Score =  147 bits (371), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 85/104 (81%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD RILD+S REIV T K++G+Q+ GPIP P  I +FTVNRSPHVD
Sbjct: 1   MNGQNIRIR--LKAFDHRILDASTREIVSTAKRTGAQVRGPIPLPTRIEKFTVNRSPHVD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q EMR +KRLL I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 59  KKSREQFEMRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKL 102


>gi|154245622|ref|YP_001416580.1| ribosomal protein S10 [Xanthobacter autotrophicus Py2]
 gi|158424179|ref|YP_001525471.1| 30S ribosomal protein S10 [Azorhizobium caulinodans ORS 571]
 gi|172047986|sp|A8IAS9|RS10_AZOC5 RecName: Full=30S ribosomal protein S10
 gi|226708310|sp|A7IFY0|RS10_XANP2 RecName: Full=30S ribosomal protein S10
 gi|154159707|gb|ABS66923.1| ribosomal protein S10 [Xanthobacter autotrophicus Py2]
 gi|158331068|dbj|BAF88553.1| ribosomal protein S10 [Azorhizobium caulinodans ORS 571]
          Length = 102

 Score =  147 bits (371), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 85/104 (81%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD RILD+S REIV T K++G+Q+ GPIP P  I +FTVNRSPH+D
Sbjct: 1   MNGQNIRIR--LKAFDHRILDASTREIVATAKRTGAQVRGPIPLPTRIEKFTVNRSPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q EMR +KRLL I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 59  KKSREQFEMRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKL 102


>gi|27380512|ref|NP_772041.1| 30S ribosomal protein S10 [Bradyrhizobium japonicum USDA 110]
 gi|39936314|ref|NP_948590.1| 30S ribosomal protein S10 [Rhodopseudomonas palustris CGA009]
 gi|75675555|ref|YP_317976.1| 30S ribosomal protein S10 [Nitrobacter winogradskyi Nb-255]
 gi|85715132|ref|ZP_01046116.1| 30S ribosomal protein S10 [Nitrobacter sp. Nb-311A]
 gi|86749414|ref|YP_485910.1| 30S ribosomal protein S10 [Rhodopseudomonas palustris HaA2]
 gi|91977653|ref|YP_570312.1| 30S ribosomal protein S10 [Rhodopseudomonas palustris BisB5]
 gi|92117097|ref|YP_576826.1| 30S ribosomal protein S10 [Nitrobacter hamburgensis X14]
 gi|115525586|ref|YP_782497.1| 30S ribosomal protein S10 [Rhodopseudomonas palustris BisA53]
 gi|146340056|ref|YP_001205104.1| 30S ribosomal protein S10 [Bradyrhizobium sp. ORS278]
 gi|148256393|ref|YP_001240978.1| 30S ribosomal protein S10 [Bradyrhizobium sp. BTAi1]
 gi|192292038|ref|YP_001992643.1| 30S ribosomal protein S10 [Rhodopseudomonas palustris TIE-1]
 gi|316933526|ref|YP_004108508.1| 30S ribosomal protein S10 [Rhodopseudomonas palustris DX-1]
 gi|44888478|sp|Q89J83|RS10_BRAJA RecName: Full=30S ribosomal protein S10
 gi|50401432|sp|Q6N4T6|RS10_RHOPA RecName: Full=30S ribosomal protein S10; AltName: Full=RRP-S10
 gi|115305638|sp|Q3SSW7|RS10_NITWN RecName: Full=30S ribosomal protein S10
 gi|118597189|sp|Q1QN31|RS10_NITHX RecName: Full=30S ribosomal protein S10
 gi|118597197|sp|Q2IXR1|RS10_RHOP2 RecName: Full=30S ribosomal protein S10
 gi|122295407|sp|Q07KL7|RS10_RHOP5 RecName: Full=30S ribosomal protein S10
 gi|123748929|sp|Q134S8|RS10_RHOPS RecName: Full=30S ribosomal protein S10
 gi|166231243|sp|A5ELM8|RS10_BRASB RecName: Full=30S ribosomal protein S10
 gi|166231244|sp|A4YSJ1|RS10_BRASO RecName: Full=30S ribosomal protein S10
 gi|226705616|sp|B3QBY1|RS10_RHOPT RecName: Full=30S ribosomal protein S10
 gi|27353676|dbj|BAC50666.1| 30S ribosomal protein S10 [Bradyrhizobium japonicum USDA 110]
 gi|39650169|emb|CAE28692.1| 30S ribosomal protein S10 [Rhodopseudomonas palustris CGA009]
 gi|74420425|gb|ABA04624.1| SSU ribosomal protein S10P [Nitrobacter winogradskyi Nb-255]
 gi|85698047|gb|EAQ35920.1| 30S ribosomal protein S10 [Nitrobacter sp. Nb-311A]
 gi|86572442|gb|ABD06999.1| SSU ribosomal protein S10P [Rhodopseudomonas palustris HaA2]
 gi|91684109|gb|ABE40411.1| SSU ribosomal protein S10P [Rhodopseudomonas palustris BisB5]
 gi|91799991|gb|ABE62366.1| SSU ribosomal protein S10P [Nitrobacter hamburgensis X14]
 gi|115519533|gb|ABJ07517.1| SSU ribosomal protein S10P [Rhodopseudomonas palustris BisA53]
 gi|146192862|emb|CAL76867.1| 30S ribosomal subunit protein S10 [Bradyrhizobium sp. ORS278]
 gi|146408566|gb|ABQ37072.1| SSU ribosomal protein S10P [Bradyrhizobium sp. BTAi1]
 gi|192285787|gb|ACF02168.1| ribosomal protein S10 [Rhodopseudomonas palustris TIE-1]
 gi|315601240|gb|ADU43775.1| ribosomal protein S10 [Rhodopseudomonas palustris DX-1]
          Length = 102

 Score =  147 bits (371), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 85/104 (81%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD RILD+S REIV T K++G+Q+ GPIP P  I +FTVNRSPHVD
Sbjct: 1   MNGQNIRIR--LKAFDHRILDTSTREIVNTAKRTGAQVRGPIPLPTRIEKFTVNRSPHVD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q EMR +KRLL I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 59  KKSREQFEMRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKL 102


>gi|209884812|ref|YP_002288669.1| ribosomal protein S10 [Oligotropha carboxidovorans OM5]
 gi|226705601|sp|B6JET2|RS10_OLICO RecName: Full=30S ribosomal protein S10
 gi|209873008|gb|ACI92804.1| ribosomal protein S10 [Oligotropha carboxidovorans OM5]
          Length = 102

 Score =  146 bits (369), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 85/104 (81%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD R+LD+S REIV T K++G+Q+ GPIP P  I +FTVNRSPHVD
Sbjct: 1   MNGQNIRIR--LKAFDHRVLDTSTREIVNTAKRTGAQVRGPIPLPTRIEKFTVNRSPHVD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q EMR +KRLL I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 59  KKSREQFEMRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKL 102


>gi|159184986|ref|NP_529842.1| 30S ribosomal protein S10 [Agrobacterium tumefaciens str. C58]
 gi|22096129|sp|Q8UE17|RS10_AGRT5 RecName: Full=30S ribosomal protein S10
 gi|17740400|gb|AAL42943.1| 30S ribosomal protein S10 [Agrobacterium tumefaciens str. C58]
          Length = 102

 Score =  146 bits (368), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 85/104 (81%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           MT +NIRI   LKAFD RILD+S REIV T K++G+ + GP+P P  I +FTVNRSPHVD
Sbjct: 1   MTGQNIRIR--LKAFDHRILDASTREIVSTAKRTGASVRGPVPLPTRIEKFTVNRSPHVD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q EMR +KRLL I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 59  KKSREQFEMRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKL 102


>gi|300022540|ref|YP_003755151.1| ribosomal protein S10 [Hyphomicrobium denitrificans ATCC 51888]
 gi|299524361|gb|ADJ22830.1| ribosomal protein S10 [Hyphomicrobium denitrificans ATCC 51888]
          Length = 102

 Score =  146 bits (368), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 85/104 (81%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD RILD+S REIV T K++G+++ GPIP P  I RFTVNRSPH+D
Sbjct: 1   MHGQNIRIR--LKAFDHRILDASTREIVNTAKRTGAEVRGPIPLPTRIERFTVNRSPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q EMR +KRLL I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 59  KKSREQFEMRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKL 102


>gi|254719292|ref|ZP_05181103.1| 30S ribosomal protein S10 [Brucella sp. 83/13]
 gi|265984292|ref|ZP_06097027.1| ribosomal protein S10 [Brucella sp. 83/13]
 gi|306838044|ref|ZP_07470902.1| ribosomal protein S10 [Brucella sp. NF 2653]
 gi|264662884|gb|EEZ33145.1| ribosomal protein S10 [Brucella sp. 83/13]
 gi|306406968|gb|EFM63189.1| ribosomal protein S10 [Brucella sp. NF 2653]
          Length = 102

 Score =  145 bits (366), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 85/104 (81%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD RILD+S REIVLT K++G+ + GPIP P  I +FTVNRSPH+D
Sbjct: 1   MNGQNIRIR--LKAFDHRILDASTREIVLTAKRTGANVRGPIPLPTRIEKFTVNRSPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q EMR +KRLL I+ PTPQTVDALMKLD++AGV+V IKL
Sbjct: 59  KKSREQFEMRTHKRLLDIVDPTPQTVDALMKLDLSAGVDVEIKL 102


>gi|83594021|ref|YP_427773.1| 30S ribosomal protein S10 [Rhodospirillum rubrum ATCC 11170]
 gi|118597199|sp|Q2RQV9|RS10_RHORT RecName: Full=30S ribosomal protein S10
 gi|83576935|gb|ABC23486.1| SSU ribosomal protein S10P [Rhodospirillum rubrum ATCC 11170]
          Length = 102

 Score =  145 bits (366), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 85/104 (81%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+NIRI   LKAFD R+LD S REIV T K++G+Q+ GPIP P  I +FTVNRSPH+D
Sbjct: 1   MESQNIRIR--LKAFDHRVLDQSTREIVSTAKRTGAQVRGPIPLPTRIEKFTVNRSPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q E+R +KRLL I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 59  KKSREQFEIRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKL 102


>gi|23014089|ref|ZP_00053926.1| COG0051: Ribosomal protein S10 [Magnetospirillum magnetotacticum
           MS-1]
 gi|162319785|ref|YP_422494.2| 30S ribosomal protein S10 [Magnetospirillum magneticum AMB-1]
 gi|115305625|sp|Q2W2J0|RS10_MAGMM RecName: Full=30S ribosomal protein S10
 gi|144900883|emb|CAM77747.1| 30S ribosomal protein S10 [Magnetospirillum gryphiswaldense MSR-1]
          Length = 102

 Score =  145 bits (365), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 85/104 (81%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+NIRI   LKAFD R+LD S REIV T K++G+Q+ GPIP P  I +FTVNRSPH+D
Sbjct: 1   MESQNIRIR--LKAFDHRVLDQSTREIVNTAKRTGAQVRGPIPLPSRIEKFTVNRSPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q E+R +KRLL I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 59  KKSREQFEIRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKL 102


>gi|90417764|ref|ZP_01225676.1| ribosomal protein S10 [Aurantimonas manganoxydans SI85-9A1]
 gi|90337436|gb|EAS51087.1| ribosomal protein S10 [Aurantimonas manganoxydans SI85-9A1]
          Length = 102

 Score =  144 bits (364), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 84/104 (80%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD R+LD+S REIV T K++G+ + GPIP P  I +FTVNRSPHVD
Sbjct: 1   MNGQNIRIR--LKAFDHRVLDASTREIVSTAKRTGANVRGPIPLPTRIEKFTVNRSPHVD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q EMR +KRLL I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 59  KKSREQFEMRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKL 102


>gi|304391452|ref|ZP_07373394.1| ribosomal protein S10 [Ahrensia sp. R2A130]
 gi|303295681|gb|EFL90039.1| ribosomal protein S10 [Ahrensia sp. R2A130]
          Length = 102

 Score =  144 bits (364), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 86/104 (82%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           MT +NIRI   LKAFD RILD+S +EIV T K++G+Q+ GP+P P  I R+TVNRSPHV+
Sbjct: 1   MTGQNIRIR--LKAFDHRILDTSAKEIVSTAKRTGAQVRGPVPLPTRIERYTVNRSPHVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KK+R+Q EMR +KRLL I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 59  KKAREQFEMRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKL 102


>gi|148260940|ref|YP_001235067.1| 30S ribosomal protein S10 [Acidiphilium cryptum JF-5]
 gi|326404338|ref|YP_004284420.1| 30S ribosomal protein S10 [Acidiphilium multivorum AIU301]
 gi|166231232|sp|A5FZW6|RS10_ACICJ RecName: Full=30S ribosomal protein S10
 gi|146402621|gb|ABQ31148.1| SSU ribosomal protein S10P [Acidiphilium cryptum JF-5]
 gi|325051200|dbj|BAJ81538.1| 30S ribosomal protein S10 [Acidiphilium multivorum AIU301]
          Length = 102

 Score =  144 bits (364), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 87/104 (83%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+NIRI   LKA+D R+LD+S REIV T K++G+Q+ GPIP P  I RFTVNRSPHVD
Sbjct: 1   MDSQNIRIR--LKAYDHRVLDNSTREIVNTAKRTGAQVRGPIPLPTHIERFTVNRSPHVD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q E+R ++RLL I++PTPQTVDALMKLD+AAGV+V IK+
Sbjct: 59  KKSREQFEIRTHRRLLDIVEPTPQTVDALMKLDLAAGVDVEIKI 102


>gi|82947071|dbj|BAE51935.1| Ribosomal protein S10 [Magnetospirillum magneticum AMB-1]
          Length = 125

 Score =  144 bits (364), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 85/104 (81%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+NIRI   LKAFD R+LD S REIV T K++G+Q+ GPIP P  I +FTVNRSPH+D
Sbjct: 24  MESQNIRIR--LKAFDHRVLDQSTREIVNTAKRTGAQVRGPIPLPSRIEKFTVNRSPHID 81

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q E+R +KRLL I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 82  KKSREQFEIRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKL 125


>gi|15965108|ref|NP_385461.1| 30S ribosomal protein S10 [Sinorhizobium meliloti 1021]
 gi|150396206|ref|YP_001326673.1| 30S ribosomal protein S10 [Sinorhizobium medicae WSM419]
 gi|227821755|ref|YP_002825725.1| 30S ribosomal protein S10 [Sinorhizobium fredii NGR234]
 gi|307314358|ref|ZP_07593964.1| ribosomal protein S10 [Sinorhizobium meliloti BL225C]
 gi|307322070|ref|ZP_07601446.1| ribosomal protein S10 [Sinorhizobium meliloti AK83]
 gi|325293337|ref|YP_004279201.1| 30S ribosomal protein S10 [Agrobacterium sp. H13-3]
 gi|20140128|sp|Q92QH1|RS10_RHIME RecName: Full=30S ribosomal protein S10
 gi|166231784|sp|A6U858|RS10_SINMW RecName: Full=30S ribosomal protein S10
 gi|254809980|sp|C3MAX9|RS10_RHISN RecName: Full=30S ribosomal protein S10
 gi|15074288|emb|CAC45934.1| Probable 30S ribosomal protein S10 [Sinorhizobium meliloti 1021]
 gi|150027721|gb|ABR59838.1| ribosomal protein S10 [Sinorhizobium medicae WSM419]
 gi|227340754|gb|ACP24972.1| 30S ribosomal protein S10 [Sinorhizobium fredii NGR234]
 gi|306892252|gb|EFN23062.1| ribosomal protein S10 [Sinorhizobium meliloti AK83]
 gi|306899056|gb|EFN29698.1| ribosomal protein S10 [Sinorhizobium meliloti BL225C]
 gi|325061190|gb|ADY64881.1| 30S ribosomal protein S10 [Agrobacterium sp. H13-3]
          Length = 102

 Score =  144 bits (364), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 84/104 (80%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD RILD+S REIV T K++G+ + GP+P P  I +FTVNRSPHVD
Sbjct: 1   MNGQNIRIR--LKAFDHRILDASTREIVSTAKRTGASVRGPVPLPTRIEKFTVNRSPHVD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q EMR +KRLL I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 59  KKSREQFEMRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKL 102


>gi|114704483|ref|ZP_01437391.1| 30S ribosomal protein S10 [Fulvimarina pelagi HTCC2506]
 gi|114539268|gb|EAU42388.1| 30S ribosomal protein S10 [Fulvimarina pelagi HTCC2506]
          Length = 102

 Score =  144 bits (363), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 84/104 (80%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD R+LD+S REIV T K++G+ + GPIP P  I +FTVNRSPH+D
Sbjct: 1   MNGQNIRIR--LKAFDHRVLDASTREIVSTAKRTGANVRGPIPLPTRIEKFTVNRSPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q EMR +KRLL I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 59  KKSREQFEMRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKL 102


>gi|222148365|ref|YP_002549322.1| 30S ribosomal protein S10 [Agrobacterium vitis S4]
 gi|254809570|sp|B9JVN6|RS10_AGRVS RecName: Full=30S ribosomal protein S10
 gi|221735353|gb|ACM36316.1| 30S ribosomal protein S10 [Agrobacterium vitis S4]
          Length = 102

 Score =  144 bits (362), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 84/104 (80%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD R+LD+S REIV T K++G+ + GP+P P  I +FTVNRSPHVD
Sbjct: 1   MNGQNIRIR--LKAFDHRVLDASTREIVSTAKRTGASVRGPVPLPTRIEKFTVNRSPHVD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q EMR +KRLL I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 59  KKSREQFEMRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKL 102


>gi|46203108|ref|ZP_00052062.2| COG0051: Ribosomal protein S10 [Magnetospirillum magnetotacticum
           MS-1]
 gi|163851584|ref|YP_001639627.1| ribosomal protein S10 [Methylobacterium extorquens PA1]
 gi|188581374|ref|YP_001924819.1| 30S ribosomal protein S10 [Methylobacterium populi BJ001]
 gi|218530393|ref|YP_002421209.1| 30S ribosomal protein S10 [Methylobacterium chloromethanicum CM4]
 gi|240138752|ref|YP_002963224.1| 30S ribosomal subunit protein S10 [Methylobacterium extorquens AM1]
 gi|254561352|ref|YP_003068447.1| 30S ribosomal subunit protein S10 [Methylobacterium extorquens DM4]
 gi|226705590|sp|A9W4Q0|RS10_METEP RecName: Full=30S ribosomal protein S10
 gi|226705592|sp|B1ZLK3|RS10_METPB RecName: Full=30S ribosomal protein S10
 gi|254809971|sp|B7L0R0|RS10_METC4 RecName: Full=30S ribosomal protein S10
 gi|163663189|gb|ABY30556.1| ribosomal protein S10 [Methylobacterium extorquens PA1]
 gi|179344872|gb|ACB80284.1| ribosomal protein S10 [Methylobacterium populi BJ001]
 gi|218522696|gb|ACK83281.1| ribosomal protein S10 [Methylobacterium chloromethanicum CM4]
 gi|240008721|gb|ACS39947.1| 30S ribosomal subunit protein S10 [Methylobacterium extorquens AM1]
 gi|254268630|emb|CAX24589.1| 30S ribosomal subunit protein S10 [Methylobacterium extorquens DM4]
          Length = 102

 Score =  144 bits (362), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 85/104 (81%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD RILD+S +EIV T +++G+QI GPIP P  I +FTVNRSPH+D
Sbjct: 1   MNGQNIRIR--LKAFDHRILDASTKEIVSTARRTGAQIRGPIPLPTHIEKFTVNRSPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q EMR +KR+L I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 59  KKSREQFEMRTHKRVLDIVDPTPQTVDALMKLDLAAGVDVEIKL 102


>gi|296533986|ref|ZP_06896502.1| 30S ribosomal protein S10 [Roseomonas cervicalis ATCC 49957]
 gi|296265652|gb|EFH11761.1| 30S ribosomal protein S10 [Roseomonas cervicalis ATCC 49957]
          Length = 102

 Score =  144 bits (362), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 85/104 (81%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+NIRI   LKAFD R+LD S REIV T K++G+++ GPIP P  I RFTVNRSPHVD
Sbjct: 1   MDSQNIRIR--LKAFDHRVLDGSTREIVNTAKRTGARVRGPIPLPTEIERFTVNRSPHVD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q E+R ++RLL I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 59  KKSREQFEIRTHRRLLDIVDPTPQTVDALMKLDLAAGVDVEIKL 102


>gi|86357304|ref|YP_469196.1| 30S ribosomal protein S10 [Rhizobium etli CFN 42]
 gi|116251539|ref|YP_767377.1| 30S ribosomal protein S10 [Rhizobium leguminosarum bv. viciae 3841]
 gi|190891354|ref|YP_001977896.1| 30S ribosomal protein S10 [Rhizobium etli CIAT 652]
 gi|209548934|ref|YP_002280851.1| 30S ribosomal protein S10 [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|218463387|ref|ZP_03503478.1| 30S ribosomal protein S10 [Rhizobium etli Kim 5]
 gi|218678067|ref|ZP_03525964.1| 30S ribosomal protein S10 [Rhizobium etli CIAT 894]
 gi|241204164|ref|YP_002975260.1| 30S ribosomal protein S10 [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|118597194|sp|Q2K9L7|RS10_RHIEC RecName: Full=30S ribosomal protein S10
 gi|118597195|sp|Q1MIE2|RS10_RHIL3 RecName: Full=30S ribosomal protein S10
 gi|226705613|sp|B3PWS0|RS10_RHIE6 RecName: Full=30S ribosomal protein S10
 gi|226705614|sp|B5ZYT4|RS10_RHILW RecName: Full=30S ribosomal protein S10
 gi|86281406|gb|ABC90469.1| 30S ribosomal protein S10 [Rhizobium etli CFN 42]
 gi|115256187|emb|CAK07268.1| putative 30S ribosomal protein S10 [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|190696633|gb|ACE90718.1| 30S ribosomal protein S10 [Rhizobium etli CIAT 652]
 gi|209534690|gb|ACI54625.1| ribosomal protein S10 [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|240858054|gb|ACS55721.1| ribosomal protein S10 [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|327191385|gb|EGE58411.1| 30S ribosomal protein S10 [Rhizobium etli CNPAF512]
          Length = 102

 Score =  144 bits (362), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 84/104 (80%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD RILD+S REIV T K++G+ + GP+P P  I +FTVNRSPH+D
Sbjct: 1   MNGQNIRIR--LKAFDHRILDASTREIVSTAKRTGASVRGPVPLPTRIEKFTVNRSPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q EMR +KRLL I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 59  KKSREQFEMRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKL 102


>gi|13470550|ref|NP_102119.1| 30S ribosomal protein S10 [Mesorhizobium loti MAFF303099]
 gi|260468555|ref|ZP_05813722.1| ribosomal protein S10 [Mesorhizobium opportunistum WSM2075]
 gi|319783319|ref|YP_004142795.1| ribosomal protein S10 [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|17865585|sp|Q98N58|RS10_RHILO RecName: Full=30S ribosomal protein S10
 gi|14021292|dbj|BAB47905.1| 30S ribosomal protein S10 [Mesorhizobium loti MAFF303099]
 gi|259028711|gb|EEW30020.1| ribosomal protein S10 [Mesorhizobium opportunistum WSM2075]
 gi|317169207|gb|ADV12745.1| ribosomal protein S10 [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 102

 Score =  143 bits (361), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 84/104 (80%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD R+LD+S +EIV T K++G+ + GPIP P  I +FTVNRSPHVD
Sbjct: 1   MNGQNIRIR--LKAFDHRVLDASTKEIVSTAKRTGANVRGPIPLPTRIEKFTVNRSPHVD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q EMR +KRLL I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 59  KKSREQFEMRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKL 102


>gi|182678336|ref|YP_001832482.1| 30S ribosomal protein S10 [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|226705401|sp|B2IK61|RS10_BEII9 RecName: Full=30S ribosomal protein S10
 gi|182634219|gb|ACB94993.1| ribosomal protein S10 [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 102

 Score =  143 bits (360), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 85/104 (81%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD RILD+S +EIV T K++G+Q+ GPIP P  I +FTVNRSPHVD
Sbjct: 1   MNGQNIRIR--LKAFDHRILDTSTKEIVSTAKRTGAQVRGPIPLPTKIEKFTVNRSPHVD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q E+R +KR+L I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 59  KKSREQFEIRTHKRVLDIVDPTPQTVDALMKLDLAAGVDVEIKL 102


>gi|49474405|ref|YP_032447.1| 30S ribosomal protein S10 [Bartonella quintana str. Toulouse]
 gi|49475795|ref|YP_033836.1| 30S ribosomal protein S10 [Bartonella henselae str. Houston-1]
 gi|54036352|sp|Q6FZC1|RS10_BARQU RecName: Full=30S ribosomal protein S10
 gi|54036354|sp|Q6G2W4|RS10_BARHE RecName: Full=30S ribosomal protein S10
 gi|49238602|emb|CAF27843.1| 30S ribosomal protein s10 [Bartonella henselae str. Houston-1]
 gi|49239909|emb|CAF26307.1| 30s ribosomal protein s10 [Bartonella quintana str. Toulouse]
          Length = 102

 Score =  143 bits (360), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 84/104 (80%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+NIRI   LKAFD RILD+S REIV T K++G+ + GPIP P  I +FTVNR PH+D
Sbjct: 1   MNSQNIRIR--LKAFDHRILDASTREIVSTAKRTGANVRGPIPLPTRIEKFTVNRGPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q EMR +KRLL I+ PTPQTVDALMKLD++AGV+V IKL
Sbjct: 59  KKSREQFEMRTHKRLLDIVDPTPQTVDALMKLDLSAGVDVEIKL 102


>gi|17987039|ref|NP_539673.1| 30S ribosomal protein S10 [Brucella melitensis bv. 1 str. 16M]
 gi|23502111|ref|NP_698238.1| 30S ribosomal protein S10 [Brucella suis 1330]
 gi|62290145|ref|YP_221938.1| 30S ribosomal protein S10 [Brucella abortus bv. 1 str. 9-941]
 gi|82700068|ref|YP_414642.1| 30S ribosomal protein S10 [Brucella melitensis biovar Abortus 2308]
 gi|148559874|ref|YP_001259154.1| 30S ribosomal protein S10 [Brucella ovis ATCC 25840]
 gi|153009285|ref|YP_001370500.1| 30S ribosomal protein S10 [Ochrobactrum anthropi ATCC 49188]
 gi|161619190|ref|YP_001593077.1| 30S ribosomal protein S10 [Brucella canis ATCC 23365]
 gi|163843500|ref|YP_001627904.1| 30S ribosomal protein S10 [Brucella suis ATCC 23445]
 gi|189024383|ref|YP_001935151.1| Ribosomal protein S10 [Brucella abortus S19]
 gi|225627704|ref|ZP_03785741.1| ribosomal protein S10 [Brucella ceti str. Cudo]
 gi|225852731|ref|YP_002732964.1| 30S ribosomal protein S10 [Brucella melitensis ATCC 23457]
 gi|237815653|ref|ZP_04594650.1| ribosomal protein S10 [Brucella abortus str. 2308 A]
 gi|239832123|ref|ZP_04680452.1| ribosomal protein S10 [Ochrobactrum intermedium LMG 3301]
 gi|254689454|ref|ZP_05152708.1| 30S ribosomal protein S10 [Brucella abortus bv. 6 str. 870]
 gi|254693939|ref|ZP_05155767.1| 30S ribosomal protein S10 [Brucella abortus bv. 3 str. Tulya]
 gi|254697589|ref|ZP_05159417.1| 30S ribosomal protein S10 [Brucella abortus bv. 2 str. 86/8/59]
 gi|254701975|ref|ZP_05163803.1| 30S ribosomal protein S10 [Brucella suis bv. 5 str. 513]
 gi|254704519|ref|ZP_05166347.1| 30S ribosomal protein S10 [Brucella suis bv. 3 str. 686]
 gi|254706585|ref|ZP_05168413.1| 30S ribosomal protein S10 [Brucella pinnipedialis M163/99/10]
 gi|254710305|ref|ZP_05172116.1| 30S ribosomal protein S10 [Brucella pinnipedialis B2/94]
 gi|254714302|ref|ZP_05176113.1| 30S ribosomal protein S10 [Brucella ceti M644/93/1]
 gi|254717739|ref|ZP_05179550.1| 30S ribosomal protein S10 [Brucella ceti M13/05/1]
 gi|254730483|ref|ZP_05189061.1| 30S ribosomal protein S10 [Brucella abortus bv. 4 str. 292]
 gi|256031799|ref|ZP_05445413.1| 30S ribosomal protein S10 [Brucella pinnipedialis M292/94/1]
 gi|256044884|ref|ZP_05447788.1| 30S ribosomal protein S10 [Brucella melitensis bv. 1 str. Rev.1]
 gi|256061314|ref|ZP_05451464.1| 30S ribosomal protein S10 [Brucella neotomae 5K33]
 gi|256113788|ref|ZP_05454592.1| 30S ribosomal protein S10 [Brucella melitensis bv. 3 str. Ether]
 gi|256159969|ref|ZP_05457687.1| 30S ribosomal protein S10 [Brucella ceti M490/95/1]
 gi|256255200|ref|ZP_05460736.1| 30S ribosomal protein S10 [Brucella ceti B1/94]
 gi|256257700|ref|ZP_05463236.1| 30S ribosomal protein S10 [Brucella abortus bv. 9 str. C68]
 gi|256263779|ref|ZP_05466311.1| ribosomal protein S10 [Brucella melitensis bv. 2 str. 63/9]
 gi|256369658|ref|YP_003107168.1| 30S ribosomal protein S10 [Brucella microti CCM 4915]
 gi|260168933|ref|ZP_05755744.1| 30S ribosomal protein S10 [Brucella sp. F5/99]
 gi|260546693|ref|ZP_05822432.1| SSU ribosomal protein S10P [Brucella abortus NCTC 8038]
 gi|260565514|ref|ZP_05835998.1| ribosomal protein S10 [Brucella melitensis bv. 1 str. 16M]
 gi|260754977|ref|ZP_05867325.1| ribosomal protein S10 [Brucella abortus bv. 6 str. 870]
 gi|260758193|ref|ZP_05870541.1| ribosomal protein S10 [Brucella abortus bv. 4 str. 292]
 gi|260762019|ref|ZP_05874362.1| ribosomal protein S10 [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883986|ref|ZP_05895600.1| ribosomal protein S10 [Brucella abortus bv. 9 str. C68]
 gi|261214231|ref|ZP_05928512.1| ribosomal protein S10 [Brucella abortus bv. 3 str. Tulya]
 gi|261219582|ref|ZP_05933863.1| ribosomal protein S10 [Brucella ceti M13/05/1]
 gi|261222396|ref|ZP_05936677.1| ribosomal protein S10 [Brucella ceti B1/94]
 gi|261314045|ref|ZP_05953242.1| ribosomal protein S10 [Brucella pinnipedialis M163/99/10]
 gi|261317868|ref|ZP_05957065.1| SSU ribosomal protein S10P [Brucella pinnipedialis B2/94]
 gi|261322077|ref|ZP_05961274.1| ribosomal protein S10 [Brucella ceti M644/93/1]
 gi|261325321|ref|ZP_05964518.1| SSU ribosomal protein S10P [Brucella neotomae 5K33]
 gi|261752543|ref|ZP_05996252.1| ribosomal protein S10 [Brucella suis bv. 5 str. 513]
 gi|261755202|ref|ZP_05998911.1| ribosomal protein S10 [Brucella suis bv. 3 str. 686]
 gi|261758426|ref|ZP_06002135.1| ribosomal protein S10 [Brucella sp. F5/99]
 gi|265988897|ref|ZP_06101454.1| ribosomal protein S10 [Brucella pinnipedialis M292/94/1]
 gi|265991311|ref|ZP_06103868.1| ribosomal protein S10 [Brucella melitensis bv. 1 str. Rev.1]
 gi|265995148|ref|ZP_06107705.1| ribosomal protein S10 [Brucella melitensis bv. 3 str. Ether]
 gi|265998361|ref|ZP_06110918.1| ribosomal protein S10 [Brucella ceti M490/95/1]
 gi|297248540|ref|ZP_06932258.1| 30S ribosomal protein S10 [Brucella abortus bv. 5 str. B3196]
 gi|306840300|ref|ZP_07473072.1| ribosomal protein S10 [Brucella sp. BO2]
 gi|306844138|ref|ZP_07476732.1| ribosomal protein S10 [Brucella sp. BO1]
 gi|54039299|sp|P66325|RS10_BRUSU RecName: Full=30S ribosomal protein S10
 gi|54042096|sp|P66324|RS10_BRUME RecName: Full=30S ribosomal protein S10
 gi|75496681|sp|Q57CQ7|RS10_BRUAB RecName: Full=30S ribosomal protein S10
 gi|115305609|sp|Q2YM02|RS10_BRUA2 RecName: Full=30S ribosomal protein S10
 gi|166231245|sp|A5VR07|RS10_BRUO2 RecName: Full=30S ribosomal protein S10
 gi|166231303|sp|A6X0B7|RS10_OCHA4 RecName: Full=30S ribosomal protein S10
 gi|189040361|sp|A9M5Q1|RS10_BRUC2 RecName: Full=30S ribosomal protein S10
 gi|189040362|sp|B0CH33|RS10_BRUSI RecName: Full=30S ribosomal protein S10
 gi|226705408|sp|B2S680|RS10_BRUA1 RecName: Full=30S ribosomal protein S10
 gi|254809604|sp|C0RJK2|RS10_BRUMB RecName: Full=30S ribosomal protein S10
 gi|17982695|gb|AAL51937.1| ssu ribosomal protein s10p [Brucella melitensis bv. 1 str. 16M]
 gi|23348071|gb|AAN30153.1| ribosomal protein S10 [Brucella suis 1330]
 gi|62196277|gb|AAX74577.1| RpsJ, ribosomal protein S10 [Brucella abortus bv. 1 str. 9-941]
 gi|82616169|emb|CAJ11212.1| Ribosomal protein S10:Ribosomal protein S10, bacterial form
           [Brucella melitensis biovar Abortus 2308]
 gi|148371131|gb|ABQ61110.1| ribosomal protein S10 [Brucella ovis ATCC 25840]
 gi|151561173|gb|ABS14671.1| ribosomal protein S10 [Ochrobactrum anthropi ATCC 49188]
 gi|161336001|gb|ABX62306.1| ribosomal protein S10 [Brucella canis ATCC 23365]
 gi|163674223|gb|ABY38334.1| ribosomal protein S10 [Brucella suis ATCC 23445]
 gi|189019955|gb|ACD72677.1| Ribosomal protein S10 [Brucella abortus S19]
 gi|225617709|gb|EEH14754.1| ribosomal protein S10 [Brucella ceti str. Cudo]
 gi|225641096|gb|ACO01010.1| ribosomal protein S10 [Brucella melitensis ATCC 23457]
 gi|237788951|gb|EEP63162.1| ribosomal protein S10 [Brucella abortus str. 2308 A]
 gi|239824390|gb|EEQ95958.1| ribosomal protein S10 [Ochrobactrum intermedium LMG 3301]
 gi|255999820|gb|ACU48219.1| 30S ribosomal protein S10 [Brucella microti CCM 4915]
 gi|260095743|gb|EEW79620.1| SSU ribosomal protein S10P [Brucella abortus NCTC 8038]
 gi|260151582|gb|EEW86676.1| ribosomal protein S10 [Brucella melitensis bv. 1 str. 16M]
 gi|260668511|gb|EEX55451.1| ribosomal protein S10 [Brucella abortus bv. 4 str. 292]
 gi|260672451|gb|EEX59272.1| ribosomal protein S10 [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675085|gb|EEX61906.1| ribosomal protein S10 [Brucella abortus bv. 6 str. 870]
 gi|260873514|gb|EEX80583.1| ribosomal protein S10 [Brucella abortus bv. 9 str. C68]
 gi|260915838|gb|EEX82699.1| ribosomal protein S10 [Brucella abortus bv. 3 str. Tulya]
 gi|260920980|gb|EEX87633.1| ribosomal protein S10 [Brucella ceti B1/94]
 gi|260924671|gb|EEX91239.1| ribosomal protein S10 [Brucella ceti M13/05/1]
 gi|261294767|gb|EEX98263.1| ribosomal protein S10 [Brucella ceti M644/93/1]
 gi|261297091|gb|EEY00588.1| SSU ribosomal protein S10P [Brucella pinnipedialis B2/94]
 gi|261301301|gb|EEY04798.1| SSU ribosomal protein S10P [Brucella neotomae 5K33]
 gi|261303071|gb|EEY06568.1| ribosomal protein S10 [Brucella pinnipedialis M163/99/10]
 gi|261738410|gb|EEY26406.1| ribosomal protein S10 [Brucella sp. F5/99]
 gi|261742296|gb|EEY30222.1| ribosomal protein S10 [Brucella suis bv. 5 str. 513]
 gi|261744955|gb|EEY32881.1| ribosomal protein S10 [Brucella suis bv. 3 str. 686]
 gi|262552829|gb|EEZ08819.1| ribosomal protein S10 [Brucella ceti M490/95/1]
 gi|262766261|gb|EEZ12050.1| ribosomal protein S10 [Brucella melitensis bv. 3 str. Ether]
 gi|263002095|gb|EEZ14670.1| ribosomal protein S10 [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093907|gb|EEZ17841.1| ribosomal protein S10 [Brucella melitensis bv. 2 str. 63/9]
 gi|264661094|gb|EEZ31355.1| ribosomal protein S10 [Brucella pinnipedialis M292/94/1]
 gi|297175709|gb|EFH35056.1| 30S ribosomal protein S10 [Brucella abortus bv. 5 str. B3196]
 gi|306275581|gb|EFM57313.1| ribosomal protein S10 [Brucella sp. BO1]
 gi|306289699|gb|EFM60888.1| ribosomal protein S10 [Brucella sp. BO2]
 gi|326409256|gb|ADZ66321.1| Ribosomal protein S10 [Brucella melitensis M28]
 gi|326538964|gb|ADZ87179.1| ribosomal protein S10 [Brucella melitensis M5-90]
          Length = 102

 Score =  143 bits (360), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 84/104 (80%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD RILD+S REIV T K++G+ + GPIP P  I +FTVNRSPH+D
Sbjct: 1   MNGQNIRIR--LKAFDHRILDASTREIVSTAKRTGANVRGPIPLPTRIEKFTVNRSPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q EMR +KRLL I+ PTPQTVDALMKLD++AGV+V IKL
Sbjct: 59  KKSREQFEMRTHKRLLDIVDPTPQTVDALMKLDLSAGVDVEIKL 102


>gi|163868651|ref|YP_001609860.1| 30S ribosomal protein S10 [Bartonella tribocorum CIP 105476]
 gi|240850836|ref|YP_002972236.1| 30S ribosomal protein S10 [Bartonella grahamii as4aup]
 gi|189040360|sp|A9IW28|RS10_BART1 RecName: Full=30S ribosomal protein S10
 gi|161018307|emb|CAK01865.1| 30S ribosomal protein S10 [Bartonella tribocorum CIP 105476]
 gi|240267959|gb|ACS51547.1| 30S ribosomal protein S10 [Bartonella grahamii as4aup]
          Length = 102

 Score =  143 bits (360), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 84/104 (80%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+NIRI   LKAFD RILD+S REIV T K++G+ + GPIP P  I +FTVNR PH+D
Sbjct: 1   MNSQNIRIR--LKAFDHRILDTSTREIVSTAKRTGANVRGPIPLPTRIEKFTVNRGPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q EMR +KRLL I+ PTPQTVDALMKLD++AGV+V IKL
Sbjct: 59  KKSREQFEMRTHKRLLDIVDPTPQTVDALMKLDLSAGVDVEIKL 102


>gi|296447529|ref|ZP_06889451.1| ribosomal protein S10 [Methylosinus trichosporium OB3b]
 gi|323136085|ref|ZP_08071168.1| ribosomal protein S10 [Methylocystis sp. ATCC 49242]
 gi|296254917|gb|EFH02022.1| ribosomal protein S10 [Methylosinus trichosporium OB3b]
 gi|322399176|gb|EFY01695.1| ribosomal protein S10 [Methylocystis sp. ATCC 49242]
          Length = 102

 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 85/104 (81%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD RILD+S +EIV T K++G+Q+ GPIP P  I +FTVNRSPH+D
Sbjct: 1   MNGQNIRIR--LKAFDHRILDTSTKEIVSTAKRTGAQVRGPIPLPTKIEKFTVNRSPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q E+R +KR+L I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 59  KKSREQFEIRTHKRVLDIVDPTPQTVDALMKLDLAAGVDVEIKL 102


>gi|294852571|ref|ZP_06793244.1| 30S ribosomal protein S10 [Brucella sp. NVSL 07-0026]
 gi|294821160|gb|EFG38159.1| 30S ribosomal protein S10 [Brucella sp. NVSL 07-0026]
          Length = 102

 Score =  142 bits (358), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 84/104 (80%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD RILD+S REIV T K++G+ + GPIP P  I +FT+NRSPH+D
Sbjct: 1   MNGQNIRIR--LKAFDHRILDASTREIVSTAKRTGANVRGPIPLPTRIEKFTINRSPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q EMR +KRLL I+ PTPQTVDALMKLD++AGV+V IKL
Sbjct: 59  KKSREQFEMRTHKRLLDIVDPTPQTVDALMKLDLSAGVDVEIKL 102


>gi|170748635|ref|YP_001754895.1| ribosomal protein S10 [Methylobacterium radiotolerans JCM 2831]
 gi|226705593|sp|B1LWS5|RS10_METRJ RecName: Full=30S ribosomal protein S10
 gi|170655157|gb|ACB24212.1| ribosomal protein S10 [Methylobacterium radiotolerans JCM 2831]
          Length = 102

 Score =  142 bits (357), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 84/104 (80%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD RILD+S +EIV T K++G+ I GPIP P  I +FTVNRSPH+D
Sbjct: 1   MNGQNIRIR--LKAFDHRILDASTKEIVSTAKRTGATIRGPIPLPTHIAKFTVNRSPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q EMR +KR+L I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 59  KKSREQFEMRTHKRVLDIVDPTPQTVDALMKLDLAAGVDVEIKL 102


>gi|319404426|emb|CBI78029.1| 30S ribosomal protein S10 [Bartonella rochalimae ATCC BAA-1498]
 gi|319405899|emb|CBI79531.1| 30S ribosomal protein S10 [Bartonella sp. AR 15-3]
 gi|319408766|emb|CBI82423.1| 30S ribosomal protein S10 [Bartonella schoenbuchensis R1]
          Length = 102

 Score =  141 bits (356), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 83/104 (79%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD RILD+S REIV T K++G+ + GPIP P  I +FTVNR PH+D
Sbjct: 1   MNGQNIRIR--LKAFDHRILDASTREIVSTAKRTGANVRGPIPLPTRIEKFTVNRGPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q EMR +KRLL I+ PTPQTVDALMKLD++AGV+V IKL
Sbjct: 59  KKSREQFEMRTHKRLLDIVDPTPQTVDALMKLDLSAGVDVEIKL 102


>gi|217976768|ref|YP_002360915.1| 30S ribosomal protein S10 [Methylocella silvestris BL2]
 gi|254809974|sp|B8ELG4|RS10_METSB RecName: Full=30S ribosomal protein S10
 gi|217502144|gb|ACK49553.1| ribosomal protein S10 [Methylocella silvestris BL2]
          Length = 102

 Score =  141 bits (356), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 84/104 (80%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD RILD+S +EIV T K++G+ + GPIP P  I +FTVNRSPHVD
Sbjct: 1   MNGQNIRIR--LKAFDHRILDTSTKEIVSTAKRTGAHVRGPIPLPTKIEKFTVNRSPHVD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q E+R +KR+L I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 59  KKSREQFEIRTHKRVLDIVDPTPQTVDALMKLDLAAGVDVEIKL 102


>gi|58038856|ref|YP_190820.1| 30S ribosomal protein S10 [Gluconobacter oxydans 621H]
 gi|114327217|ref|YP_744374.1| 30S ribosomal protein S10 [Granulibacter bethesdensis CGDNIH1]
 gi|258542026|ref|YP_003187459.1| 30S ribosomal protein S10 [Acetobacter pasteurianus IFO 3283-01]
 gi|330993845|ref|ZP_08317777.1| 30S ribosomal protein S10 [Gluconacetobacter sp. SXCC-1]
 gi|81557182|sp|Q5FTY2|RS10_GLUOX RecName: Full=30S ribosomal protein S10
 gi|122327803|sp|Q0BUQ1|RS10_GRABC RecName: Full=30S ribosomal protein S10
 gi|58001270|gb|AAW60164.1| SSU ribosomal protein S10P [Gluconobacter oxydans 621H]
 gi|114315391|gb|ABI61451.1| SSU ribosomal protein S10P [Granulibacter bethesdensis CGDNIH1]
 gi|256633104|dbj|BAH99079.1| SSU ribosomal protein S10P [Acetobacter pasteurianus IFO 3283-01]
 gi|256636161|dbj|BAI02130.1| SSU ribosomal protein S10P [Acetobacter pasteurianus IFO 3283-03]
 gi|256639216|dbj|BAI05178.1| SSU ribosomal protein S10P [Acetobacter pasteurianus IFO 3283-07]
 gi|256642270|dbj|BAI08225.1| SSU ribosomal protein S10P [Acetobacter pasteurianus IFO 3283-22]
 gi|256645325|dbj|BAI11273.1| SSU ribosomal protein S10P [Acetobacter pasteurianus IFO 3283-26]
 gi|256648380|dbj|BAI14321.1| SSU ribosomal protein S10P [Acetobacter pasteurianus IFO 3283-32]
 gi|256651433|dbj|BAI17367.1| SSU ribosomal protein S10P [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654424|dbj|BAI20351.1| SSU ribosomal protein S10P [Acetobacter pasteurianus IFO 3283-12]
 gi|329759113|gb|EGG75625.1| 30S ribosomal protein S10 [Gluconacetobacter sp. SXCC-1]
          Length = 102

 Score =  141 bits (355), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 87/104 (83%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M ++NIRI   LKA+D R+LD+S +EIV T K++G+++ GPIP P  I RFTVNRSPHVD
Sbjct: 1   MDNQNIRIR--LKAYDHRVLDNSTKEIVNTAKRTGARVRGPIPLPTHIERFTVNRSPHVD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q E+R ++RLL I++PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 59  KKSREQFEIRTHRRLLDIVEPTPQTVDALMKLDLAAGVDVEIKL 102


>gi|110634031|ref|YP_674239.1| 30S ribosomal protein S10 [Mesorhizobium sp. BNC1]
 gi|118597185|sp|Q11HQ1|RS10_MESSB RecName: Full=30S ribosomal protein S10
 gi|110285015|gb|ABG63074.1| SSU ribosomal protein S10P [Chelativorans sp. BNC1]
          Length = 102

 Score =  140 bits (354), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 83/104 (79%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD R+LD+S REIV T K++G+ + GPIP P  I +FTVNRS H+D
Sbjct: 1   MNGQNIRIR--LKAFDHRVLDASTREIVSTAKRTGANVRGPIPLPTRIEKFTVNRSTHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q EMR +KRLL I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 59  KKSREQFEMRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKL 102


>gi|328543357|ref|YP_004303466.1| 30S ribosomal protein S10 [Polymorphum gilvum SL003B-26A1]
 gi|326413102|gb|ADZ70165.1| 30S ribosomal protein S10 [Polymorphum gilvum SL003B-26A1]
          Length = 102

 Score =  140 bits (354), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 83/104 (79%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD RILD+S REIV T K++G+Q+ GP+P P  I ++TV R PH+D
Sbjct: 1   MNGQNIRIR--LKAFDHRILDASTREIVNTAKRTGAQVRGPVPLPTRIEKYTVLRGPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSRDQ EMR +KRLL I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 59  KKSRDQFEMRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKL 102


>gi|56698637|ref|YP_169014.1| 30S ribosomal protein S10 [Ruegeria pomeroyi DSS-3]
 gi|99080086|ref|YP_612240.1| 30S ribosomal protein S10 [Ruegeria sp. TM1040]
 gi|254467298|ref|ZP_05080709.1| ribosomal protein S10 [Rhodobacterales bacterium Y4I]
 gi|259416566|ref|ZP_05740486.1| ribosomal protein S10 [Silicibacter sp. TrichCH4B]
 gi|260432428|ref|ZP_05786399.1| ribosomal protein S10 [Silicibacter lacuscaerulensis ITI-1157]
 gi|81558237|sp|Q5LLU5|RS10_SILPO RecName: Full=30S ribosomal protein S10
 gi|118597321|sp|Q1GK38|RS10_SILST RecName: Full=30S ribosomal protein S10
 gi|56680374|gb|AAV97040.1| ribosomal protein S10 [Ruegeria pomeroyi DSS-3]
 gi|99036366|gb|ABF62978.1| SSU ribosomal protein S10P [Ruegeria sp. TM1040]
 gi|206688206|gb|EDZ48688.1| ribosomal protein S10 [Rhodobacterales bacterium Y4I]
 gi|259348005|gb|EEW59782.1| ribosomal protein S10 [Silicibacter sp. TrichCH4B]
 gi|260416256|gb|EEX09515.1| ribosomal protein S10 [Silicibacter lacuscaerulensis ITI-1157]
          Length = 104

 Score =  140 bits (354), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 84/104 (80%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+NIRI   LKAFD R+LD+S +EIV T K++G+Q+ GPIP P  I +FTV R PHVD
Sbjct: 1   MQSQNIRIR--LKAFDYRVLDASTQEIVNTAKRTGAQVRGPIPLPNKIEKFTVLRGPHVD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSRDQ E+R +KRLL I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 59  KKSRDQFEIRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKL 102


>gi|288957421|ref|YP_003447762.1| small subunit ribosomal protein S10 [Azospirillum sp. B510]
 gi|288909729|dbj|BAI71218.1| small subunit ribosomal protein S10 [Azospirillum sp. B510]
          Length = 102

 Score =  140 bits (353), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 84/104 (80%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+NIRI   LKAFD R+LD S  EIV T K++G+++ GPIP P  I +FTVNRSPH+D
Sbjct: 1   MDSQNIRIR--LKAFDHRVLDQSTSEIVNTAKRTGARVRGPIPLPTHIEKFTVNRSPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q E+R +KRLL I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 59  KKSREQFEIRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKL 102


>gi|254477653|ref|ZP_05091039.1| ribosomal protein S10 [Ruegeria sp. R11]
 gi|214031896|gb|EEB72731.1| ribosomal protein S10 [Ruegeria sp. R11]
          Length = 104

 Score =  140 bits (353), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 84/104 (80%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+NIRI   LKAFD R+LD+S +EIV T K++G+Q+ GPIP P  I +FTV R PHVD
Sbjct: 1   MQSQNIRIR--LKAFDFRVLDASTQEIVNTAKRTGAQVRGPIPLPNKIEKFTVLRGPHVD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSRDQ E+R +KRLL I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 59  KKSRDQFEIRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKL 102


>gi|163739436|ref|ZP_02146846.1| 30S ribosomal protein S10 [Phaeobacter gallaeciensis BS107]
 gi|163740230|ref|ZP_02147624.1| 30S ribosomal protein S10 [Phaeobacter gallaeciensis 2.10]
 gi|161386088|gb|EDQ10463.1| 30S ribosomal protein S10 [Phaeobacter gallaeciensis 2.10]
 gi|161387189|gb|EDQ11548.1| 30S ribosomal protein S10 [Phaeobacter gallaeciensis BS107]
          Length = 106

 Score =  140 bits (353), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 84/104 (80%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+NIRI   LKAFD R+LD+S +EIV T K++G+Q+ GPIP P  I +FTV R PHVD
Sbjct: 3   MQSQNIRIR--LKAFDFRVLDASTQEIVNTAKRTGAQVRGPIPLPNKIEKFTVLRGPHVD 60

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSRDQ E+R +KRLL I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 61  KKSRDQFEIRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKL 104


>gi|260566237|ref|ZP_05836707.1| ribosomal protein S10 [Brucella suis bv. 4 str. 40]
 gi|260155755|gb|EEW90835.1| ribosomal protein S10 [Brucella suis bv. 4 str. 40]
          Length = 102

 Score =  140 bits (353), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 83/104 (79%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD RILD+S REIV T K++G+ + GPIP P  I +FTVNRSPH+D
Sbjct: 1   MNGQNIRIR--LKAFDHRILDASTREIVSTAKRTGANVRGPIPLPTRIEKFTVNRSPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q EMR +KRLL I+ P PQTVDALMKLD++AGV+V IKL
Sbjct: 59  KKSREQFEMRTHKRLLDIVDPPPQTVDALMKLDLSAGVDVEIKL 102


>gi|162149175|ref|YP_001603636.1| 30S ribosomal protein S10 [Gluconacetobacter diazotrophicus PAl 5]
 gi|209545081|ref|YP_002277310.1| 30S ribosomal protein S10 [Gluconacetobacter diazotrophicus PAl 5]
 gi|189040374|sp|A9H3R6|RS10_GLUDA RecName: Full=30S ribosomal protein S10
 gi|161787752|emb|CAP57348.1| putative 30S ribosomal protein S10 [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209532758|gb|ACI52695.1| ribosomal protein S10 [Gluconacetobacter diazotrophicus PAl 5]
          Length = 102

 Score =  140 bits (352), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 87/104 (83%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M ++NIRI   LKA+D R+LD+S +EIV T K++G+++ GPIP P  I +FTVNRSPHVD
Sbjct: 1   MDNQNIRIR--LKAYDHRVLDNSTKEIVNTAKRTGARVRGPIPLPTHIEKFTVNRSPHVD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q E+R ++RLL I++PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 59  KKSREQFEIRTHRRLLDIVEPTPQTVDALMKLDLAAGVDVEIKL 102


>gi|209964039|ref|YP_002296954.1| 30S ribosomal protein S10 [Rhodospirillum centenum SW]
 gi|226705615|sp|B6IRQ5|RS10_RHOCS RecName: Full=30S ribosomal protein S10
 gi|209957505|gb|ACI98141.1| ribosomal protein S10 [Rhodospirillum centenum SW]
          Length = 102

 Score =  140 bits (352), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 84/104 (80%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+NIRI   LKAFD R+LD S  EIV T K++G+++ GPIP P  I +FTVNRSPH+D
Sbjct: 1   MESQNIRIR--LKAFDHRVLDQSTSEIVNTAKRTGARVRGPIPLPTQIEKFTVNRSPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q E+R +KRLL I+ PTPQTVDALMKLD+AAGV+V IK+
Sbjct: 59  KKSREQFEIRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKI 102


>gi|254500932|ref|ZP_05113083.1| ribosomal protein S10 [Labrenzia alexandrii DFL-11]
 gi|222437003|gb|EEE43682.1| ribosomal protein S10 [Labrenzia alexandrii DFL-11]
          Length = 107

 Score =  140 bits (352), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 83/104 (79%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD RILD+S +EIV T K++G+Q+ GP+P P  I ++TV R PH+D
Sbjct: 6   MNGQNIRIR--LKAFDHRILDASTKEIVNTAKRTGAQVRGPVPLPTRIEKYTVLRGPHID 63

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSRDQ EMR +KRLL I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 64  KKSRDQFEMRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKL 107


>gi|319407427|emb|CBI81078.1| 30S ribosomal protein S10 [Bartonella sp. 1-1C]
          Length = 102

 Score =  139 bits (351), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 83/104 (79%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD RILD+S REIV T K++G+ + GPIP P  I +FTVNR PH++
Sbjct: 1   MNGQNIRIR--LKAFDHRILDASTREIVSTAKRTGANVRGPIPLPTRIEKFTVNRGPHIN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q EMR +KRLL I+ PTPQTVDALMKLD++AGV+V IKL
Sbjct: 59  KKSREQFEMRTHKRLLDIVDPTPQTVDALMKLDLSAGVDVEIKL 102


>gi|121602045|ref|YP_988996.1| ribosomal protein S10 [Bartonella bacilliformis KC583]
 gi|121602082|ref|YP_988966.1| ribosomal protein S10 [Bartonella bacilliformis KC583]
 gi|120614222|gb|ABM44823.1| ribosomal protein S10 [Bartonella bacilliformis KC583]
 gi|120614259|gb|ABM44860.1| ribosomal protein S10 [Bartonella bacilliformis KC583]
          Length = 102

 Score =  139 bits (351), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 82/104 (78%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   L+AFD RILD S +EIV T K++G+ + GPIP P  I +FTVNR PH+D
Sbjct: 1   MNGQNIRIR--LEAFDHRILDVSTQEIVSTAKRTGANVRGPIPLPTRIEKFTVNRGPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q EMR +KRLL II PTPQTVDALMKLD++AGVNV IKL
Sbjct: 59  KKSREQFEMRTHKRLLDIIDPTPQTVDALMKLDLSAGVNVEIKL 102


>gi|254470024|ref|ZP_05083428.1| ribosomal protein S10 [Pseudovibrio sp. JE062]
 gi|211960335|gb|EEA95531.1| ribosomal protein S10 [Pseudovibrio sp. JE062]
          Length = 102

 Score =  139 bits (351), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 83/104 (79%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD R+LD+S +EIV T K++G+Q+ GP+P P  I ++TV R PHVD
Sbjct: 1   MNGQNIRIR--LKAFDHRVLDASTKEIVNTAKRTGAQVRGPVPLPTRIEKYTVLRGPHVD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSRDQ EMR +KRLL I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 59  KKSRDQFEMRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKL 102


>gi|118591185|ref|ZP_01548584.1| 30S ribosomal protein S10 [Stappia aggregata IAM 12614]
 gi|307946285|ref|ZP_07661620.1| ribosomal protein S10 [Roseibium sp. TrichSKD4]
 gi|118436261|gb|EAV42903.1| 30S ribosomal protein S10 [Stappia aggregata IAM 12614]
 gi|307769949|gb|EFO29175.1| ribosomal protein S10 [Roseibium sp. TrichSKD4]
          Length = 102

 Score =  139 bits (351), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 83/104 (79%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD RILD+S +EIV T K++G+Q+ GP+P P  I ++TV R PH+D
Sbjct: 1   MNGQNIRIR--LKAFDHRILDASTKEIVNTAKRTGAQVRGPVPLPTRIEKYTVLRGPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSRDQ EMR +KRLL I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 59  KKSRDQFEMRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKL 102


>gi|218660496|ref|ZP_03516426.1| 30S ribosomal protein S10 [Rhizobium etli IE4771]
          Length = 98

 Score =  139 bits (351), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 81/100 (81%), Gaps = 2/100 (2%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD RILD+S REIV T K++G+ + GP+P P  I +FTVNRSPH+D
Sbjct: 1   MNGQNIRIR--LKAFDHRILDASTREIVSTAKRTGASVRGPVPLPTRIEKFTVNRSPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNV 100
           KKSR+Q EMR +KRLL I+ PTPQTVDALMKLD+AAGV+V
Sbjct: 59  KKSREQFEMRTHKRLLDIVDPTPQTVDALMKLDLAAGVDV 98


>gi|312115686|ref|YP_004013282.1| ribosomal protein S10 [Rhodomicrobium vannielii ATCC 17100]
 gi|311220815|gb|ADP72183.1| ribosomal protein S10 [Rhodomicrobium vannielii ATCC 17100]
          Length = 102

 Score =  139 bits (350), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 83/104 (79%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LKAFD R+LD+S +EIV T K++G+ + GPIP P  I R+TVNRSPH+D
Sbjct: 1   MAGQTIRIR--LKAFDHRVLDASTKEIVNTAKRTGADVHGPIPLPTRIERYTVNRSPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q EMR +KRL+ I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 59  KKSREQFEMRTHKRLIDIVDPTPQTVDALMKLDLAAGVDVEIKL 102


>gi|294085957|ref|YP_003552717.1| 30S ribosomal protein S10 [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292665532|gb|ADE40633.1| Ribosomal protein S10 [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 102

 Score =  139 bits (350), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 84/104 (80%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M ++NIRI   LKAFD RILD S  EIV T K++G+++ GPIP P ++RR TV RSPH+D
Sbjct: 1   METQNIRIR--LKAFDHRILDQSTTEIVNTAKRTGAEVRGPIPLPTNLRRMTVLRSPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q EMR +KRLL I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 59  KKSREQFEMRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKL 102


>gi|319899100|ref|YP_004159193.1| 30S ribosomal protein S10 [Bartonella clarridgeiae 73]
 gi|319403064|emb|CBI76619.1| 30S ribosomal protein S10 [Bartonella clarridgeiae 73]
          Length = 102

 Score =  139 bits (349), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 82/104 (78%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD RILD+S REIV T K++G+ + GPIP P  I +FTVNR PH+D
Sbjct: 1   MNGQNIRIR--LKAFDHRILDASTREIVSTAKRTGANVRGPIPLPTRIEKFTVNRGPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q EMR +KRLL I+ PTPQTVDALMKLD++A V+V IKL
Sbjct: 59  KKSREQFEMRTHKRLLDIVDPTPQTVDALMKLDLSASVDVEIKL 102


>gi|114771270|ref|ZP_01448690.1| 30S ribosomal protein S10 [alpha proteobacterium HTCC2255]
 gi|114548195|gb|EAU51082.1| 30S ribosomal protein S10 [alpha proteobacterium HTCC2255]
          Length = 102

 Score =  139 bits (349), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 84/104 (80%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+NIRI   LKAFD R+LD+S  EIV T K++G+Q+ GPIP P  I +FTV RSPHV+
Sbjct: 1   MQSQNIRIR--LKAFDYRVLDASTEEIVNTAKRTGAQVRGPIPLPNKIEKFTVLRSPHVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q E+R +KRLL II PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 59  KKSREQFEIRTHKRLLDIIDPTPQTVDALMKLDLAAGVDVEIKL 102


>gi|119383510|ref|YP_914566.1| 30S ribosomal protein S10 [Paracoccus denitrificans PD1222]
 gi|166231305|sp|A1B026|RS10_PARDP RecName: Full=30S ribosomal protein S10
 gi|119373277|gb|ABL68870.1| SSU ribosomal protein S10P [Paracoccus denitrificans PD1222]
          Length = 102

 Score =  138 bits (348), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 84/104 (80%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+NIRI   LKAFD R+LD+S +EIV T K++G+Q+ GPIP P  I +FTV R PH+D
Sbjct: 1   MQSQNIRIR--LKAFDYRVLDASTQEIVNTAKRTGAQVRGPIPLPNKIEKFTVLRGPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSRDQ E+R +KRLL I+ PTPQTVDALMKLD+AAGV+V IK+
Sbjct: 59  KKSRDQWEIRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKV 102


>gi|254510543|ref|ZP_05122610.1| ribosomal protein S10 [Rhodobacteraceae bacterium KLH11]
 gi|221534254|gb|EEE37242.1| ribosomal protein S10 [Rhodobacteraceae bacterium KLH11]
          Length = 104

 Score =  138 bits (348), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 83/104 (79%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+NIRI   LKAFD R+LD+S +EIV T K++G+ + GPIP P  I +FTV R PHVD
Sbjct: 1   MQSQNIRIR--LKAFDYRVLDASTQEIVNTAKRTGANVRGPIPLPNKIEKFTVLRGPHVD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSRDQ E+R +KRLL I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 59  KKSRDQFEIRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKL 102


>gi|163745536|ref|ZP_02152896.1| 30S ribosomal protein S10 [Oceanibulbus indolifex HEL-45]
 gi|161382354|gb|EDQ06763.1| 30S ribosomal protein S10 [Oceanibulbus indolifex HEL-45]
          Length = 106

 Score =  138 bits (347), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 70/102 (68%), Positives = 82/102 (80%), Gaps = 2/102 (1%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           S+NIRI   LKAFD R+LDSS +EIV T K++G+ + GPIP P  I +FTV R PHVDKK
Sbjct: 5   SQNIRIR--LKAFDYRVLDSSTQEIVSTAKRTGASVRGPIPLPNKIEKFTVLRGPHVDKK 62

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           SRDQ E+R +KRLL II PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 63  SRDQFEIRTHKRLLDIIDPTPQTVDALMKLDLAAGVDVEIKL 104


>gi|126724860|ref|ZP_01740703.1| 30S ribosomal protein S10 [Rhodobacterales bacterium HTCC2150]
 gi|126706024|gb|EBA05114.1| 30S ribosomal protein S10 [Rhodobacterales bacterium HTCC2150]
          Length = 102

 Score =  137 bits (346), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 83/104 (79%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+NIRI   LKAFD R+LD+S +EIV T K++G+ + GPIP P  I +FTV R PHVD
Sbjct: 1   MQSQNIRIR--LKAFDYRVLDASTQEIVNTAKRTGAHVRGPIPLPNKIEKFTVLRGPHVD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSRDQ E+R +KRLL II PTPQTVDALMKLD+AAGV+V IK+
Sbjct: 59  KKSRDQFEIRTHKRLLDIIDPTPQTVDALMKLDLAAGVDVEIKV 102


>gi|294675855|ref|YP_003576470.1| 30S ribosomal protein S10 [Rhodobacter capsulatus SB 1003]
 gi|294474675|gb|ADE84063.1| 30S ribosomal protein S10 [Rhodobacter capsulatus SB 1003]
          Length = 102

 Score =  137 bits (346), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 84/104 (80%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M+ +NIRI   LKAFD R+LD+S +EIV T K++G+Q+ GPIP P  I +FTV R PH+D
Sbjct: 1   MSGQNIRIR--LKAFDYRVLDASTQEIVNTAKRTGAQVRGPIPLPNKIEKFTVLRGPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSRDQ E+R +KRLL I+ PTPQTVDALMKLD+AAGV+V IK+
Sbjct: 59  KKSRDQWEIRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKV 102


>gi|114764145|ref|ZP_01443383.1| 30S ribosomal protein S10 [Pelagibaca bermudensis HTCC2601]
 gi|260425649|ref|ZP_05779629.1| ribosomal protein S10 [Citreicella sp. SE45]
 gi|114543297|gb|EAU46313.1| 30S ribosomal protein S10 [Roseovarius sp. HTCC2601]
 gi|260423589|gb|EEX16839.1| ribosomal protein S10 [Citreicella sp. SE45]
          Length = 102

 Score =  137 bits (345), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 84/104 (80%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+NIRI   LKAFD R+LD+S +EIV T K++G+Q+ GPIP P  I +FTV R PHV+
Sbjct: 1   MQSQNIRIR--LKAFDYRVLDASTQEIVNTAKRTGAQVRGPIPLPNKIEKFTVLRGPHVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSRDQ E+R +KRLL I+ PTPQTVDALMKLD+AAGV+V IK+
Sbjct: 59  KKSRDQFEIRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKV 102


>gi|89053073|ref|YP_508524.1| 30S ribosomal protein S10 [Jannaschia sp. CCS1]
 gi|118597181|sp|Q28UW3|RS10_JANSC RecName: Full=30S ribosomal protein S10
 gi|88862622|gb|ABD53499.1| SSU ribosomal protein S10P [Jannaschia sp. CCS1]
          Length = 103

 Score =  137 bits (345), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 68/102 (66%), Positives = 83/102 (81%), Gaps = 2/102 (1%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           S+NIRI   LKAFD R+LD+S +EIV T K++G+Q+ GPIP P  I +FTV R PHVDKK
Sbjct: 4   SQNIRIR--LKAFDYRVLDASTQEIVNTAKRTGAQVRGPIPLPNKIEKFTVLRGPHVDKK 61

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           SRDQ E+R +KRLL I+ PTPQTVDALMKLD+AAGV+V IK+
Sbjct: 62  SRDQWEIRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKV 103


>gi|86135761|ref|ZP_01054340.1| ribosomal protein S10 [Roseobacter sp. MED193]
 gi|126739693|ref|ZP_01755385.1| 30S ribosomal protein S10 [Roseobacter sp. SK209-2-6]
 gi|85826635|gb|EAQ46831.1| ribosomal protein S10 [Roseobacter sp. MED193]
 gi|126719339|gb|EBA16049.1| 30S ribosomal protein S10 [Roseobacter sp. SK209-2-6]
          Length = 104

 Score =  137 bits (344), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 83/104 (79%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+NIRI   LKAFD R+LD+S +EIV T K++G+ + GPIP P  I +FTV R PHVD
Sbjct: 1   MQSQNIRIR--LKAFDYRVLDASTQEIVNTAKRTGATVRGPIPLPNKIEKFTVLRGPHVD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSRDQ E+R +KR+L I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 59  KKSRDQFEIRTHKRMLDIVDPTPQTVDALMKLDLAAGVDVEIKL 102


>gi|315497972|ref|YP_004086776.1| ribosomal protein s10 [Asticcacaulis excentricus CB 48]
 gi|329850206|ref|ZP_08265051.1| ribosomal protein S10 [Asticcacaulis biprosthecum C19]
 gi|315415984|gb|ADU12625.1| ribosomal protein S10 [Asticcacaulis excentricus CB 48]
 gi|328840521|gb|EGF90092.1| ribosomal protein S10 [Asticcacaulis biprosthecum C19]
          Length = 102

 Score =  137 bits (344), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 83/104 (79%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD R+LD S REIV T K++G+ + GPIP P  I RFTVNRSPHVD
Sbjct: 1   MDRQNIRIR--LKAFDHRVLDHSTREIVNTAKRTGATVRGPIPLPTLIERFTVNRSPHVD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q E+R +KR+L I+ PTPQTVDALMKLD++AGV+V IK+
Sbjct: 59  KKSREQFEIRTHKRVLDIVDPTPQTVDALMKLDLSAGVDVEIKI 102


>gi|16125496|ref|NP_420060.1| 30S ribosomal protein S10 [Caulobacter crescentus CB15]
 gi|167645577|ref|YP_001683240.1| 30S ribosomal protein S10 [Caulobacter sp. K31]
 gi|221234242|ref|YP_002516678.1| 30S ribosomal protein S10 [Caulobacter crescentus NA1000]
 gi|295688905|ref|YP_003592598.1| 30S ribosomal protein S10 [Caulobacter segnis ATCC 21756]
 gi|17865590|sp|Q9A8V4|RS10_CAUCR RecName: Full=30S ribosomal protein S10
 gi|189040363|sp|B0T2C1|RS10_CAUSK RecName: Full=30S ribosomal protein S10
 gi|254809600|sp|B8H4D3|RS10_CAUCN RecName: Full=30S ribosomal protein S10
 gi|13422578|gb|AAK23228.1| ribosomal protein S10 [Caulobacter crescentus CB15]
 gi|167348007|gb|ABZ70742.1| ribosomal protein S10 [Caulobacter sp. K31]
 gi|220963414|gb|ACL94770.1| SSU ribosomal protein S10P [Caulobacter crescentus NA1000]
 gi|295430808|gb|ADG09980.1| ribosomal protein S10 [Caulobacter segnis ATCC 21756]
          Length = 102

 Score =  137 bits (344), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 83/104 (79%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD R+LD S REIV T K++G+ + GPIP P  I +FTVNRSPHVD
Sbjct: 1   MDRQNIRIR--LKAFDHRVLDHSTREIVNTAKRTGATVRGPIPLPTLIEKFTVNRSPHVD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q E+R +KR+L I+ PTPQTVDALMKLD++AGV+V IKL
Sbjct: 59  KKSREQFEIRTHKRVLDIVDPTPQTVDALMKLDLSAGVDVEIKL 102


>gi|197104695|ref|YP_002130072.1| 30S ribosomal protein S10 [Phenylobacterium zucineum HLK1]
 gi|226705603|sp|B4R8L6|RS10_PHEZH RecName: Full=30S ribosomal protein S10
 gi|196478115|gb|ACG77643.1| 30S ribosomal protein S10 [Phenylobacterium zucineum HLK1]
          Length = 102

 Score =  137 bits (344), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 83/104 (79%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD R+LD S REIV T K++G+ + GPIP P  I +FTVNRSPH+D
Sbjct: 1   MDRQNIRIR--LKAFDHRVLDHSTREIVNTAKRTGATVRGPIPLPTRIEKFTVNRSPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q E+R +KR+L I+ PTPQTVDALMKLD++AGV+V IKL
Sbjct: 59  KKSREQFEIRTHKRVLDIVDPTPQTVDALMKLDLSAGVDVEIKL 102


>gi|85703986|ref|ZP_01035089.1| 30S ribosomal protein S10 [Roseovarius sp. 217]
 gi|149203510|ref|ZP_01880480.1| 30S ribosomal protein S10 [Roseovarius sp. TM1035]
 gi|85671306|gb|EAQ26164.1| 30S ribosomal protein S10 [Roseovarius sp. 217]
 gi|149143343|gb|EDM31382.1| 30S ribosomal protein S10 [Roseovarius sp. TM1035]
          Length = 102

 Score =  137 bits (344), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 84/104 (80%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+NIRI   LKAFD R+LD+S +EIV T K++G+Q+ GPIP P  I +FTV RSPHV+
Sbjct: 1   MQSQNIRIR--LKAFDYRVLDASTQEIVNTAKRTGAQVRGPIPLPNKIEKFTVLRSPHVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSRDQ E+R +KRLL I+ PTPQTVDALMKLD+AAGV+V I +
Sbjct: 59  KKSRDQFEIRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVQISV 102


>gi|83854979|ref|ZP_00948509.1| 30S ribosomal protein S10 [Sulfitobacter sp. NAS-14.1]
 gi|83941501|ref|ZP_00953963.1| 30S ribosomal protein S10 [Sulfitobacter sp. EE-36]
 gi|254487904|ref|ZP_05101109.1| ribosomal protein S10 [Roseobacter sp. GAI101]
 gi|83842822|gb|EAP81989.1| 30S ribosomal protein S10 [Sulfitobacter sp. NAS-14.1]
 gi|83847321|gb|EAP85196.1| 30S ribosomal protein S10 [Sulfitobacter sp. EE-36]
 gi|214044773|gb|EEB85411.1| ribosomal protein S10 [Roseobacter sp. GAI101]
          Length = 105

 Score =  136 bits (343), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 68/102 (66%), Positives = 82/102 (80%), Gaps = 2/102 (1%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           S+NIRI   LKAFD R+LD+S +EIV T K++G+ + GPIP P  I +FTV R PHVDKK
Sbjct: 4   SQNIRIR--LKAFDYRVLDASTQEIVNTAKRTGASVRGPIPLPNKIEKFTVLRGPHVDKK 61

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           SRDQ E+R +KRLL I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 62  SRDQFEIRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKL 103


>gi|163733829|ref|ZP_02141271.1| 30S ribosomal protein S10 [Roseobacter litoralis Och 149]
 gi|161392940|gb|EDQ17267.1| 30S ribosomal protein S10 [Roseobacter litoralis Och 149]
          Length = 107

 Score =  136 bits (343), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 68/102 (66%), Positives = 82/102 (80%), Gaps = 2/102 (1%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           S+NIRI   LKAFD R+LD+S +EIV T K++G+ + GPIP P  I +FTV R PHVDKK
Sbjct: 6   SQNIRIR--LKAFDYRVLDTSTQEIVNTAKRTGASVRGPIPLPNKIEKFTVLRGPHVDKK 63

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           SRDQ E+R +KRLL I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 64  SRDQFEIRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKL 105


>gi|110678717|ref|YP_681724.1| 30S ribosomal protein S10 [Roseobacter denitrificans OCh 114]
 gi|118597314|sp|Q16AF5|RS10_ROSDO RecName: Full=30S ribosomal protein S10
 gi|109454833|gb|ABG31038.1| ribosomal protein S10 [Roseobacter denitrificans OCh 114]
          Length = 105

 Score =  136 bits (343), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 68/102 (66%), Positives = 82/102 (80%), Gaps = 2/102 (1%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           S+NIRI   LKAFD R+LD+S +EIV T K++G+ + GPIP P  I +FTV R PHVDKK
Sbjct: 4   SQNIRIR--LKAFDYRVLDTSTQEIVNTAKRTGASVRGPIPLPNKIEKFTVLRGPHVDKK 61

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           SRDQ E+R +KRLL I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 62  SRDQFEIRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKL 103


>gi|84503643|ref|ZP_01001681.1| 30S ribosomal protein S10 [Oceanicola batsensis HTCC2597]
 gi|84387940|gb|EAQ00992.1| 30S ribosomal protein S10 [Oceanicola batsensis HTCC2597]
          Length = 102

 Score =  135 bits (341), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 83/104 (79%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M+ + IRI   LKAFD R+LD+S +EIV T K++G+Q+ GPIP P  I +FTV R PHVD
Sbjct: 1   MSGQTIRIR--LKAFDYRVLDTSTQEIVNTAKRTGAQVRGPIPLPNKIEKFTVLRGPHVD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSRDQ E+R +KRLL I+ PTPQTVDALMKLD+AAGV+V IK+
Sbjct: 59  KKSRDQFEIRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKV 102


>gi|84685438|ref|ZP_01013336.1| 30S ribosomal protein S10 [Maritimibacter alkaliphilus HTCC2654]
 gi|84666595|gb|EAQ13067.1| 30S ribosomal protein S10 [Rhodobacterales bacterium HTCC2654]
          Length = 104

 Score =  135 bits (341), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 83/104 (79%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           + S+NIRI   LKAFD R+LD+S +EIV T K++G+Q+ GPIP P  I +FTV R PH+D
Sbjct: 3   IQSQNIRIR--LKAFDYRVLDASTQEIVATAKRTGAQVRGPIPLPNKIEKFTVLRGPHID 60

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSRDQ E+R +KRLL I+ PTPQTVDALMKLD+AAGV+V I +
Sbjct: 61  KKSRDQFEIRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVQISV 104


>gi|114570346|ref|YP_757026.1| 30S ribosomal protein S10P [Maricaulis maris MCS10]
 gi|122315783|sp|Q0ANP9|RS10_MARMM RecName: Full=30S ribosomal protein S10
 gi|114340808|gb|ABI66088.1| SSU ribosomal protein S10P [Maricaulis maris MCS10]
          Length = 104

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 83/104 (79%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD R+LD+S REIV T K++G+ + GPIP P  I +FTV RSPH+D
Sbjct: 1   MERQNIRIR--LKAFDHRVLDNSTREIVSTAKRTGANVRGPIPLPTRIEKFTVLRSPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q E+R +KRLL I+ PTPQTVDALMKLD++AGV+V IKL
Sbjct: 59  KKSREQFEIRTHKRLLDIVDPTPQTVDALMKLDLSAGVDVEIKL 102


>gi|159042831|ref|YP_001531625.1| 30S ribosomal protein S10 [Dinoroseobacter shibae DFL 12]
 gi|157910591|gb|ABV92024.1| 30S ribosomal protein S10 [Dinoroseobacter shibae DFL 12]
          Length = 106

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 67/102 (65%), Positives = 82/102 (80%), Gaps = 2/102 (1%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           S+NIRI   LKAFD R+LD+S +EIV T K++G+Q+ GPIP P  I +FTV R PHVDKK
Sbjct: 7   SQNIRIR--LKAFDYRVLDASTQEIVNTAKRTGAQVRGPIPLPNKIEKFTVLRGPHVDKK 64

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           SRDQ E+R +KRLL I+ PTPQTVDALMKLD+AAGV+V I +
Sbjct: 65  SRDQFEIRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVQISV 106


>gi|254439628|ref|ZP_05053122.1| ribosomal protein S10 [Octadecabacter antarcticus 307]
 gi|254449690|ref|ZP_05063127.1| ribosomal protein S10 [Octadecabacter antarcticus 238]
 gi|198255074|gb|EDY79388.1| ribosomal protein S10 [Octadecabacter antarcticus 307]
 gi|198264096|gb|EDY88366.1| ribosomal protein S10 [Octadecabacter antarcticus 238]
          Length = 103

 Score =  135 bits (339), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 82/103 (79%), Gaps = 2/103 (1%)

Query: 2   TSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDK 61
            S+NIRI   LKAFD R+LD+S +EIV T K++G+ + GPIP P  I +FTV R PH+DK
Sbjct: 3   ASQNIRIR--LKAFDYRVLDASTQEIVQTAKRTGASVRGPIPLPNKIEKFTVLRGPHIDK 60

Query: 62  KSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KSRDQ E+R +KRLL I+ PTPQTVDALMKLD+AAGV+V IK+
Sbjct: 61  KSRDQFEIRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKV 103


>gi|239787562|emb|CAX84030.1| 30S ribosomal protein S10 [uncultured bacterium]
          Length = 102

 Score =  134 bits (338), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 80/100 (80%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKAFD RILD S  EIV T +++G++I GPIP P  I R+TV RSPHVDKKSR
Sbjct: 3   NQKIRIRLKAFDHRILDQSTGEIVQTARRTGAEIRGPIPLPTRISRYTVLRSPHVDKKSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q E+R +KR++ II PTPQTVDALMKLD+AAGVNV IKL
Sbjct: 63  EQFEIRTHKRVIDIINPTPQTVDALMKLDLAAGVNVEIKL 102


>gi|103488296|ref|YP_617857.1| 30S ribosomal protein S10 [Sphingopyxis alaskensis RB2256]
 gi|118597323|sp|Q1GP98|RS10_SPHAL RecName: Full=30S ribosomal protein S10
 gi|98978373|gb|ABF54524.1| SSU ribosomal protein S10P [Sphingopyxis alaskensis RB2256]
          Length = 103

 Score =  134 bits (338), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 65/104 (62%), Positives = 82/104 (78%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M ++NIRI   LKAFD R+LD +  +I  T +++G+ I GPIP P  I +FTVNR PH+D
Sbjct: 1   METQNIRIR--LKAFDHRVLDQATTDIADTARRTGALIRGPIPLPTRIEKFTVNRGPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q E+R +KRLL I++PTPQTVDALMKLD+AAGVNV IKL
Sbjct: 59  KKSREQFEVRTHKRLLDIVQPTPQTVDALMKLDLAAGVNVEIKL 102


>gi|83858567|ref|ZP_00952089.1| 30S ribosomal protein S10 [Oceanicaulis alexandrii HTCC2633]
 gi|83853390|gb|EAP91242.1| 30S ribosomal protein S10 [Oceanicaulis alexandrii HTCC2633]
          Length = 104

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 65/104 (62%), Positives = 82/104 (78%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD R+LD+S REIV T K++G+ + GPIP P  + +FTV R PHVD
Sbjct: 1   MAQQNIRIR--LKAFDHRVLDTSAREIVSTAKRTGANVRGPIPLPTRLEKFTVLRGPHVD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q E+R +KR+L I+ PTPQTVDALMKLD++AGV+V IKL
Sbjct: 59  KKSREQFEIRTHKRMLDIVDPTPQTVDALMKLDLSAGVDVEIKL 102


>gi|148554275|ref|YP_001261857.1| 30S ribosomal protein S10 [Sphingomonas wittichii RW1]
 gi|148499465|gb|ABQ67719.1| SSU ribosomal protein S10P [Sphingomonas wittichii RW1]
          Length = 103

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 65/104 (62%), Positives = 82/104 (78%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M ++NIRI   LKAFD R+LD +  +I  T +++G+ I GPIP P  I +FTVNR PH+D
Sbjct: 1   METQNIRIR--LKAFDHRVLDQATGDIADTARRTGALIRGPIPLPTRIEKFTVNRGPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q E+R YKRLL I++PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 59  KKSREQFEVRTYKRLLDIVQPTPQTVDALMKLDLAAGVDVEIKL 102


>gi|149915843|ref|ZP_01904367.1| ribosomal protein S10 [Roseobacter sp. AzwK-3b]
 gi|149810166|gb|EDM70012.1| ribosomal protein S10 [Roseobacter sp. AzwK-3b]
          Length = 102

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 83/104 (79%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+NIRI   LKAFD R+LD+S +EIV T K++G+++ GPIP P  I +FTV R PHV+
Sbjct: 1   MQSQNIRIR--LKAFDYRVLDASTQEIVNTAKRTGAEVRGPIPLPNKIEKFTVLRGPHVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSRDQ E+R +KRLL I+ PTPQTVDALMKLD+AAGV+V I +
Sbjct: 59  KKSRDQFEIRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVQISV 102


>gi|254294441|ref|YP_003060464.1| ribosomal protein S10 [Hirschia baltica ATCC 49814]
 gi|254042972|gb|ACT59767.1| ribosomal protein S10 [Hirschia baltica ATCC 49814]
          Length = 106

 Score =  134 bits (336), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 81/104 (77%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD R LD S REIV T K++G+ + GP+P P  I +FTVNRSPHV+
Sbjct: 1   MDRQNIRIR--LKAFDHRALDQSAREIVSTAKRTGADVRGPVPLPTRIEKFTVNRSPHVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q E+R +KR+L I+ PTPQTVDALMKLD++AGV V IKL
Sbjct: 59  KKSREQFEIRTHKRVLDIVDPTPQTVDALMKLDLSAGVAVEIKL 102


>gi|126732275|ref|ZP_01748075.1| 30S ribosomal protein S10 [Sagittula stellata E-37]
 gi|126707144|gb|EBA06210.1| 30S ribosomal protein S10 [Sagittula stellata E-37]
          Length = 101

 Score =  134 bits (336), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 80/100 (80%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N  I I LKAFD R+LD+S +EIV T K++G+Q+ GPIP P  I +FTV R PHV+KKSR
Sbjct: 2   NQNIRIRLKAFDFRVLDASTQEIVNTAKRTGAQVRGPIPLPNKIEKFTVLRGPHVNKKSR 61

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           DQ E+R +KRLL I+ PTPQTVDALMKLD+AAGV+V IK+
Sbjct: 62  DQFEIRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKV 101


>gi|89070558|ref|ZP_01157847.1| 30S ribosomal protein S10 [Oceanicola granulosus HTCC2516]
 gi|89043865|gb|EAR50063.1| 30S ribosomal protein S10 [Oceanicola granulosus HTCC2516]
          Length = 104

 Score =  134 bits (336), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 82/104 (78%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           + S+NIRI   LKAFD R+LD+S  EIV T K++G+ + GPIP P  I +FTV R PH+D
Sbjct: 3   IQSQNIRIR--LKAFDYRVLDASTAEIVQTAKRTGASVRGPIPLPNKIEKFTVLRGPHID 60

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSRDQ E+R +KRLL I+ PTPQTVDALMKLD+AAGV+V IK+
Sbjct: 61  KKSRDQFEIRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKV 104


>gi|77462258|ref|YP_351762.1| 30S ribosomal protein S10 [Rhodobacter sphaeroides 2.4.1]
 gi|126461134|ref|YP_001042248.1| 30S ribosomal protein S10 [Rhodobacter sphaeroides ATCC 17029]
 gi|146278569|ref|YP_001168728.1| 30S ribosomal protein S10 [Rhodobacter sphaeroides ATCC 17025]
 gi|221638112|ref|YP_002524374.1| 30S ribosomal protein S10 [Rhodobacter sphaeroides KD131]
 gi|124028642|sp|Q3J5S3|RS10_RHOS4 RecName: Full=30S ribosomal protein S10
 gi|166231768|sp|A3PGL0|RS10_RHOS1 RecName: Full=30S ribosomal protein S10
 gi|166231769|sp|A4WVK9|RS10_RHOS5 RecName: Full=30S ribosomal protein S10
 gi|254809982|sp|B9KL90|RS10_RHOSK RecName: Full=30S ribosomal protein S10
 gi|77386676|gb|ABA77861.1| SSU ribosomal protein S10P [Rhodobacter sphaeroides 2.4.1]
 gi|126102798|gb|ABN75476.1| SSU ribosomal protein S10P [Rhodobacter sphaeroides ATCC 17029]
 gi|145556810|gb|ABP71423.1| SSU ribosomal protein S10P [Rhodobacter sphaeroides ATCC 17025]
 gi|221158893|gb|ACL99872.1| 30S ribosomal protein S10 [Rhodobacter sphaeroides KD131]
          Length = 102

 Score =  134 bits (336), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 65/104 (62%), Positives = 82/104 (78%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LKAFD R+LD+S +EIV T K++G+Q+ GPIP P  I +FTV R PH+D
Sbjct: 1   MQGQTIRIR--LKAFDYRVLDASTQEIVNTAKRTGAQVRGPIPLPNKIEKFTVLRGPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSRDQ E+R +KRLL I+ PTPQTVDALMKLD+AAGV++ IK+
Sbjct: 59  KKSRDQWEIRTHKRLLDIVDPTPQTVDALMKLDLAAGVDIQIKV 102


>gi|255264326|ref|ZP_05343668.1| ribosomal protein S10 [Thalassiobium sp. R2A62]
 gi|255106661|gb|EET49335.1| ribosomal protein S10 [Thalassiobium sp. R2A62]
          Length = 106

 Score =  134 bits (336), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 81/103 (78%), Gaps = 2/103 (1%)

Query: 2   TSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDK 61
            S+NIRI   LKAFD R+LDSS +EIV T K++G+ + GPIP P  I +FTV R PHVDK
Sbjct: 3   ASQNIRIR--LKAFDYRVLDSSAQEIVNTAKRTGASVRGPIPMPNKIEKFTVLRGPHVDK 60

Query: 62  KSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KSRDQ E+R +KR+L I+ PTPQTVDALMKLD+AAGV V IK+
Sbjct: 61  KSRDQFEIRTHKRMLDIVDPTPQTVDALMKLDLAAGVAVDIKV 103


>gi|117924154|ref|YP_864771.1| 30S ribosomal protein S10P [Magnetococcus sp. MC-1]
 gi|166231282|sp|A0L5X2|RS10_MAGSM RecName: Full=30S ribosomal protein S10
 gi|117607910|gb|ABK43365.1| SSU ribosomal protein S10P [Magnetococcus sp. MC-1]
          Length = 103

 Score =  133 bits (335), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 81/104 (77%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+ IRI   LKAFD RILD S  EIV T +++G+ I GPIP P  I R+TV RSPHVD
Sbjct: 2   MESQKIRIR--LKAFDHRILDQSTGEIVQTARRTGADIRGPIPLPTKINRYTVLRSPHVD 59

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q E+R +KR++ I+ PTPQTVDALMKLD+AAGVNV IKL
Sbjct: 60  KKSREQFEIRTHKRIIDIVNPTPQTVDALMKLDLAAGVNVEIKL 103


>gi|126736645|ref|ZP_01752385.1| ribosomal protein S10 [Roseobacter sp. CCS2]
 gi|126713958|gb|EBA10829.1| ribosomal protein S10 [Roseobacter sp. CCS2]
          Length = 103

 Score =  133 bits (335), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 81/103 (78%), Gaps = 2/103 (1%)

Query: 2   TSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDK 61
            S+NIRI   LKAFD R+LD+S +EIV T K++G+ + GPIP P  I +FTV R PHVDK
Sbjct: 3   ASQNIRIR--LKAFDFRVLDASTQEIVSTAKRTGASVRGPIPLPNKIEKFTVLRGPHVDK 60

Query: 62  KSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KSRDQ E+R +KRLL II PTPQTVDALMKLD+AAGV+V I +
Sbjct: 61  KSRDQFEIRTHKRLLDIIDPTPQTVDALMKLDLAAGVDVQISV 103


>gi|241761059|ref|ZP_04759148.1| ribosomal protein S10 [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|283856273|ref|YP_003377796.1| 30S ribosomal protein S10 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241374678|gb|EER64139.1| ribosomal protein S10 [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|283775268|gb|ADB28962.1| ribosomal protein S10 [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 123

 Score =  133 bits (335), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 65/104 (62%), Positives = 81/104 (77%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M ++NIRI   LKAFD R+LD +  +I  T +++G+ I GPIP P  I +FTVNR PH+D
Sbjct: 21  MDTQNIRIR--LKAFDHRVLDQATGDIADTARRTGALIRGPIPLPTRIEKFTVNRGPHID 78

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q E+R YKRLL I++PTPQTVDALMKLD+AAGV V IKL
Sbjct: 79  KKSREQFEVRTYKRLLDIVQPTPQTVDALMKLDLAAGVEVEIKL 122


>gi|260752975|ref|YP_003225868.1| 30S ribosomal protein S10 [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|258552338|gb|ACV75284.1| ribosomal protein S10 [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
          Length = 103

 Score =  133 bits (335), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 65/104 (62%), Positives = 81/104 (77%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M ++NIRI   LKAFD R+LD +  +I  T +++G+ I GPIP P  I +FTVNR PH+D
Sbjct: 1   MDTQNIRIR--LKAFDHRVLDQATGDIADTARRTGALIRGPIPLPTRIEKFTVNRGPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q E+R YKRLL I++PTPQTVDALMKLD+AAGV V IKL
Sbjct: 59  KKSREQFEVRTYKRLLDIVQPTPQTVDALMKLDLAAGVEVEIKL 102


>gi|260577182|ref|ZP_05845159.1| ribosomal protein S10 [Rhodobacter sp. SW2]
 gi|259020656|gb|EEW23975.1| ribosomal protein S10 [Rhodobacter sp. SW2]
          Length = 102

 Score =  133 bits (335), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 81/104 (77%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LKAFD R+LD+S  EIV T K++G+Q+ GPIP P  I +FTV R PH+D
Sbjct: 1   MQGQTIRIR--LKAFDYRVLDASTLEIVNTAKRTGAQVRGPIPLPNKIEKFTVLRGPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSRDQ E+R +KRLL II PTPQTVDALMKLD+AAGV+V IK+
Sbjct: 59  KKSRDQWEIRTHKRLLDIIDPTPQTVDALMKLDLAAGVDVEIKV 102


>gi|310817009|ref|YP_003964973.1| 30S ribosomal protein S10 [Ketogulonicigenium vulgare Y25]
 gi|308755744|gb|ADO43673.1| 30S ribosomal protein S10 [Ketogulonicigenium vulgare Y25]
          Length = 104

 Score =  133 bits (334), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 65/104 (62%), Positives = 80/104 (76%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S +  I I LKAFD R+LD+S  EIV T K++G+ + GPIP P  I +FTV R PH+D
Sbjct: 1   MASSSQTIRIRLKAFDYRVLDASTAEIVSTAKRTGASVRGPIPLPNKIEKFTVLRGPHID 60

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSRDQ E+R +KRLL I+ PTPQTVDALMKLD+AAGV+V IK+
Sbjct: 61  KKSRDQFEIRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVEIKV 104


>gi|83949797|ref|ZP_00958530.1| 30S ribosomal protein S10 [Roseovarius nubinhibens ISM]
 gi|83837696|gb|EAP76992.1| 30S ribosomal protein S10 [Roseovarius nubinhibens ISM]
          Length = 102

 Score =  133 bits (334), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 82/104 (78%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+NIRI   LKAFD R+LD+S +EIV T K++G+ + GPIP P  I +FTV R PHV+
Sbjct: 1   MQSQNIRIR--LKAFDYRVLDASTQEIVNTAKRTGANVRGPIPLPNKIEKFTVLRGPHVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSRDQ E+R +KRLL I+ PTPQTVDALMKLD+AAGV+V I +
Sbjct: 59  KKSRDQFEIRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVQISV 102


>gi|85374466|ref|YP_458528.1| 30S ribosomal protein S10 [Erythrobacter litoralis HTCC2594]
 gi|85709059|ref|ZP_01040125.1| 30S ribosomal protein s10 [Erythrobacter sp. NAP1]
 gi|149184310|ref|ZP_01862628.1| 30S ribosomal protein s10 [Erythrobacter sp. SD-21]
 gi|84787549|gb|ABC63731.1| 30S ribosomal protein s10 [Erythrobacter litoralis HTCC2594]
 gi|85690593|gb|EAQ30596.1| 30S ribosomal protein s10 [Erythrobacter sp. NAP1]
 gi|148831630|gb|EDL50063.1| 30S ribosomal protein s10 [Erythrobacter sp. SD-21]
          Length = 103

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 65/104 (62%), Positives = 80/104 (76%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M ++NIRI   LKAFD R+LD +  EI  T +++G+ I GPIP P  I +FTVNR PH+D
Sbjct: 1   MEAQNIRIR--LKAFDHRVLDQATGEIADTARRTGALIRGPIPMPTRIEKFTVNRGPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q E+R YKRLL I++P  QTVDALMKLD+AAGVNV IKL
Sbjct: 59  KKSREQFEVRTYKRLLDIVQPNAQTVDALMKLDLAAGVNVEIKL 102


>gi|296282581|ref|ZP_06860579.1| 30S ribosomal protein S10 [Citromicrobium bathyomarinum JL354]
          Length = 103

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 65/104 (62%), Positives = 80/104 (76%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M ++NIRI   LKAFD R+LD +  EI  T +++G+ I GPIP P  I +FTVNR PH+D
Sbjct: 1   MDAQNIRIR--LKAFDHRVLDQATGEIADTARRTGALIRGPIPLPTRIEKFTVNRGPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q E+R YKRLL I++P  QTVDALMKLD+AAGVNV IKL
Sbjct: 59  KKSREQFEVRTYKRLLDIVQPNAQTVDALMKLDLAAGVNVEIKL 102


>gi|116748989|ref|YP_845676.1| 30S ribosomal protein S10 [Syntrophobacter fumaroxidans MPOB]
 gi|166991572|sp|A0LII9|RS10_SYNFM RecName: Full=30S ribosomal protein S10
 gi|116698053|gb|ABK17241.1| SSU ribosomal protein S10P [Syntrophobacter fumaroxidans MPOB]
          Length = 103

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 82/100 (82%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N RI I LKA+D ++LD S  EIV+T KK+G+++ GPIP P  I R+TV RSPHVDKKSR
Sbjct: 4   NQRIRIRLKAYDHKLLDQSTSEIVMTAKKTGARVAGPIPLPTKIHRYTVLRSPHVDKKSR 63

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q E+R++KRL+ I++PT QTVD+LMKLD++AGV+V IKL
Sbjct: 64  EQFEIRVHKRLIDILEPTQQTVDSLMKLDLSAGVDVEIKL 103


>gi|254417826|ref|ZP_05031550.1| ribosomal protein S10 [Brevundimonas sp. BAL3]
 gi|302382617|ref|YP_003818440.1| ribosomal protein S10 [Brevundimonas subvibrioides ATCC 15264]
 gi|329889128|ref|ZP_08267471.1| ribosomal protein S10 [Brevundimonas diminuta ATCC 11568]
 gi|196184003|gb|EDX78979.1| ribosomal protein S10 [Brevundimonas sp. BAL3]
 gi|302193245|gb|ADL00817.1| ribosomal protein S10 [Brevundimonas subvibrioides ATCC 15264]
 gi|328844429|gb|EGF93993.1| ribosomal protein S10 [Brevundimonas diminuta ATCC 11568]
          Length = 101

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 64/97 (65%), Positives = 79/97 (81%)

Query: 8   ICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQL 67
           I I LKAFD R+LD S REIV T K++G+ + GPIP P  I +FTVNRSPHVDKKSR+Q 
Sbjct: 5   IRIRLKAFDHRVLDFSTREIVNTAKRTGATVRGPIPLPTLIEKFTVNRSPHVDKKSREQF 64

Query: 68  EMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           E+R +KR+L I+ PTPQTVDALMKLD++AGV+V IK+
Sbjct: 65  EIRTHKRVLDIVDPTPQTVDALMKLDLSAGVDVEIKI 101


>gi|163796920|ref|ZP_02190877.1| 50S ribosomal protein L3 [alpha proteobacterium BAL199]
 gi|159177909|gb|EDP62458.1| 50S ribosomal protein L3 [alpha proteobacterium BAL199]
          Length = 102

 Score =  132 bits (332), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 82/104 (78%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+NIRI   LKAFD R+LD S  EIV T K++G+++ GPIP P  I RFTV R PH+D
Sbjct: 1   MDSQNIRIR--LKAFDHRVLDQSTGEIVNTAKRTGARVRGPIPLPTRIERFTVLRGPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q E+R +KR+L I+ PTPQTVDALMKLD+A+GV+V IKL
Sbjct: 59  KKSREQFEVRTHKRVLDIVDPTPQTVDALMKLDLASGVDVEIKL 102


>gi|154253176|ref|YP_001414000.1| 30S ribosomal protein S10 [Parvibaculum lavamentivorans DS-1]
 gi|171769626|sp|A7HWR0|RS10_PARL1 RecName: Full=30S ribosomal protein S10
 gi|154157126|gb|ABS64343.1| ribosomal protein S10 [Parvibaculum lavamentivorans DS-1]
          Length = 102

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 79/98 (80%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK FD R+LD S REIV T K++G+Q++GPIP P  + +FTV R PH+DKKSR+Q
Sbjct: 5   KIRIRLKGFDHRVLDVSTREIVNTAKRTGAQVLGPIPLPTRLEKFTVLRGPHIDKKSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KR+L I+ PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 65  FEIRTHKRVLDIVDPTPQTVDALMKLDLAAGVDVEIKL 102


>gi|94498475|ref|ZP_01305031.1| 30S ribosomal protein s10 [Sphingomonas sp. SKA58]
 gi|294010612|ref|YP_003544072.1| ribosomal protein S10 [Sphingobium japonicum UT26S]
 gi|307294973|ref|ZP_07574815.1| ribosomal protein S10 [Sphingobium chlorophenolicum L-1]
 gi|94422018|gb|EAT07063.1| 30S ribosomal protein s10 [Sphingomonas sp. SKA58]
 gi|292673942|dbj|BAI95460.1| ribosomal protein S10 [Sphingobium japonicum UT26S]
 gi|306879447|gb|EFN10665.1| ribosomal protein S10 [Sphingobium chlorophenolicum L-1]
          Length = 102

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 79/100 (79%), Gaps = 2/100 (2%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           NIRI   LKAFD R+LD +  +I  T +++G+ I GPIP P  I +FTVNR PH+DKKSR
Sbjct: 4   NIRIR--LKAFDHRVLDQATGDIADTARRTGALIRGPIPLPTRIEKFTVNRGPHIDKKSR 61

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q E+R YKR+L I++PTPQTVDALMKLD+AAGVNV IKL
Sbjct: 62  EQFEVRTYKRMLDIVQPTPQTVDALMKLDLAAGVNVEIKL 101


>gi|114798629|ref|YP_761530.1| 30S ribosomal protein S10 [Hyphomonas neptunium ATCC 15444]
 gi|122942157|sp|Q0BYB3|RS10_HYPNA RecName: Full=30S ribosomal protein S10
 gi|114738803|gb|ABI76928.1| ribosomal protein S10 [Hyphomonas neptunium ATCC 15444]
          Length = 106

 Score =  131 bits (330), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 63/104 (60%), Positives = 81/104 (77%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   LKAFD R LD S +EIV T K++G+++ GP+P P  I RFTVNRSPH+D
Sbjct: 1   MERQNIRIR--LKAFDHRALDMSAKEIVNTAKRTGAEVRGPVPLPTRIERFTVNRSPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q E+R + R+L I+ PTPQTVDALMKLD+++GV + IKL
Sbjct: 59  KKSREQFEIRTHTRILDIVDPTPQTVDALMKLDLSSGVGIEIKL 102


>gi|304321439|ref|YP_003855082.1| 30S ribosomal protein S10 [Parvularcula bermudensis HTCC2503]
 gi|303300341|gb|ADM09940.1| 30S ribosomal protein S10 [Parvularcula bermudensis HTCC2503]
          Length = 103

 Score =  130 bits (328), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 65/102 (63%), Positives = 83/102 (81%), Gaps = 2/102 (1%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
            +NIRI   LKAFD R+LDSS  EIV T K++G+++ GPIP P  I R+TV RSPHV+KK
Sbjct: 2   QQNIRIR--LKAFDHRVLDSSAVEIVNTAKRTGARVRGPIPLPTHIDRYTVLRSPHVNKK 59

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           SR+Q EMR +KR+L I++PTPQT+DALMKLD++AGV+V IKL
Sbjct: 60  SREQFEMRTHKRVLDILEPTPQTIDALMKLDLSAGVDVEIKL 101


>gi|289610053|emb|CBI60334.1| unnamed protein product [Sordaria macrospora]
          Length = 102

 Score =  130 bits (327), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 78/100 (78%), Gaps = 2/100 (2%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           NIRI   LKAFD R+LD +  +I  T +++G+ I GPIP P  I +FTVNR PH+DKKSR
Sbjct: 4   NIRIR--LKAFDHRVLDQAAGDIADTARRTGALIRGPIPLPTHIDKFTVNRGPHIDKKSR 61

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q E R YKRLL I++PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 62  EQFETRTYKRLLDIVQPTPQTVDALMKLDLAAGVDVEIKL 101


>gi|302344357|ref|YP_003808886.1| ribosomal protein S10 [Desulfarculus baarsii DSM 2075]
 gi|301640970|gb|ADK86292.1| ribosomal protein S10 [Desulfarculus baarsii DSM 2075]
          Length = 103

 Score =  130 bits (327), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 81/101 (80%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N +I I LKA+D R+LD S  EIV T +++G+++ GPIP P  I RFTV RSPH+DKKS
Sbjct: 3   QNQKIRIRLKAYDHRLLDQSAAEIVETARRTGAKVAGPIPLPTRINRFTVLRSPHIDKKS 62

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           R+Q E+R +KRLL I++PT QTVDALMKLD++AGV+V IKL
Sbjct: 63  REQFEIRTHKRLLDILEPTQQTVDALMKLDLSAGVDVEIKL 103


>gi|332187825|ref|ZP_08389559.1| ribosomal protein S10 [Sphingomonas sp. S17]
 gi|332012175|gb|EGI54246.1| ribosomal protein S10 [Sphingomonas sp. S17]
          Length = 102

 Score =  130 bits (326), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 79/100 (79%), Gaps = 2/100 (2%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           NIRI   LKAFD R+LD +  +I  T +++G+ I GPIP P  I +FTVNR PH+DKKSR
Sbjct: 4   NIRIR--LKAFDHRVLDQATGDIADTARRTGALIRGPIPLPTRIEKFTVNRGPHIDKKSR 61

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q E+R YKR+L I++PTPQTVDALMKLD+AAGV+V IKL
Sbjct: 62  EQFEVRTYKRMLDIVQPTPQTVDALMKLDLAAGVDVEIKL 101


>gi|254461256|ref|ZP_05074672.1| ribosomal protein S10 [Rhodobacterales bacterium HTCC2083]
 gi|206677845|gb|EDZ42332.1| ribosomal protein S10 [Rhodobacteraceae bacterium HTCC2083]
          Length = 105

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 63/97 (64%), Positives = 78/97 (80%)

Query: 8   ICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQL 67
           I I LKAFD R+LD+S +EIV T K++G+ + GPIP P  I +FTV  SPHV+KKSRDQ 
Sbjct: 9   IRIRLKAFDYRVLDASTQEIVNTAKRTGADVRGPIPLPNKIEKFTVLSSPHVNKKSRDQW 68

Query: 68  EMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           E+R +KR+L II PTPQTVDALMKLD+AAGV+V IK+
Sbjct: 69  EVRTHKRMLDIIDPTPQTVDALMKLDLAAGVDVEIKV 105


>gi|84515207|ref|ZP_01002570.1| 30S ribosomal protein S10 [Loktanella vestfoldensis SKA53]
 gi|84511366|gb|EAQ07820.1| 30S ribosomal protein S10 [Loktanella vestfoldensis SKA53]
          Length = 103

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 64/102 (62%), Positives = 79/102 (77%), Gaps = 2/102 (1%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           S+ IRI   LKAFD R+LD+S  EIV T K++G+ + GPIP P  I +FTV R PH+DKK
Sbjct: 4   SQTIRIR--LKAFDFRVLDASTAEIVSTAKRTGASVRGPIPLPNKIEKFTVLRGPHIDKK 61

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           SRDQ E+R +KRLL I+ PTPQTVDALMKLD+AAGV+V I +
Sbjct: 62  SRDQFEIRTHKRLLDIVDPTPQTVDALMKLDLAAGVDVQISV 103


>gi|254456649|ref|ZP_05070078.1| ribosomal protein S10 [Candidatus Pelagibacter sp. HTCC7211]
 gi|207083651|gb|EDZ61077.1| ribosomal protein S10 [Candidatus Pelagibacter sp. HTCC7211]
          Length = 102

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 63/104 (60%), Positives = 83/104 (79%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   L+A+D++ILD+S  EIV T K++G+ I GPIP P  I R+TV RSPH+D
Sbjct: 1   MEKQNIRIK--LRAYDNKILDASTEEIVNTVKRTGATIKGPIPLPTRIERYTVLRSPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q E R +KRL+ II+PTPQTV+ALMKLD+A+GV+V IK+
Sbjct: 59  KKSREQFESRTHKRLIDIIEPTPQTVEALMKLDLASGVDVEIKI 102


>gi|326388195|ref|ZP_08209798.1| 30S ribosomal protein S10 [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326207361|gb|EGD58175.1| 30S ribosomal protein S10 [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 103

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 63/104 (60%), Positives = 78/104 (75%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M ++NIRI   LKAFD R+LD +  EI  T +++G+ I GPIP P  I +F VNR PH+D
Sbjct: 1   MEAQNIRIR--LKAFDHRVLDQATGEIAETARRTGALIRGPIPLPTRIEKFCVNRGPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q E+R YKRLL I++P   TVDALMKLD+AAGVNV IKL
Sbjct: 59  KKSREQFEVRTYKRLLDIVQPNAATVDALMKLDLAAGVNVEIKL 102


>gi|87199269|ref|YP_496526.1| 30S ribosomal protein S10 [Novosphingobium aromaticivorans DSM
           12444]
 gi|115305639|sp|Q2G8Y1|RS10_NOVAD RecName: Full=30S ribosomal protein S10
 gi|87134950|gb|ABD25692.1| SSU ribosomal protein S10P [Novosphingobium aromaticivorans DSM
           12444]
          Length = 103

 Score =  127 bits (320), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 63/104 (60%), Positives = 78/104 (75%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M ++NIRI   LKAFD R+LD +  EI  T +++G+ I GPIP P  I +F VNR PH+D
Sbjct: 1   MEAQNIRIR--LKAFDHRVLDQATGEIADTARRTGALIRGPIPLPTRIEKFCVNRGPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q E+R YKRLL I++P   TVDALMKLD+AAGVNV IKL
Sbjct: 59  KKSREQFEVRTYKRLLDIVQPNAATVDALMKLDLAAGVNVEIKL 102


>gi|86158369|ref|YP_465154.1| 30S ribosomal protein S10 [Anaeromyxobacter dehalogenans 2CP-C]
 gi|153004773|ref|YP_001379098.1| 30S ribosomal protein S10 [Anaeromyxobacter sp. Fw109-5]
 gi|197122339|ref|YP_002134290.1| 30S ribosomal protein S10 [Anaeromyxobacter sp. K]
 gi|220917121|ref|YP_002492425.1| ribosomal protein S10 [Anaeromyxobacter dehalogenans 2CP-1]
 gi|110825778|sp|Q2IJ85|RS10_ANADE RecName: Full=30S ribosomal protein S10
 gi|166231235|sp|A7HBL8|RS10_ANADF RecName: Full=30S ribosomal protein S10
 gi|226705395|sp|B4UB99|RS10_ANASK RecName: Full=30S ribosomal protein S10
 gi|254809572|sp|B8J860|RS10_ANAD2 RecName: Full=30S ribosomal protein S10
 gi|85774880|gb|ABC81717.1| SSU ribosomal protein S10P [Anaeromyxobacter dehalogenans 2CP-C]
 gi|152028346|gb|ABS26114.1| ribosomal protein S10 [Anaeromyxobacter sp. Fw109-5]
 gi|196172188|gb|ACG73161.1| ribosomal protein S10 [Anaeromyxobacter sp. K]
 gi|219954975|gb|ACL65359.1| ribosomal protein S10 [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 101

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 82/103 (79%), Gaps = 2/103 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M ++ IRI   LKA+D ++LD S  EIV T K++G+++ GPIP P  I +FTV RSPHVD
Sbjct: 1   MATQKIRIR--LKAYDYKLLDQSAGEIVETAKRTGAKVAGPIPLPTRINKFTVLRSPHVD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           KKSR+Q E+R +KRLL I++PTPQT+DALMKLD++AGV+V IK
Sbjct: 59  KKSREQFEIRTHKRLLDILEPTPQTLDALMKLDLSAGVDVEIK 101


>gi|42524376|ref|NP_969756.1| 30S ribosomal protein S10 [Bdellovibrio bacteriovorus HD100]
 gi|54036364|sp|Q6MJ14|RS10_BDEBA RecName: Full=30S ribosomal protein S10
 gi|39576585|emb|CAE80749.1| 30S ribosomal protein S10 [Bdellovibrio bacteriovorus HD100]
          Length = 105

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 62/104 (59%), Positives = 82/104 (78%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+ IRI   LKAFD ++LD S +EIV T +++G+++ GPIP P  I R+TV RSPHVD
Sbjct: 1   MQSQKIRIR--LKAFDHKLLDQSTKEIVETARRTGAKVAGPIPLPTRINRYTVLRSPHVD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q E+R +KR+L I++PT QTVD LMKLD++AGV+V IKL
Sbjct: 59  KKSREQFEVRTHKRMLDILEPTQQTVDQLMKLDLSAGVDVEIKL 102


>gi|108763296|ref|YP_631498.1| 30S ribosomal protein S10 [Myxococcus xanthus DK 1622]
 gi|118597188|sp|Q1D775|RS10_MYXXD RecName: Full=30S ribosomal protein S10
 gi|108467176|gb|ABF92361.1| ribosomal protein S10 [Myxococcus xanthus DK 1622]
          Length = 102

 Score =  127 bits (319), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 82/103 (79%), Gaps = 2/103 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M ++ IRI   LKA+DS++LD S  EIV T K++G+++ GPIP P  I +FTV RSPHVD
Sbjct: 1   MATQKIRIR--LKAYDSKLLDQSAGEIVETAKRTGAKVAGPIPLPTRINKFTVLRSPHVD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           KKSR+Q E+R +KRLL I++PT QT+DALMKLD++AGV+V IK
Sbjct: 59  KKSREQFEIRTHKRLLDILEPTQQTLDALMKLDLSAGVDVEIK 101


>gi|115376065|ref|ZP_01463310.1| ribosomal protein S10 [Stigmatella aurantiaca DW4/3-1]
 gi|310820994|ref|YP_003953352.1| 30S ribosomal protein S10 [Stigmatella aurantiaca DW4/3-1]
 gi|115366880|gb|EAU65870.1| ribosomal protein S10 [Stigmatella aurantiaca DW4/3-1]
 gi|309394066|gb|ADO71525.1| 30S ribosomal protein S10 [Stigmatella aurantiaca DW4/3-1]
          Length = 102

 Score =  127 bits (318), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 60/97 (61%), Positives = 79/97 (81%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+DS++LD S  EIV T K++G+++ GPIP P  I +FTV RSPHVDKKSR+Q
Sbjct: 5   KIRIRLKAYDSKLLDQSAGEIVETAKRTGAKVAGPIPLPTRINKFTVLRSPHVDKKSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E+R +KRLL I++PT QT+DALMKLD++AGV+V IK
Sbjct: 65  FEIRTHKRLLDILEPTQQTLDALMKLDLSAGVDVEIK 101


>gi|158520724|ref|YP_001528594.1| ribosomal protein S10 [Desulfococcus oleovorans Hxd3]
 gi|158509550|gb|ABW66517.1| ribosomal protein S10 [Desulfococcus oleovorans Hxd3]
          Length = 101

 Score =  127 bits (318), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 79/100 (79%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA+D ++LD S  +IV T +K+G++IVGPIP P  I +F V RSPHVDKKSR
Sbjct: 2   NTKIRIKLKAYDHKLLDQSALDIVDTARKTGARIVGPIPLPTRINKFCVLRSPHVDKKSR 61

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KRLL II+PT QTVDALMKLD++ GV+V IKL
Sbjct: 62  EQFEMRTHKRLLDIIEPTQQTVDALMKLDLSPGVDVAIKL 101


>gi|162449112|ref|YP_001611479.1| 30S ribosomal protein S10 [Sorangium cellulosum 'So ce 56']
 gi|161159694|emb|CAN90999.1| 30S ribosomal protein S10 [Sorangium cellulosum 'So ce 56']
          Length = 103

 Score =  127 bits (318), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 60/97 (61%), Positives = 77/97 (79%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD ++LD S  +IV T K++G+ + GPIP P  IRR+TV R PHVDKKSR+Q
Sbjct: 6   KIRIRLKAFDHQLLDKSTSDIVETAKRTGAHVAGPIPLPTEIRRYTVLRGPHVDKKSREQ 65

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E+R +KRLL II+PT QT+DALMKLD++AGV+V IK
Sbjct: 66  FEIRTHKRLLDIIEPTQQTLDALMKLDLSAGVDVEIK 102


>gi|22203342|gb|AAM92277.1| ribosomal protein S10 [Rhodobacter capsulatus]
          Length = 93

 Score =  126 bits (317), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 76/95 (80%), Gaps = 2/95 (2%)

Query: 1  MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
          M+ +NIRI   LKAFD R+LD+S +EIV T K++G+Q+ GPIP P  I +FTV R PH+D
Sbjct: 1  MSGQNIRIR--LKAFDYRVLDASTQEIVNTAKRTGAQVRGPIPLPNKIEKFTVLRGPHID 58

Query: 61 KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIA 95
          KKSRDQ E+R +KRLL I+ PTPQTVDALMKLD+A
Sbjct: 59 KKSRDQWEIRTHKRLLDIVDPTPQTVDALMKLDLA 93


>gi|71083805|ref|YP_266525.1| 30S ribosomal protein S10 [Candidatus Pelagibacter ubique HTCC1062]
 gi|91763159|ref|ZP_01265123.1| 30S ribosomal protein S10 [Candidatus Pelagibacter ubique HTCC1002]
 gi|115305642|sp|Q4FLL7|RS10_PELUB RecName: Full=30S ribosomal protein S10
 gi|71062918|gb|AAZ21921.1| 30S ribosomal protein S10 [Candidatus Pelagibacter ubique HTCC1062]
 gi|91717572|gb|EAS84223.1| 30S ribosomal protein S10 [Candidatus Pelagibacter ubique HTCC1002]
          Length = 102

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 61/104 (58%), Positives = 82/104 (78%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +NIRI   L+A+D++ILD+S  EIV T K++G+ I GPIP P  I R+TV + PH+D
Sbjct: 1   MEKQNIRIK--LRAYDNKILDASTEEIVNTVKRTGATIKGPIPLPTRIERYTVLKGPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q E R +KRL+ II+PTPQTV+ALMKLD+A+GV+V IK+
Sbjct: 59  KKSREQFETRTHKRLIDIIEPTPQTVEALMKLDLASGVDVEIKI 102


>gi|302036664|ref|YP_003796986.1| 30S ribosomal protein S10 [Candidatus Nitrospira defluvii]
 gi|300604728|emb|CBK41060.1| 30S ribosomal protein S10 [Candidatus Nitrospira defluvii]
          Length = 103

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 80/98 (81%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I L+ FD R+LD S+ EIV T ++SG+++VGPIP P  I +FTV RS HVDKKSR+Q
Sbjct: 6   RIRIRLRGFDYRVLDQSVVEIVETVRRSGARVVGPIPLPTRIEKFTVQRSTHVDKKSREQ 65

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRLL I++PTP+T+D+LMKL++AAGV+V IKL
Sbjct: 66  FEIRTHKRLLDIMEPTPETMDSLMKLNLAAGVDVEIKL 103


>gi|258591315|emb|CBE67614.1| 30S ribosomal subunit protein S10 [NC10 bacterium 'Dutch sediment']
          Length = 102

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 77/100 (77%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N RI I LKA+D RILD S +EIV T +++G+++ GPIP P  I RFTV RSPH+DKKSR
Sbjct: 3   NQRIRIRLKAYDHRILDQSAKEIVNTAQRTGARVSGPIPLPTKISRFTVLRSPHIDKKSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR + RL+ I+   PQTVDALM+LD+ AGV+V IKL
Sbjct: 63  EQFEMRTHLRLMDILDAQPQTVDALMRLDLPAGVDVEIKL 102


>gi|288942073|ref|YP_003444313.1| 30S ribosomal protein S10 [Allochromatium vinosum DSM 180]
 gi|288897445|gb|ADC63281.1| ribosomal protein S10 [Allochromatium vinosum DSM 180]
          Length = 103

 Score =  125 bits (313), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 77/100 (77%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N RI I LKAFD R++D S REIV T K++G+Q+ GP+P P    RFTV  SPHV+K +R
Sbjct: 3   NQRIRIRLKAFDHRLIDQSAREIVDTAKRTGAQVRGPVPLPSKKERFTVLVSPHVNKDAR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           DQ E+R +KRL+ I+ PT +TVDALMKLD+AAGV+V IKL
Sbjct: 63  DQYELRTHKRLMDIVDPTDKTVDALMKLDLAAGVDVQIKL 102


>gi|94987401|ref|YP_595334.1| 30S ribosomal protein S10 [Lawsonia intracellularis PHE/MN1-00]
 gi|118597184|sp|Q1MPR4|RS10_LAWIP RecName: Full=30S ribosomal protein S10
 gi|94731650|emb|CAJ55013.1| ribosomal protein S10 [Lawsonia intracellularis PHE/MN1-00]
          Length = 105

 Score =  125 bits (313), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 77/98 (78%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I LKA+D RILD ++ EIV T + +G+ I GPIP P +I +FTVNRS HVDKKSR+Q
Sbjct: 8   RIRIKLKAYDYRILDKAVAEIVDTARNTGASIAGPIPLPTNIHKFTVNRSVHVDKKSREQ 67

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMRI+KRL+ I++PT QTVDAL KL + AGV+V IKL
Sbjct: 68  FEMRIHKRLMDILEPTQQTVDALGKLSLPAGVDVEIKL 105


>gi|121997650|ref|YP_001002437.1| 30S ribosomal protein S10 [Halorhodospira halophila SL1]
 gi|121589055|gb|ABM61635.1| SSU ribosomal protein S10P [Halorhodospira halophila SL1]
          Length = 109

 Score =  125 bits (313), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 62/102 (60%), Positives = 78/102 (76%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           ++N RI I LKAFD R++D S REIV T K++G+ + GPIP P    RFTV  SPHV+K 
Sbjct: 7   TQNQRIRIRLKAFDHRLIDQSAREIVDTAKRTGAHVCGPIPLPVKKERFTVLTSPHVNKD 66

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +RDQ E+R +KRL+ II PT +TVDALMKLD+AAGV+V IKL
Sbjct: 67  ARDQYEIRTHKRLMDIIDPTDKTVDALMKLDLAAGVDVQIKL 108


>gi|37912992|gb|AAR05321.1| ribosomal protein S10 [uncultured marine alpha proteobacterium
           HOT2C01]
          Length = 102

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 62/104 (59%), Positives = 81/104 (77%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M ++NI+I   LKAFD  +LD S  EIV T K++G+ + GPIP P +  +FTV RSPHV+
Sbjct: 1   MENQNIKIR--LKAFDHGVLDKSSVEIVDTAKRTGAMVKGPIPLPTNNEKFTVLRSPHVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q E+R +KRL+ I+ PTPQTVDALMKLD+A+GV+V IKL
Sbjct: 59  KKSREQFEIRTHKRLIEIVDPTPQTVDALMKLDLASGVDVEIKL 102


>gi|291286311|ref|YP_003503127.1| 30S ribosomal protein S10 [Denitrovibrio acetiphilus DSM 12809]
 gi|290883471|gb|ADD67171.1| ribosomal protein S10 [Denitrovibrio acetiphilus DSM 12809]
          Length = 102

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 81/101 (80%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
            N +I I LKAFD +ILD ++++IV T K++G+++VGPIP P  I +FTV RSPHV+KK+
Sbjct: 2   ENQKIRIKLKAFDYKILDKAVKDIVSTAKRTGAEVVGPIPLPTRIEKFTVLRSPHVNKKA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRL+ I +  PQT+DALMKL+++AGV+V IKL
Sbjct: 62  RDQFEVRTHKRLIDIFEHNPQTIDALMKLELSAGVDVEIKL 102


>gi|46579713|ref|YP_010521.1| 30S ribosomal protein S10 [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|78357301|ref|YP_388750.1| 30S ribosomal protein S10 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|120602810|ref|YP_967210.1| 30S ribosomal protein S10 [Desulfovibrio vulgaris DP4]
 gi|54036376|sp|Q72CI1|RS10_DESVH RecName: Full=30S ribosomal protein S10
 gi|115305620|sp|Q30Z41|RS10_DESDG RecName: Full=30S ribosomal protein S10
 gi|166231267|sp|A1VEB7|RS10_DESVV RecName: Full=30S ribosomal protein S10
 gi|46449128|gb|AAS95780.1| ribosomal protein S10 [Desulfovibrio vulgaris str. Hildenborough]
 gi|78219706|gb|ABB39055.1| SSU ribosomal protein S10P [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|120563039|gb|ABM28783.1| SSU ribosomal protein S10P [Desulfovibrio vulgaris DP4]
 gi|311233504|gb|ADP86358.1| ribosomal protein S10 [Desulfovibrio vulgaris RCH1]
          Length = 105

 Score =  124 bits (311), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 77/98 (78%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I LKA+D RILD ++ EIV T + +G+ + GPIP P +I +FTVNRS HVDKKSR+Q
Sbjct: 8   RIRIKLKAYDYRILDKAVAEIVDTARNTGAGVAGPIPLPTNIHKFTVNRSVHVDKKSREQ 67

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMRI+KRL+ I++PT QTVDAL KL + AGV+V IKL
Sbjct: 68  FEMRIHKRLMDILEPTQQTVDALGKLSLPAGVDVEIKL 105


>gi|317485823|ref|ZP_07944687.1| ribosomal protein S10 [Bilophila wadsworthia 3_1_6]
 gi|316922929|gb|EFV44151.1| ribosomal protein S10 [Bilophila wadsworthia 3_1_6]
          Length = 105

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 77/98 (78%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I LKA+D RILD ++ EIV T + +G+ + GPIP P +I +FTVNRS HVDKKSR+Q
Sbjct: 8   RIRIKLKAYDYRILDKAVAEIVDTARNTGAGVAGPIPLPTNINKFTVNRSVHVDKKSREQ 67

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMRI+KRL+ I++PT QTVDAL KL + AGV+V IKL
Sbjct: 68  FEMRIHKRLMDILEPTQQTVDALGKLSLPAGVDVEIKL 105


>gi|77918314|ref|YP_356129.1| 30S ribosomal protein S10 [Pelobacter carbinolicus DSM 2380]
 gi|115305640|sp|Q3A6P8|RS10_PELCD RecName: Full=30S ribosomal protein S10
 gi|77544397|gb|ABA87959.1| SSU ribosomal protein S10P [Pelobacter carbinolicus DSM 2380]
          Length = 102

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 62/104 (59%), Positives = 81/104 (77%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+ IRI   LKA+D ++LD S+ EIV T K++G+++ GPIP P  I ++ V R PHVD
Sbjct: 1   MQSQKIRIR--LKAYDHKLLDLSVNEIVDTAKRTGARVAGPIPLPTIINKYCVLRGPHVD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q EMR +KRLL I++PT QTVDALMKLD++AGV+V IKL
Sbjct: 59  KKSREQFEMRTHKRLLDIVEPTQQTVDALMKLDLSAGVDVEIKL 102


>gi|169632349|ref|YP_001706085.1| 30S ribosomal protein S10 [Acinetobacter baumannii SDF]
 gi|169794593|ref|YP_001712386.1| 30S ribosomal protein S10 [Acinetobacter baumannii AYE]
 gi|260549841|ref|ZP_05824057.1| 30S ribosomal protein S10 [Acinetobacter sp. RUH2624]
 gi|260557026|ref|ZP_05829243.1| ribosomal protein S10 [Acinetobacter baumannii ATCC 19606]
 gi|262280226|ref|ZP_06058010.1| 30S ribosomal protein S10 [Acinetobacter calcoaceticus RUH2202]
 gi|262370579|ref|ZP_06063904.1| 30S ribosomal protein S10 [Acinetobacter johnsonii SH046]
 gi|262373522|ref|ZP_06066800.1| ribosomal protein S10 [Acinetobacter junii SH205]
 gi|262377313|ref|ZP_06070537.1| ribosomal protein S10 [Acinetobacter lwoffii SH145]
 gi|262380349|ref|ZP_06073503.1| ribosomal protein S10 [Acinetobacter radioresistens SH164]
 gi|169147520|emb|CAM85381.1| 30S ribosomal protein S10 [Acinetobacter baumannii AYE]
 gi|169151141|emb|CAO99813.1| 30S ribosomal protein S10 [Acinetobacter baumannii]
 gi|260407091|gb|EEX00568.1| 30S ribosomal protein S10 [Acinetobacter sp. RUH2624]
 gi|260409632|gb|EEX02933.1| ribosomal protein S10 [Acinetobacter baumannii ATCC 19606]
 gi|262258004|gb|EEY76738.1| 30S ribosomal protein S10 [Acinetobacter calcoaceticus RUH2202]
 gi|262297795|gb|EEY85710.1| ribosomal protein S10 [Acinetobacter radioresistens SH164]
 gi|262307766|gb|EEY88905.1| ribosomal protein S10 [Acinetobacter lwoffii SH145]
 gi|262311275|gb|EEY92361.1| ribosomal protein S10 [Acinetobacter junii SH205]
 gi|262314379|gb|EEY95421.1| 30S ribosomal protein S10 [Acinetobacter johnsonii SH046]
 gi|322509509|gb|ADX04963.1| 30S ribosomal protein S10 [Acinetobacter baumannii 1656-2]
 gi|323519529|gb|ADX93910.1| 30S ribosomal protein S10 [Acinetobacter baumannii TCDC-AB0715]
          Length = 108

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 77/100 (77%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N RI I LK+FD R++D S +EIV T K++G+Q+ GPIP P  I RF V  SPHV+K +R
Sbjct: 8   NQRIRIRLKSFDHRLIDQSAQEIVETAKRTGAQVCGPIPMPTRIERFNVLTSPHVNKDAR 67

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           DQ E+R YKRL+ I++PT +TVDALMKLD+AAGV+V I L
Sbjct: 68  DQYEIRTYKRLIDIVQPTDKTVDALMKLDLAAGVDVQIAL 107


>gi|308272980|emb|CBX29584.1| 30S ribosomal protein S10 [uncultured Desulfobacterium sp.]
          Length = 103

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 78/100 (78%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA+D ++LD S  +IV T  K+G++++GPIP P  I ++ V RSPH+DKKSR
Sbjct: 4   NTKIRIKLKAYDHKLLDQSASDIVDTANKTGAKVIGPIPLPTRINKYCVLRSPHIDKKSR 63

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KRLL II+PT QTVDALMKLD++ GV+V IKL
Sbjct: 64  EQFEMRTHKRLLDIIEPTQQTVDALMKLDLSPGVDVEIKL 103


>gi|196228454|ref|ZP_03127321.1| ribosomal protein S10 [Chthoniobacter flavus Ellin428]
 gi|196227857|gb|EDY22360.1| ribosomal protein S10 [Chthoniobacter flavus Ellin428]
          Length = 102

 Score =  123 bits (309), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 62/104 (59%), Positives = 79/104 (75%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           MT + IRI   LKAFD R+LD S  EIV T K++G+++ GPIP P  I +FTVNRSPHVD
Sbjct: 1   MTGQRIRIR--LKAFDFRMLDQSSAEIVETAKRTGAKVAGPIPLPTRIEKFTVNRSPHVD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKS DQ E+R +KRLL II+PT +TVD L KL++ AGV++ IK+
Sbjct: 59  KKSMDQFEVRTHKRLLDIIEPTAKTVDELKKLNLPAGVDITIKI 102


>gi|126643096|ref|YP_001086080.1| 30S ribosomal protein S10 [Acinetobacter baumannii ATCC 17978]
 gi|184159599|ref|YP_001847938.1| 30S ribosomal protein S10 [Acinetobacter baumannii ACICU]
 gi|213158836|ref|YP_002320834.1| ribosomal protein S10 [Acinetobacter baumannii AB0057]
 gi|215482182|ref|YP_002324364.1| ribosomal protein S10 [Acinetobacter baumannii AB307-0294]
 gi|239503235|ref|ZP_04662545.1| 30S ribosomal protein S10 [Acinetobacter baumannii AB900]
 gi|255319816|ref|ZP_05361021.1| ribosomal protein S10 [Acinetobacter radioresistens SK82]
 gi|293610823|ref|ZP_06693123.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|294842652|ref|ZP_06787335.1| 30S ribosomal protein S10 [Acinetobacter sp. 6014059]
 gi|299768665|ref|YP_003730691.1| 30S ribosomal protein S10 [Acinetobacter sp. DR1]
 gi|301345009|ref|ZP_07225750.1| 30S ribosomal protein S10 [Acinetobacter baumannii AB056]
 gi|301512060|ref|ZP_07237297.1| 30S ribosomal protein S10 [Acinetobacter baumannii AB058]
 gi|301596103|ref|ZP_07241111.1| 30S ribosomal protein S10 [Acinetobacter baumannii AB059]
 gi|166231230|sp|A3M984|RS10_ACIBT RecName: Full=30S ribosomal protein S10
 gi|226705385|sp|B7GW01|RS10_ACIB3 RecName: Full=30S ribosomal protein S10
 gi|226705386|sp|B7IA40|RS10_ACIB5 RecName: Full=30S ribosomal protein S10
 gi|226705387|sp|B2HZM3|RS10_ACIBC RecName: Full=30S ribosomal protein S10
 gi|126388980|gb|ABO13478.1| 30S ribosomal protein S10 [Acinetobacter baumannii ATCC 17978]
 gi|183211193|gb|ACC58591.1| 30S ribosomal protein S10 [Acinetobacter baumannii ACICU]
 gi|213057996|gb|ACJ42898.1| ribosomal protein S10 [Acinetobacter baumannii AB0057]
 gi|213988572|gb|ACJ58871.1| ribosomal protein S10 [Acinetobacter baumannii AB307-0294]
 gi|255303135|gb|EET82347.1| ribosomal protein S10 [Acinetobacter radioresistens SK82]
 gi|292827167|gb|EFF85532.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|298698753|gb|ADI89318.1| 30S ribosomal protein S10 [Acinetobacter sp. DR1]
          Length = 103

 Score =  123 bits (309), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 77/100 (77%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N RI I LK+FD R++D S +EIV T K++G+Q+ GPIP P  I RF V  SPHV+K +R
Sbjct: 3   NQRIRIRLKSFDHRLIDQSAQEIVETAKRTGAQVCGPIPMPTRIERFNVLTSPHVNKDAR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           DQ E+R YKRL+ I++PT +TVDALMKLD+AAGV+V I L
Sbjct: 63  DQYEIRTYKRLIDIVQPTDKTVDALMKLDLAAGVDVQIAL 102


>gi|53803547|ref|YP_114789.1| 30S ribosomal protein S10 [Methylococcus capsulatus str. Bath]
 gi|81681357|sp|Q605B1|RS10_METCA RecName: Full=30S ribosomal protein S10
 gi|53757308|gb|AAU91599.1| ribosomal protein S10 [Methylococcus capsulatus str. Bath]
          Length = 103

 Score =  123 bits (309), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 77/98 (78%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I LKAFD R++D S  EIV T K++G+Q++GPIP P    RFTV  SPHV+K +RDQ
Sbjct: 5   RIRIRLKAFDHRLIDQSASEIVETAKRTGAQVLGPIPLPTKKERFTVLVSPHVNKDARDQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRL+ II+PT +TVDALM+LD+AAGV+V IKL
Sbjct: 65  YELRTHKRLMDIIEPTDKTVDALMRLDLAAGVDVQIKL 102


>gi|320352916|ref|YP_004194255.1| 30S ribosomal protein S10P [Desulfobulbus propionicus DSM 2032]
 gi|320121418|gb|ADW16964.1| SSU ribosomal protein S10P [Desulfobulbus propionicus DSM 2032]
          Length = 104

 Score =  123 bits (309), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 79/98 (80%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK +D ++LD S REIV T +++G+ +VGPIP P S  +FTV RSPHVDKKSR+Q
Sbjct: 6   KIRIRLKGYDHKLLDLSTREIVDTARRTGATVVGPIPLPTSTNKFTVLRSPHVDKKSREQ 65

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR ++RLL I++PT QT+D+LMKL+++AGV+V IKL
Sbjct: 66  FEMRTHRRLLDILEPTQQTIDSLMKLELSAGVDVEIKL 103


>gi|118602212|ref|YP_903427.1| SSU ribosomal protein S10P [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
 gi|166231775|sp|A1AVJ9|RS10_RUTMC RecName: Full=30S ribosomal protein S10
 gi|118567151|gb|ABL01956.1| SSU ribosomal protein S10P [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
          Length = 103

 Score =  123 bits (309), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 62/104 (59%), Positives = 79/104 (75%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M+++NIRI   LKAFD R++D S  EIV T K++G+ + GPIP P    RFTV  SPHV+
Sbjct: 1   MSNQNIRIK--LKAFDHRLIDKSALEIVETAKRTGASVRGPIPLPTKKERFTVLTSPHVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KK+RDQ E+R Y RL+ +I PT +TVDALMKLD+AAGV+V IKL
Sbjct: 59  KKARDQYELRTYVRLMDVISPTDKTVDALMKLDLAAGVDVAIKL 102


>gi|325123605|gb|ADY83128.1| 30S ribosomal protein S10 [Acinetobacter calcoaceticus PHEA-2]
          Length = 111

 Score =  123 bits (309), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 77/100 (77%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N RI I LK+FD R++D S +EIV T K++G+Q+ GPIP P  I RF V  SPHV+K +R
Sbjct: 11  NQRIRIRLKSFDHRLIDQSAQEIVETAKRTGAQVCGPIPMPTRIERFNVLTSPHVNKDAR 70

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           DQ E+R YKRL+ I++PT +TVDALMKLD+AAGV+V I L
Sbjct: 71  DQYEIRTYKRLIDIVQPTDKTVDALMKLDLAAGVDVQIAL 110


>gi|50086216|ref|YP_047726.1| 30S ribosomal protein S10 [Acinetobacter sp. ADP1]
 gi|49532192|emb|CAG69904.1| 30S ribosomal protein S10 [Acinetobacter sp. ADP1]
          Length = 108

 Score =  123 bits (309), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 77/100 (77%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N RI I LK+FD R++D S +EIV T K++G+Q+ GPIP P  I RF V  SPHV+K +R
Sbjct: 8   NQRIRIRLKSFDHRLIDQSSQEIVETAKRTGAQVCGPIPMPTRIERFNVLTSPHVNKDAR 67

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           DQ E+R YKRL+ I++PT +TVDALMKLD+AAGV+V I L
Sbjct: 68  DQYEIRTYKRLIDIVQPTDKTVDALMKLDLAAGVDVQIAL 107


>gi|148244328|ref|YP_001219022.1| 30S ribosomal protein S10 [Candidatus Vesicomyosocius okutanii HA]
 gi|166231795|sp|A5CXK3|RS10_VESOH RecName: Full=30S ribosomal protein S10
 gi|146326155|dbj|BAF61298.1| 30S ribosomal protein S10 [Candidatus Vesicomyosocius okutanii HA]
          Length = 103

 Score =  123 bits (309), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 62/104 (59%), Positives = 79/104 (75%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M+++NIRI   LKAFD R++D S  EIV T K++G+ + GPIP P    RFTV  SPHV+
Sbjct: 1   MSNQNIRIK--LKAFDHRLIDKSAVEIVETAKRTGASVRGPIPLPTKKERFTVLTSPHVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KK+RDQ E+R Y RL+ +I PT +TVDALMKLD+AAGV+V IKL
Sbjct: 59  KKARDQYELRTYVRLMDVISPTDKTVDALMKLDLAAGVDVAIKL 102


>gi|218885186|ref|YP_002434507.1| 30S ribosomal protein S10 [Desulfovibrio vulgaris str. 'Miyazaki
           F']
 gi|226705434|sp|B8DN95|RS10_DESVM RecName: Full=30S ribosomal protein S10
 gi|66766344|dbj|BAD99040.1| ribosomal protein S10 [Desulfovibrio vulgaris]
 gi|218756140|gb|ACL07039.1| ribosomal protein S10 [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 105

 Score =  123 bits (308), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 77/98 (78%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I LKA+D RILD ++ EIV T + +G+ + GPIP P +I ++TVNRS HVDKKSR+Q
Sbjct: 8   RIRIKLKAYDYRILDKAVAEIVDTARNTGAGVAGPIPLPTNIHKYTVNRSVHVDKKSREQ 67

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMRI+KRL+ I++PT QTVDAL KL + AGV+V IKL
Sbjct: 68  FEMRIHKRLMDILEPTQQTVDALGKLSLPAGVDVEIKL 105


>gi|90020606|ref|YP_526433.1| 30S ribosomal protein S10 [Saccharophagus degradans 2-40]
 gi|118597316|sp|Q21M58|RS10_SACD2 RecName: Full=30S ribosomal protein S10
 gi|89950206|gb|ABD80221.1| SSU ribosomal protein S10P [Saccharophagus degradans 2-40]
          Length = 103

 Score =  123 bits (308), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 78/101 (77%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LKAFD +++D+S +EIV T K++G+Q+ GPIP P    R+TV  SPHV+K +
Sbjct: 2   QNQRIRIRLKAFDHKLIDASTQEIVETAKRTGAQVRGPIPLPTRKERYTVLVSPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R YKRLL I++PT +TVDALMKLD+AAGV V I L
Sbjct: 62  RDQYEIRTYKRLLDIVEPTEKTVDALMKLDLAAGVEVQISL 102


>gi|226953870|ref|ZP_03824334.1| 30S ribosomal protein S10 [Acinetobacter sp. ATCC 27244]
 gi|294651635|ref|ZP_06728939.1| 30S ribosomal protein S10 [Acinetobacter haemolyticus ATCC 19194]
 gi|226835353|gb|EEH67736.1| 30S ribosomal protein S10 [Acinetobacter sp. ATCC 27244]
 gi|292822484|gb|EFF81383.1| 30S ribosomal protein S10 [Acinetobacter haemolyticus ATCC 19194]
          Length = 115

 Score =  123 bits (308), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 77/100 (77%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N RI I LK+FD R++D S +EIV T K++G+Q+ GPIP P  I RF V  SPHV+K +R
Sbjct: 15  NQRIRIRLKSFDHRLIDQSAQEIVETAKRTGAQVCGPIPMPTRIERFNVLTSPHVNKDAR 74

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           DQ E+R YKRL+ I++PT +TVDALMKLD+AAGV+V I L
Sbjct: 75  DQYEIRTYKRLIDIVQPTDKTVDALMKLDLAAGVDVQIAL 114


>gi|118595831|sp|Q6F7R1|RS10_ACIAD RecName: Full=30S ribosomal protein S10
          Length = 103

 Score =  123 bits (308), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 77/100 (77%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N RI I LK+FD R++D S +EIV T K++G+Q+ GPIP P  I RF V  SPHV+K +R
Sbjct: 3   NQRIRIRLKSFDHRLIDQSSQEIVETAKRTGAQVCGPIPMPTRIERFNVLTSPHVNKDAR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           DQ E+R YKRL+ I++PT +TVDALMKLD+AAGV+V I L
Sbjct: 63  DQYEIRTYKRLIDIVQPTDKTVDALMKLDLAAGVDVQIAL 102


>gi|328953159|ref|YP_004370493.1| 30S ribosomal protein S10 [Desulfobacca acetoxidans DSM 11109]
 gi|328453483|gb|AEB09312.1| 30S ribosomal protein S10 [Desulfobacca acetoxidans DSM 11109]
          Length = 102

 Score =  123 bits (308), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 78/98 (79%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I L++FD ++LD S+ EIV T +++G+ + GPIP P  I +F V RSPHVDKKSR+Q
Sbjct: 5   KIRIRLRSFDHKLLDQSVGEIVETARRTGAMVAGPIPLPTDINKFCVLRSPHVDKKSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRLL I++PT QTVDALMKLD+AAGV+V IKL
Sbjct: 65  FEVRTHKRLLDILEPTQQTVDALMKLDLAAGVDVEIKL 102


>gi|88812758|ref|ZP_01128004.1| Ribosomal protein S10 [Nitrococcus mobilis Nb-231]
 gi|88789996|gb|EAR21117.1| Ribosomal protein S10 [Nitrococcus mobilis Nb-231]
          Length = 104

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 75/98 (76%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I LKAFD R++D S REIV T K++G+Q+ GP+P P    RFTV  SPHV+K +RDQ
Sbjct: 6   RIRIRLKAFDYRLIDQSAREIVETAKRTGAQVKGPVPLPTKKERFTVLVSPHVNKDARDQ 65

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PT +TVDALMKLD+AAGV V IK+
Sbjct: 66  YEMRTHKRLMDIVDPTDKTVDALMKLDLAAGVEVQIKV 103


>gi|124514444|gb|EAY55957.1| ribosomal protein S10 [Leptospirillum rubarum]
          Length = 101

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 77/98 (78%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK +D R+LD S+ EIV T K++G+ + GPIP P  I +FTV RSPHVDKKSR+Q
Sbjct: 4   KIRIRLKGYDYRLLDQSLLEIVSTAKRTGASVKGPIPLPTKIEKFTVLRSPHVDKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R +KRLL I++PTP+TVDALMKL++ +GV+V IKL
Sbjct: 64  FERRTHKRLLDILEPTPETVDALMKLELPSGVDVEIKL 101


>gi|118579118|ref|YP_900368.1| 30S ribosomal protein S10 [Pelobacter propionicus DSM 2379]
 gi|166231306|sp|A1ALU0|RS10_PELPD RecName: Full=30S ribosomal protein S10
 gi|118501828|gb|ABK98310.1| SSU ribosomal protein S10P [Pelobacter propionicus DSM 2379]
          Length = 102

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 62/104 (59%), Positives = 80/104 (76%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+ IRI   LKA+D ++LD S+ EIV T K++G+++ GPIP P  I ++ V R PHVD
Sbjct: 1   MQSQKIRIR--LKAYDHKLLDVSVTEIVDTAKRTGARVAGPIPLPTVINKYCVLRGPHVD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSRDQ E+R +KRL+ I+ PT QTVDALMKLD+AAGV+V IKL
Sbjct: 59  KKSRDQFEIRTHKRLIDILDPTQQTVDALMKLDLAAGVDVEIKL 102


>gi|85858145|ref|YP_460347.1| 30S ribosomal protein S10P [Syntrophus aciditrophicus SB]
 gi|85721236|gb|ABC76179.1| SSU ribosomal protein S10P [Syntrophus aciditrophicus SB]
          Length = 109

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 80/100 (80%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           ++ +I I LKA+D ++LD S+ EIV T +++G++I GP+P P  I ++ VNRSPHVDKKS
Sbjct: 9   KDQKIRIRLKAYDYKLLDRSVEEIVETARRTGARIAGPVPLPTEINKYCVNRSPHVDKKS 68

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           R+Q E+R +KRL+ II+PT  TVDALMKLD++AGV+V IK
Sbjct: 69  REQFEIRTHKRLIDIIEPTQSTVDALMKLDLSAGVDVEIK 108


>gi|239905857|ref|YP_002952596.1| 30S ribosomal protein S10 [Desulfovibrio magneticus RS-1]
 gi|283853152|ref|ZP_06370405.1| ribosomal protein S10 [Desulfovibrio sp. FW1012B]
 gi|259494588|sp|C4XLX2|RS10_DESMR RecName: Full=30S ribosomal protein S10
 gi|239795721|dbj|BAH74710.1| 30S ribosomal protein S10 [Desulfovibrio magneticus RS-1]
 gi|283571410|gb|EFC19417.1| ribosomal protein S10 [Desulfovibrio sp. FW1012B]
          Length = 105

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 77/101 (76%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LKA+D RILD ++ EIV T + +G+ + GPIP P  I + TVNRS HVDKKS
Sbjct: 5   QNDRIRIKLKAYDYRILDKAVAEIVDTARNTGAGVAGPIPLPTDIHKVTVNRSVHVDKKS 64

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           R+Q EMR++KRLL I++PT QTVDAL KL + AGV+V IKL
Sbjct: 65  REQFEMRVHKRLLDIMEPTQQTVDALGKLSLPAGVDVEIKL 105


>gi|118597331|sp|Q2LQA2|RS10_SYNAS RecName: Full=30S ribosomal protein S10
          Length = 102

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 80/100 (80%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           ++ +I I LKA+D ++LD S+ EIV T +++G++I GP+P P  I ++ VNRSPHVDKKS
Sbjct: 2   KDQKIRIRLKAYDYKLLDRSVEEIVETARRTGARIAGPVPLPTEINKYCVNRSPHVDKKS 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           R+Q E+R +KRL+ II+PT  TVDALMKLD++AGV+V IK
Sbjct: 62  REQFEIRTHKRLIDIIEPTQSTVDALMKLDLSAGVDVEIK 101


>gi|78484639|ref|YP_390564.1| ribosomal protein S10 [Thiomicrospira crunogena XCL-2]
 gi|118597336|sp|Q31IY3|RS10_THICR RecName: Full=30S ribosomal protein S10
 gi|78362925|gb|ABB40890.1| SSU ribosomal protein S10P [Thiomicrospira crunogena XCL-2]
          Length = 103

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 61/104 (58%), Positives = 79/104 (75%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M ++NIRI   LKAFD R++D S REI  T K++G+Q+ GPIP P    RFTV  SPHV+
Sbjct: 1   MATQNIRIR--LKAFDHRLIDQSAREITETAKRTGAQVKGPIPMPTRKERFTVLVSPHVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K +RDQ E+R +KRLL I+ PT +TVDALMKLD+AAGV+V ++L
Sbjct: 59  KDARDQYEIRTHKRLLDIVDPTDKTVDALMKLDLAAGVDVQLEL 102


>gi|303246992|ref|ZP_07333268.1| ribosomal protein S10 [Desulfovibrio fructosovorans JJ]
 gi|302491699|gb|EFL51582.1| ribosomal protein S10 [Desulfovibrio fructosovorans JJ]
          Length = 105

 Score =  122 bits (306), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 77/101 (76%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LKA+D RILD ++ EIV T + +G+ + GPIP P  I + TVNRS HVDKKS
Sbjct: 5   QNDRIRIKLKAYDYRILDKAVAEIVDTARNTGAGVAGPIPLPTDINKVTVNRSVHVDKKS 64

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           R+Q EMR++KRLL I++PT QTVDAL KL + AGV+V IKL
Sbjct: 65  REQFEMRVHKRLLDIMEPTQQTVDALGKLSLPAGVDVEIKL 105


>gi|110833257|ref|YP_692116.1| 30S ribosomal protein S10 [Alcanivorax borkumensis SK2]
 gi|254426922|ref|ZP_05040629.1| ribosomal protein S10 [Alcanivorax sp. DG881]
 gi|118595833|sp|Q0VSK4|RS10_ALCBS RecName: Full=30S ribosomal protein S10
 gi|110646368|emb|CAL15844.1| 30S ribosomal protein S10 [Alcanivorax borkumensis SK2]
 gi|196193091|gb|EDX88050.1| ribosomal protein S10 [Alcanivorax sp. DG881]
          Length = 103

 Score =  122 bits (306), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 77/100 (77%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N RI I LKAFD R++D S +EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +R
Sbjct: 3   NQRIRIRLKAFDHRLIDQSAQEIVDTAKRTGAQVTGPIPLPTRKERFTVLVSPHVNKDAR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           DQ E+R +KRL+ I++PT +TVDALMKLD+AAGV+V I L
Sbjct: 63  DQYEIRTHKRLVDIVEPTDKTVDALMKLDLAAGVDVQISL 102


>gi|330814200|ref|YP_004358439.1| SSU ribosomal protein S10p (S20e) [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327487295|gb|AEA81700.1| SSU ribosomal protein S10p (S20e) [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 102

 Score =  122 bits (306), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 78/98 (79%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I L+A+D +ILD S  EIV T K++G+QI GPIP P +   FTV RSPH+DKKSR+Q
Sbjct: 5   QIRIRLQAYDHKILDQSTIEIVNTAKRTGAQIKGPIPLPTTKEIFTVLRSPHIDKKSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R +KRL+ I++PTPQT++ALMKLD+AAGV+V IK+
Sbjct: 65  FETRTHKRLIDILEPTPQTIEALMKLDLAAGVDVEIKI 102


>gi|298531086|ref|ZP_07018487.1| ribosomal protein S10 [Desulfonatronospira thiodismutans ASO3-1]
 gi|298509109|gb|EFI33014.1| ribosomal protein S10 [Desulfonatronospira thiodismutans ASO3-1]
          Length = 105

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 78/98 (79%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I L+A+D+RILD ++ EIV + K +G+ + GPIP P  I ++TVNRS HVDKKSR+Q
Sbjct: 8   RIRIKLRAYDNRILDKAVVEIVDSAKNTGAGVAGPIPLPTRIHKYTVNRSVHVDKKSREQ 67

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR++KRLL I++PT QTVDAL KL++ AGV+V IKL
Sbjct: 68  FEMRVHKRLLDIMEPTQQTVDALGKLNLPAGVDVEIKL 105


>gi|167945156|ref|ZP_02532230.1| ribosomal protein S10 [Endoriftia persephone 'Hot96_1+Hot96_2']
          Length = 100

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 60/97 (61%), Positives = 76/97 (78%)

Query: 8   ICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQL 67
           I I LKAFD R++D S REIV T K++G+Q++GPIP P    RFTV  SPHV+K +RDQ 
Sbjct: 3   IRIRLKAFDHRLIDQSAREIVETAKRTGAQVLGPIPLPTKKERFTVLISPHVNKDARDQY 62

Query: 68  EMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           E+R +KRL+ I+ PT +TVDALMKLD+AAGV+V IKL
Sbjct: 63  EIRTHKRLMDIVDPTDKTVDALMKLDLAAGVDVQIKL 99


>gi|192359612|ref|YP_001981207.1| 30S ribosomal protein S10 [Cellvibrio japonicus Ueda107]
 gi|226705415|sp|B3PK36|RS10_CELJU RecName: Full=30S ribosomal protein S10
 gi|190685777|gb|ACE83455.1| ribosomal protein S10 [Cellvibrio japonicus Ueda107]
          Length = 103

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 78/101 (77%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LKAFD +++D+S +EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +
Sbjct: 2   QNQRIRIRLKAFDHKLIDASTQEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRLL I++PT +TVDALMKLD+AAGV V I L
Sbjct: 62  RDQYEIRTHKRLLDIVEPTEKTVDALMKLDLAAGVEVQISL 102


>gi|254785078|ref|YP_003072506.1| 30S ribosomal protein S10 [Teredinibacter turnerae T7901]
 gi|237684172|gb|ACR11436.1| ribosomal protein S10 [Teredinibacter turnerae T7901]
          Length = 103

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 77/101 (76%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LKAFD +++D+S  EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +
Sbjct: 2   QNQRIRIRLKAFDHKLIDASTLEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R YKRLL I++PT +TVDALMKLD+AAGV V I L
Sbjct: 62  RDQYEIRTYKRLLDIVEPTEKTVDALMKLDLAAGVEVQISL 102


>gi|258406186|ref|YP_003198928.1| 30S ribosomal protein S10 [Desulfohalobium retbaense DSM 5692]
 gi|257798413|gb|ACV69350.1| ribosomal protein S10 [Desulfohalobium retbaense DSM 5692]
          Length = 105

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 76/98 (77%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I LKA+D RILD ++ EIV + K +G+ I GPIP P  I ++TVNRS HV+KKSR+Q
Sbjct: 8   RIRIKLKAYDYRILDKAVAEIVDSAKNTGASIAGPIPLPTRIHKYTVNRSVHVNKKSREQ 67

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMRI+KRLL I++PT QTVDAL KL + AGV+V IKL
Sbjct: 68  FEMRIHKRLLDILEPTQQTVDALGKLSLPAGVDVEIKL 105


>gi|206602674|gb|EDZ39155.1| Ribosomal protein S10 [Leptospirillum sp. Group II '5-way CG']
          Length = 101

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 77/98 (78%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK +D R+LD S+ EIV T K++G+ + GPIP P  I ++TV RSPHVDKKSR+Q
Sbjct: 4   KIRIRLKGYDYRLLDQSLLEIVSTAKRTGASVKGPIPLPTKIEKYTVLRSPHVDKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R +KRLL I++PTP+TVDALMKL++ +GV+V IKL
Sbjct: 64  FERRTHKRLLDILEPTPETVDALMKLELPSGVDVEIKL 101


>gi|92112553|ref|YP_572481.1| SSU ribosomal protein S10P [Chromohalobacter salexigens DSM 3043]
 gi|118597169|sp|Q1R0H6|RS10_CHRSD RecName: Full=30S ribosomal protein S10
 gi|91795643|gb|ABE57782.1| SSU ribosomal protein S10P [Chromohalobacter salexigens DSM 3043]
          Length = 103

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 80/101 (79%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N +I I LKAFD R++D S +EIV T K++G+Q+ GPIP P +  R+TV  SPHV+K +
Sbjct: 2   QNQKIRIRLKAFDHRLIDQSAQEIVDTAKRTGAQVRGPIPLPTNRERYTVLISPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KR+L I++PT +TVDALMKLD+AAGV+V IKL
Sbjct: 62  RDQYEIRTHKRVLDIVEPTEKTVDALMKLDLAAGVDVQIKL 102


>gi|88704379|ref|ZP_01102093.1| 30S ribosomal protein S10 [Congregibacter litoralis KT71]
 gi|254516910|ref|ZP_05128968.1| ribosomal protein S10 [gamma proteobacterium NOR5-3]
 gi|88701430|gb|EAQ98535.1| 30S ribosomal protein S10 [Congregibacter litoralis KT71]
 gi|219674415|gb|EED30783.1| ribosomal protein S10 [gamma proteobacterium NOR5-3]
          Length = 103

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 78/101 (77%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LKAFD R++D+S +EIV T +++G+Q+ GPIP P    R+TV  SPHV+K +
Sbjct: 2   QNQRIRIRLKAFDHRLIDTSTQEIVETARRTGAQVRGPIPLPTRKERYTVLVSPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRLL II+PT +TVDALMKLD+AAGV V I L
Sbjct: 62  RDQYEIRTHKRLLDIIEPTEKTVDALMKLDLAAGVEVQISL 102


>gi|301168459|emb|CBW28049.1| 30S ribosomal protein S10 [Bacteriovorax marinus SJ]
          Length = 102

 Score =  121 bits (304), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 56/97 (57%), Positives = 78/97 (80%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           R+ I L+A+D ++LD+S+ EIV T K++G+++ GPIP P  I +FTV R PHV+KKSR+Q
Sbjct: 5   RLRIKLRAYDYKLLDNSVNEIVNTAKETGARVAGPIPLPTEINKFTVLRGPHVNKKSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            EMR +KRL+ I+ PT QTVD+LMKLD++AGV+V IK
Sbjct: 65  FEMRTHKRLIDIVDPTQQTVDSLMKLDLSAGVDVEIK 101


>gi|189424409|ref|YP_001951586.1| 30S ribosomal protein S10 [Geobacter lovleyi SZ]
 gi|226705451|sp|B3E7T4|RS10_GEOLS RecName: Full=30S ribosomal protein S10
 gi|189420668|gb|ACD95066.1| ribosomal protein S10 [Geobacter lovleyi SZ]
          Length = 102

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 61/104 (58%), Positives = 80/104 (76%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+ IRI   LKA+D ++LD S+ EIV T K++G+++ GPIP P  I ++ V R PHVD
Sbjct: 1   MQSQKIRIR--LKAYDHKLLDVSVGEIVETAKRTGARVAGPIPLPTVINKYCVLRGPHVD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSRDQ E+R +KRL+ I+ PT QTVDALMKLD++AGV+V IKL
Sbjct: 59  KKSRDQFEIRTHKRLIDILDPTQQTVDALMKLDLSAGVDVEIKL 102


>gi|148652237|ref|YP_001279330.1| 30S ribosomal protein S10 [Psychrobacter sp. PRwf-1]
 gi|172048470|sp|A5WCI9|RS10_PSYWF RecName: Full=30S ribosomal protein S10
 gi|148571321|gb|ABQ93380.1| SSU ribosomal protein S10P [Psychrobacter sp. PRwf-1]
          Length = 103

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 77/100 (77%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N RI I LK+FD R++D S +EIV T K++G+Q+ GP+P P  I RF V  SPHV+K +R
Sbjct: 3   NQRIRIRLKSFDHRLIDQSAQEIVDTAKRTGAQVCGPVPLPTRIERFNVLTSPHVNKDAR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           DQ E+R +KR+L I++PT +TVDALMKLD+AAGV+V I L
Sbjct: 63  DQYEIRTHKRMLDIVQPTDKTVDALMKLDLAAGVDVQIAL 102


>gi|77359115|ref|YP_338690.1| 30S ribosomal subunit protein S10 [Pseudoalteromonas haloplanktis
           TAC125]
 gi|119468281|ref|ZP_01611407.1| 30S ribosomal subunit protein S10 (NusE protein) [Alteromonadales
           bacterium TW-7]
 gi|315125261|ref|YP_004067264.1| 30S ribosomal subunit protein S10 [Pseudoalteromonas sp. SM9913]
 gi|115305647|sp|Q3IF26|RS10_PSEHT RecName: Full=30S ribosomal protein S10
 gi|76874026|emb|CAI85247.1| 30S ribosomal subunit protein S10 (NusE protein) [Pseudoalteromonas
           haloplanktis TAC125]
 gi|119448274|gb|EAW29538.1| 30S ribosomal subunit protein S10 (NusE protein) [Alteromonadales
           bacterium TW-7]
 gi|315013774|gb|ADT67112.1| 30S ribosomal subunit protein S10 [Pseudoalteromonas sp. SM9913]
 gi|332038838|gb|EGI75280.1| 30S ribosomal protein S10 [Pseudoalteromonas haloplanktis ANT/505]
          Length = 103

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 76/100 (76%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N RI I LKAFD R++D S  EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +R
Sbjct: 3   NQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRFERFTVLTSPHVNKDAR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           DQ E+R +KRL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 63  DQYEIRTHKRLIDIVEPTDKTVDALMRLDLAAGVDVQISL 102


>gi|294839748|ref|ZP_06784431.1| 30S ribosomal protein S10 [Acinetobacter sp. 6013113]
 gi|294860426|ref|ZP_06798195.1| 30S ribosomal protein S10 [Acinetobacter sp. 6013150]
          Length = 103

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 76/100 (76%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N RI I LK+FD R++D S +EIV T K++G+Q+ GPIP P  I RF V  SPHV+K +R
Sbjct: 3   NQRIRIRLKSFDHRLIDQSAQEIVETAKRTGAQVCGPIPMPTRIERFNVLTSPHVNKDAR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           DQ E+R YKRL+ I++PT +TVDALMKLD+A GV+V I L
Sbjct: 63  DQYEIRTYKRLIDIVQPTDKTVDALMKLDLAVGVDVQIAL 102


>gi|257095041|ref|YP_003168682.1| 30S ribosomal protein S10 [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257047565|gb|ACV36753.1| ribosomal protein S10 [Candidatus Accumulibacter phosphatis clade
           IIA str. UW-1]
          Length = 103

 Score =  121 bits (303), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 63/104 (60%), Positives = 78/104 (75%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+ IRI   LKAFD R++D S +EIV T K++G+ + GP+P P  I+RF V RSPHVD
Sbjct: 1   MQSQKIRIR--LKAFDYRLIDQSAQEIVETAKRTGAVVRGPVPLPTRIQRFDVLRSPHVD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SRDQ EMR + RL+ II PT +TVDALMKLD+ AGV+V IKL
Sbjct: 59  KSSRDQFEMRTHLRLMDIIDPTDKTVDALMKLDLPAGVDVEIKL 102


>gi|238754174|ref|ZP_04615532.1| 30S ribosomal protein S10 [Yersinia ruckeri ATCC 29473]
 gi|238707670|gb|EEQ00030.1| 30S ribosomal protein S10 [Yersinia ruckeri ATCC 29473]
          Length = 103

 Score =  121 bits (303), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 77/101 (76%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LKAFD R++D S  EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +
Sbjct: 2   QNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVTGPIPLPTRKERFTVLVSPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 62  RDQYEIRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISL 102


>gi|51244975|ref|YP_064859.1| 30S ribosomal protein S10 [Desulfotalea psychrophila LSv54]
 gi|81642547|sp|Q6AP72|RS10_DESPS RecName: Full=30S ribosomal protein S10
 gi|50876012|emb|CAG35852.1| probable 30S ribosomal protein S10 [Desulfotalea psychrophila
           LSv54]
          Length = 105

 Score =  121 bits (303), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 78/98 (79%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D ++LD S  EIV T +++GS +VGPIP P SI +F V RSPHV+KKSR+Q
Sbjct: 7   KIRIRLKAYDHKLLDQSTSEIVETARRTGSAVVGPIPLPTSINKFCVLRSPHVNKKSREQ 66

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR ++RLL I++PT QT+D LMKL+++AGV+V IKL
Sbjct: 67  FEMRTHRRLLDILEPTQQTIDLLMKLELSAGVDVEIKL 104


>gi|114319618|ref|YP_741301.1| 30S ribosomal protein S10 [Alkalilimnicola ehrlichii MLHE-1]
 gi|122312457|sp|Q0ABH6|RS10_ALHEH RecName: Full=30S ribosomal protein S10
 gi|114226012|gb|ABI55811.1| SSU ribosomal protein S10P [Alkalilimnicola ehrlichii MLHE-1]
          Length = 103

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 76/100 (76%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N RI I LKAFD R++D S REIV T K++G+ + GPIP P    +FT+  SPHV+K +R
Sbjct: 3   NQRIRIRLKAFDHRLIDQSAREIVETAKRTGAHVKGPIPLPVKKEKFTILISPHVNKDAR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           DQ E+R +KRL+ II PT +TVDALMKLD+AAGV+V IKL
Sbjct: 63  DQYEIRTHKRLMDIIDPTDKTVDALMKLDLAAGVDVQIKL 102


>gi|157804036|ref|YP_001492585.1| 30S ribosomal protein S10 [Rickettsia canadensis str. McKiel]
 gi|166231772|sp|A8EZL7|RS10_RICCK RecName: Full=30S ribosomal protein S10
 gi|157785299|gb|ABV73800.1| 30S ribosomal protein S10 [Rickettsia canadensis str. McKiel]
          Length = 105

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 74/98 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK+FD RILD + +EIV   K++ + I GPIP PR I RFTVNRSPHV KKSR+Q
Sbjct: 4   KIKIRLKSFDHRILDQATKEIVSAIKRTFANINGPIPLPRKIERFTVNRSPHVHKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRLL I  P P  VDAL K+D+AAGV+VVI+L
Sbjct: 64  FEIRKHKRLLVIDDPNPAVVDALSKVDLAAGVDVVIEL 101


>gi|197117322|ref|YP_002137749.1| 30S ribosomal protein S10 [Geobacter bemidjiensis Bem]
 gi|253701923|ref|YP_003023112.1| 30S ribosomal protein S10 [Geobacter sp. M21]
 gi|322418363|ref|YP_004197586.1| 30S ribosomal protein S10 [Geobacter sp. M18]
 gi|226705450|sp|B5EFP9|RS10_GEOBB RecName: Full=30S ribosomal protein S10
 gi|259494594|sp|C6E4Q8|RS10_GEOSM RecName: Full=30S ribosomal protein S10
 gi|197086682|gb|ACH37953.1| ribosomal protein S10 [Geobacter bemidjiensis Bem]
 gi|251776773|gb|ACT19354.1| ribosomal protein S10 [Geobacter sp. M21]
 gi|320124750|gb|ADW12310.1| ribosomal protein S10 [Geobacter sp. M18]
          Length = 102

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 60/104 (57%), Positives = 82/104 (78%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+ IRI   LKA+D ++LD+S+ EIV T K++G+++ GPIP P  I ++ V R PHVD
Sbjct: 1   MPSQKIRIR--LKAYDHKLLDTSVGEIVDTAKRTGARVAGPIPLPTVINKYCVLRGPHVD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q E+R +KRL+ I++PT QTVDALMKLD++AGV+V IKL
Sbjct: 59  KKSREQFEIRTHKRLIDILEPTQQTVDALMKLDLSAGVDVEIKL 102


>gi|269468074|gb|EEZ79788.1| ribosomal protein S10 [uncultured SUP05 cluster bacterium]
          Length = 103

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 61/104 (58%), Positives = 78/104 (75%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M+++NIRI   LKAFD R++D S  EIV T K++G+ + GPIP P    RFTV  SPHV+
Sbjct: 1   MSNQNIRIK--LKAFDHRLIDKSAVEIVETAKRTGASVRGPIPLPTKKERFTVLTSPHVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K +RDQ E+R Y RL+ +I PT +TVDALMKLD+AAGV+V IKL
Sbjct: 59  KDARDQYELRTYIRLMDVISPTDKTVDALMKLDLAAGVDVAIKL 102


>gi|54307540|ref|YP_128560.1| 30S ribosomal protein S10 [Photobacterium profundum SS9]
 gi|90415161|ref|ZP_01223110.1| 30S ribosomal protein S10 [Photobacterium profundum 3TCK]
 gi|54036360|sp|Q6LVB7|RS10_PHOPR RecName: Full=30S ribosomal protein S10
 gi|46911960|emb|CAG18758.1| putative ribosomal protein S10 [Photobacterium profundum SS9]
 gi|90323708|gb|EAS40340.1| 30S ribosomal protein S10 [Photobacterium profundum 3TCK]
          Length = 103

 Score =  120 bits (302), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 77/101 (76%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LKAFD R++D S  EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +
Sbjct: 2   QNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVKGPIPLPTRKERFTVLTSPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 62  RDQYEIRTHKRLIDIVEPTDKTVDALMRLDLAAGVDVQISL 102


>gi|39997950|ref|NP_953901.1| 30S ribosomal protein S10 [Geobacter sulfurreducens PCA]
 gi|54036386|sp|Q748Z0|RS10_GEOSL RecName: Full=30S ribosomal protein S10
 gi|39984895|gb|AAR36251.1| ribosomal protein S10 [Geobacter sulfurreducens PCA]
 gi|298506889|gb|ADI85612.1| ribosomal protein S10 [Geobacter sulfurreducens KN400]
          Length = 102

 Score =  120 bits (302), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 61/104 (58%), Positives = 80/104 (76%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+ IRI   LKAFD ++LD S+ EIV T K++G+++ GPIP P  I ++ V R PHVD
Sbjct: 1   MPSQKIRIR--LKAFDHKLLDQSVGEIVDTAKRTGARVAGPIPLPTVINKYCVLRGPHVD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q E+R +KRL+ I+ PT QTVDALMKLD++AGV+V IKL
Sbjct: 59  KKSREQFEIRTHKRLIDILDPTQQTVDALMKLDLSAGVDVEIKL 102


>gi|329898795|ref|ZP_08272467.1| SSU ribosomal protein S10p (S20e) [gamma proteobacterium IMCC3088]
 gi|328920747|gb|EGG28209.1| SSU ribosomal protein S10p (S20e) [gamma proteobacterium IMCC3088]
          Length = 103

 Score =  120 bits (302), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 78/101 (77%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LKAFD R++D+S +EIV T +++G+Q+ GPIP P    +FTV  SPHV+K +
Sbjct: 2   QNQRIRIRLKAFDHRLIDASTQEIVETARRTGAQVRGPIPLPTRKEKFTVLISPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRLL I++PT +TVDALMKLD+AAGV V I L
Sbjct: 62  RDQYEIRTHKRLLDIVEPTEKTVDALMKLDLAAGVEVQISL 102


>gi|330722459|gb|EGH00294.1| SSU ribosomal protein S10p (S20e) [gamma proteobacterium IMCC2047]
          Length = 103

 Score =  120 bits (302), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 79/101 (78%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N +I I LKAFD R++D+S +EIV T K++G+Q+ GPIP P    +FTV  SPHV+K +
Sbjct: 2   QNQKIRIRLKAFDHRLIDASTQEIVDTAKRTGAQVRGPIPLPTGKEKFTVLISPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KR+L I++PT +TVDALMKLD+AAGV+V I L
Sbjct: 62  RDQYEIRTHKRMLDIVEPTEKTVDALMKLDLAAGVDVQISL 102


>gi|310941845|dbj|BAJ24276.1| 30S ribosomal protein S10 [Pseudomonas straminea]
          Length = 103

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 77/101 (76%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N +I I LKAFD R++D S +EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +
Sbjct: 2   QNQQIRIRLKAFDHRLIDQSTQEIVETAKRTGAQVRGPIPLPTRKERFTVLTSPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KR+L I++PT +TVDALMKLD+AAGV V I L
Sbjct: 62  RDQYEIRTHKRVLDIVQPTDKTVDALMKLDLAAGVEVQISL 102


>gi|119502923|ref|ZP_01625008.1| Phosphoenolpyruvate carboxykinase (ATP) [marine gamma
           proteobacterium HTCC2080]
 gi|119461269|gb|EAW42359.1| Phosphoenolpyruvate carboxykinase (ATP) [marine gamma
           proteobacterium HTCC2080]
          Length = 103

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 78/101 (77%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LKAFD +++D+S +EIV T +++G+Q+ GPIP P    +FT+  SPHV+K +
Sbjct: 2   QNQRIRIRLKAFDHKLIDTSTQEIVETARRTGAQVRGPIPLPTKKEKFTILTSPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRLL I++PT +TVDALMKLD+AAGV V I L
Sbjct: 62  RDQYEIRTHKRLLDIVEPTEKTVDALMKLDLAAGVEVQISL 102


>gi|88860960|ref|ZP_01135596.1| 30S ribosomal subunit protein S10 (NusE protein) [Pseudoalteromonas
           tunicata D2]
 gi|88817173|gb|EAR26992.1| 30S ribosomal subunit protein S10 (NusE protein) [Pseudoalteromonas
           tunicata D2]
          Length = 103

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 76/100 (76%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N RI I LKAFD R++D S  EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +R
Sbjct: 3   NQRIRIRLKAFDHRLIDQSTLEIVETAKRTGAQVRGPIPLPTRFERFTVLTSPHVNKDAR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           DQ E+R +KRL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 63  DQYEIRTHKRLIDIVEPTDKTVDALMRLDLAAGVDVQISL 102


>gi|307543824|ref|YP_003896303.1| 30S ribosomal protein S10 [Halomonas elongata DSM 2581]
 gi|307215848|emb|CBV41118.1| 30S ribosomal protein S10 [Halomonas elongata DSM 2581]
          Length = 103

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 79/101 (78%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N +I I LKAFD R++D S  EIV T K++G+Q+ GPIP P +  R+TV  SPHV+K +
Sbjct: 2   QNQKIRIRLKAFDHRLIDQSAAEIVDTAKRTGAQVRGPIPLPTNRERYTVLISPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KR+L I++PT +TVDALMKLD+AAGV+V IKL
Sbjct: 62  RDQYEIRTHKRVLDIVEPTEKTVDALMKLDLAAGVDVQIKL 102


>gi|297569423|ref|YP_003690767.1| ribosomal protein S10 [Desulfurivibrio alkaliphilus AHT2]
 gi|296925338|gb|ADH86148.1| ribosomal protein S10 [Desulfurivibrio alkaliphilus AHT2]
          Length = 103

 Score =  120 bits (301), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 76/98 (77%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK +D +++D S  EIV T K++G+ + GPIP P SI +F V R PHVDKKSR+Q
Sbjct: 6   KIRIRLKGYDHKLIDQSTGEIVETAKRTGAAVAGPIPLPTSINKFCVLRGPHVDKKSREQ 65

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR ++RLL I++PT QT+DALMKL+++AGV+V IKL
Sbjct: 66  FEMRTHRRLLDILEPTQQTIDALMKLELSAGVDVEIKL 103


>gi|28867853|ref|NP_790472.1| 30S ribosomal protein S10 [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|161486726|ref|YP_237617.2| 30S ribosomal protein S10 [Pseudomonas syringae pv. syringae B728a]
 gi|213969213|ref|ZP_03397351.1| ribosomal protein S10 [Pseudomonas syringae pv. tomato T1]
 gi|237797431|ref|ZP_04585892.1| 30S ribosomal protein S10 [Pseudomonas syringae pv. oryzae str.
           1_6]
 gi|257483184|ref|ZP_05637225.1| 30S ribosomal protein S10 [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|289675487|ref|ZP_06496377.1| 30S ribosomal protein S10 [Pseudomonas syringae pv. syringae FF5]
 gi|298489098|ref|ZP_07007120.1| SSU ribosomal protein S10p (S20e) [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|301381720|ref|ZP_07230138.1| 30S ribosomal protein S10 [Pseudomonas syringae pv. tomato Max13]
 gi|302061080|ref|ZP_07252621.1| 30S ribosomal protein S10 [Pseudomonas syringae pv. tomato K40]
 gi|302130779|ref|ZP_07256769.1| 30S ribosomal protein S10 [Pseudomonas syringae pv. tomato NCPPB
           1108]
 gi|302189276|ref|ZP_07265949.1| 30S ribosomal protein S10 [Pseudomonas syringae pv. syringae 642]
 gi|38258478|sp|Q889X2|RS10_PSESM RecName: Full=30S ribosomal protein S10
 gi|115305645|sp|Q48D35|RS10_PSE14 RecName: Full=30S ribosomal protein S10
 gi|115305649|sp|Q4ZMP3|RS10_PSEU2 RecName: Full=30S ribosomal protein S10
 gi|28851089|gb|AAO54167.1| ribosomal protein S10 [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213925891|gb|EEB59448.1| ribosomal protein S10 [Pseudomonas syringae pv. tomato T1]
 gi|298156410|gb|EFH97508.1| SSU ribosomal protein S10p (S20e) [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|320322323|gb|EFW78417.1| 30S ribosomal protein S10 [Pseudomonas syringae pv. glycinea str.
           B076]
 gi|320331981|gb|EFW87917.1| 30S ribosomal protein S10 [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|330879368|gb|EGH13517.1| 30S ribosomal protein S10 [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|330879443|gb|EGH13592.1| 30S ribosomal protein S10 [Pseudomonas syringae pv. morsprunorum
           str. M302280PT]
 gi|330891932|gb|EGH24593.1| 30S ribosomal protein S10 [Pseudomonas syringae pv. mori str.
           301020]
 gi|330899738|gb|EGH31157.1| 30S ribosomal protein S10 [Pseudomonas syringae pv. japonica str.
           M301072PT]
 gi|330940884|gb|EGH43841.1| 30S ribosomal protein S10 [Pseudomonas syringae pv. pisi str.
           1704B]
 gi|330953198|gb|EGH53458.1| 30S ribosomal protein S10 [Pseudomonas syringae Cit 7]
 gi|330966912|gb|EGH67172.1| 30S ribosomal protein S10 [Pseudomonas syringae pv. actinidiae str.
           M302091]
 gi|330969822|gb|EGH69888.1| 30S ribosomal protein S10 [Pseudomonas syringae pv. aceris str.
           M302273PT]
 gi|330976639|gb|EGH76683.1| 30S ribosomal protein S10 [Pseudomonas syringae pv. aptata str. DSM
           50252]
 gi|330988283|gb|EGH86386.1| 30S ribosomal protein S10 [Pseudomonas syringae pv. lachrymans str.
           M301315]
 gi|331012412|gb|EGH92468.1| 30S ribosomal protein S10 [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|331018159|gb|EGH98215.1| 30S ribosomal protein S10 [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
 gi|331020281|gb|EGI00338.1| 30S ribosomal protein S10 [Pseudomonas syringae pv. oryzae str.
           1_6]
          Length = 103

 Score =  120 bits (301), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 77/101 (76%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N +I I LKAFD R++D S +EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +
Sbjct: 2   QNQQIRIRLKAFDHRLIDQSTQEIVETAKRTGAQVRGPIPLPTRKERFTVLVSPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KR+L I++PT +TVDALMKLD+AAGV V I L
Sbjct: 62  RDQYEIRTHKRVLDIVQPTEKTVDALMKLDLAAGVEVQISL 102


>gi|94266254|ref|ZP_01289961.1| Ribosomal protein S10 [delta proteobacterium MLMS-1]
 gi|94272897|ref|ZP_01292201.1| Ribosomal protein S10 [delta proteobacterium MLMS-1]
 gi|93449980|gb|EAT01386.1| Ribosomal protein S10 [delta proteobacterium MLMS-1]
 gi|93453180|gb|EAT03644.1| Ribosomal protein S10 [delta proteobacterium MLMS-1]
          Length = 103

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 76/98 (77%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK +D +++D S  EIV T K++G+ + GPIP P SI +F V R PHVDKKSR+Q
Sbjct: 6   KIRIRLKGYDHKLIDQSTGEIVETAKRTGATVAGPIPLPTSINKFCVLRGPHVDKKSREQ 65

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR ++RLL I++PT QT+DALMKL+++AGV+V IKL
Sbjct: 66  FEMRTHRRLLDILEPTQQTIDALMKLELSAGVDVEIKL 103


>gi|78221845|ref|YP_383592.1| 30S ribosomal protein S10 [Geobacter metallireducens GS-15]
 gi|115305622|sp|Q39Y07|RS10_GEOMG RecName: Full=30S ribosomal protein S10
 gi|78193100|gb|ABB30867.1| SSU ribosomal protein S10P [Geobacter metallireducens GS-15]
          Length = 102

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 61/104 (58%), Positives = 80/104 (76%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+ IRI   LKAFD ++LD S+ EIV T K++G+++ GPIP P  I ++ V R PHVD
Sbjct: 1   MPSQKIRIR--LKAFDHKLLDQSVGEIVDTAKRTGARVAGPIPLPTIINKYCVLRGPHVD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q E+R +KRL+ I+ PT QTVDALMKLD++AGV+V IKL
Sbjct: 59  KKSREQFEIRTHKRLIDILDPTQQTVDALMKLDLSAGVDVEIKL 102


>gi|254283312|ref|ZP_04958280.1| ribosomal protein S10 [gamma proteobacterium NOR51-B]
 gi|219679515|gb|EED35864.1| ribosomal protein S10 [gamma proteobacterium NOR51-B]
          Length = 103

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 77/101 (76%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LKAFD +++D+S  EIV T +++G+Q+ GPIP P    +FT+  SPHV+K +
Sbjct: 2   QNQRIRIRLKAFDHKLIDASTEEIVETARRTGAQVRGPIPLPTKKEKFTILTSPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRLL I++PT +TVDALMKLD+AAGV V I L
Sbjct: 62  RDQYEIRTHKRLLDIVEPTEKTVDALMKLDLAAGVEVQISL 102


>gi|326562143|gb|EGE12471.1| 30S ribosomal protein S10 [Moraxella catarrhalis 7169]
 gi|326564492|gb|EGE14718.1| 30S ribosomal protein S10 [Moraxella catarrhalis 46P47B1]
 gi|326565675|gb|EGE15838.1| 30S ribosomal protein S10 [Moraxella catarrhalis 12P80B1]
 gi|326566244|gb|EGE16396.1| 30S ribosomal protein S10 [Moraxella catarrhalis 103P14B1]
 gi|326567104|gb|EGE17226.1| 30S ribosomal protein S10 [Moraxella catarrhalis BC1]
 gi|326568368|gb|EGE18448.1| 30S ribosomal protein S10 [Moraxella catarrhalis BC7]
 gi|326572269|gb|EGE22264.1| 30S ribosomal protein S10 [Moraxella catarrhalis BC8]
 gi|326574611|gb|EGE24551.1| 30S ribosomal protein S10 [Moraxella catarrhalis O35E]
 gi|326574867|gb|EGE24797.1| 30S ribosomal protein S10 [Moraxella catarrhalis 101P30B1]
 gi|326576191|gb|EGE26106.1| 30S ribosomal protein S10 [Moraxella catarrhalis CO72]
          Length = 103

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 77/100 (77%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N RI I LK+FD R++D S +EIV T K++G+Q+ GP+P P  I RF V  SPHV+K +R
Sbjct: 3   NQRIRIRLKSFDHRLIDQSAQEIVDTAKRTGAQVCGPVPLPTRIERFNVLTSPHVNKDAR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           DQ E+R +KR++ I++PT +TVDALMKLD+AAGV+V I L
Sbjct: 63  DQYEIRTHKRMIDIVQPTDKTVDALMKLDLAAGVDVQIAL 102


>gi|242278657|ref|YP_002990786.1| 30S ribosomal protein S10 [Desulfovibrio salexigens DSM 2638]
 gi|259494587|sp|C6C184|RS10_DESAD RecName: Full=30S ribosomal protein S10
 gi|242121551|gb|ACS79247.1| ribosomal protein S10 [Desulfovibrio salexigens DSM 2638]
          Length = 105

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 64/104 (61%), Positives = 77/104 (74%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           MTS  IRI   LKA+D RILD ++ EIV T + +G+ I GPIP P  I R T+ RS HVD
Sbjct: 4   MTSDRIRIK--LKAYDYRILDKAVTEIVDTARNTGAAIAGPIPLPTQISRTTIQRSVHVD 61

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q EMRI+KRLL I++PT QTVDAL KL + AGV+V IKL
Sbjct: 62  KKSREQFEMRIHKRLLDILEPTQQTVDALGKLSLPAGVDVEIKL 105


>gi|116624203|ref|YP_826359.1| 30S ribosomal protein S10 [Candidatus Solibacter usitatus
           Ellin6076]
 gi|122253081|sp|Q01W91|RS10_SOLUE RecName: Full=30S ribosomal protein S10
 gi|116227365|gb|ABJ86074.1| SSU ribosomal protein S10P [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 106

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 62/97 (63%), Positives = 74/97 (76%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I LKA+D RILD S  EIV T K++G+ + GPIP P S    TV RSPHVDKKSR+Q
Sbjct: 6   RIRIRLKAYDHRILDQSTTEIVDTAKRTGATVAGPIPLPTSRSITTVLRSPHVDKKSREQ 65

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E+R +KRLL I++PT QTVDALMKLD+ AGV+V IK
Sbjct: 66  FEIRTHKRLLDILEPTQQTVDALMKLDLPAGVDVEIK 102


>gi|71734713|ref|YP_276707.1| 30S ribosomal protein S10 [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|71555266|gb|AAZ34477.1| ribosomal protein S10 [Pseudomonas syringae pv. phaseolicola 1448A]
          Length = 130

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 77/101 (76%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N +I I LKAFD R++D S +EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +
Sbjct: 29  QNQQIRIRLKAFDHRLIDQSTQEIVETAKRTGAQVRGPIPLPTRKERFTVLVSPHVNKDA 88

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KR+L I++PT +TVDALMKLD+AAGV V I L
Sbjct: 89  RDQYEIRTHKRVLDIVQPTEKTVDALMKLDLAAGVEVQISL 129


>gi|262277093|ref|ZP_06054886.1| ribosomal protein S10 [alpha proteobacterium HIMB114]
 gi|262224196|gb|EEY74655.1| ribosomal protein S10 [alpha proteobacterium HIMB114]
          Length = 102

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 59/104 (56%), Positives = 79/104 (75%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  ++IRI   L+A+D +ILD S  EIV T K++G+QI GPIP P     +TV RSPH+D
Sbjct: 1   MDQQHIRIR--LQAYDHKILDQSTEEIVNTAKRTGAQIKGPIPLPTKKEIYTVLRSPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q E R +KRL+ I++PTP T++ALMKLD+AAGV+V IK+
Sbjct: 59  KKSREQFETRTHKRLIDIMEPTPATIEALMKLDLAAGVDVEIKI 102


>gi|331005016|ref|ZP_08328423.1| SSU ribosomal protein S10p (S20e) [gamma proteobacterium IMCC1989]
 gi|330421182|gb|EGG95441.1| SSU ribosomal protein S10p (S20e) [gamma proteobacterium IMCC1989]
          Length = 103

 Score =  120 bits (300), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 78/101 (77%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LKAFD +++D+S +EIV T +++G+Q+ GPIP P    RFT+  SPHV+K +
Sbjct: 2   QNQRIRIRLKAFDHKLIDTSTQEIVETVRRTGAQVRGPIPLPTRKERFTILVSPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRLL I++PT +TVDALMKLD+AAGV V I L
Sbjct: 62  RDQYEIRTHKRLLDIVEPTEKTVDALMKLDLAAGVEVQISL 102


>gi|71065058|ref|YP_263785.1| 30S ribosomal protein S10 [Psychrobacter arcticus 273-4]
 gi|93005313|ref|YP_579750.1| 30S ribosomal protein S10 [Psychrobacter cryohalolentis K5]
 gi|115305650|sp|Q4FUF7|RS10_PSYA2 RecName: Full=30S ribosomal protein S10
 gi|118597191|sp|Q1QDI7|RS10_PSYCK RecName: Full=30S ribosomal protein S10
 gi|71038043|gb|AAZ18351.1| SSU ribosomal protein S10P [Psychrobacter arcticus 273-4]
 gi|92392991|gb|ABE74266.1| SSU ribosomal protein S10P [Psychrobacter cryohalolentis K5]
          Length = 103

 Score =  120 bits (300), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 77/100 (77%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N RI I LK+FD R++D S +EIV T K++G+Q+ GP+P P  I RF V  SPHV+K +R
Sbjct: 3   NQRIRIRLKSFDHRLIDQSAQEIVDTAKRTGAQVCGPVPLPTRIERFNVLTSPHVNKDAR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           DQ E+R +KR++ I++PT +TVDALMKLD+AAGV+V I L
Sbjct: 63  DQYEIRTHKRMVDIVQPTDKTVDALMKLDLAAGVDVQIAL 102


>gi|307823441|ref|ZP_07653670.1| ribosomal protein S10 [Methylobacter tundripaludum SV96]
 gi|307735426|gb|EFO06274.1| ribosomal protein S10 [Methylobacter tundripaludum SV96]
          Length = 103

 Score =  120 bits (300), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 59/104 (56%), Positives = 80/104 (76%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M+++ IRI   LK+FD +++D S  EIV T +++G+Q+ GPIP P    RFT+  SPHV+
Sbjct: 1   MSNQTIRIR--LKSFDHKLIDQSAGEIVETARRTGAQVKGPIPLPTKKERFTILISPHVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K +RDQ E+R YKRLL I++PT +TVDALMKLD+AAGV+V IKL
Sbjct: 59  KDARDQYELRTYKRLLDIVEPTEKTVDALMKLDLAAGVDVQIKL 102


>gi|63258483|gb|AAY39579.1| Ribosomal protein S10, bacterial form [Pseudomonas syringae pv.
           syringae B728a]
          Length = 124

 Score =  120 bits (300), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 77/101 (76%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N +I I LKAFD R++D S +EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +
Sbjct: 23  QNQQIRIRLKAFDHRLIDQSTQEIVETAKRTGAQVRGPIPLPTRKERFTVLVSPHVNKDA 82

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KR+L I++PT +TVDALMKLD+AAGV V I L
Sbjct: 83  RDQYEIRTHKRVLDIVQPTEKTVDALMKLDLAAGVEVQISL 123


>gi|163760798|ref|ZP_02167877.1| putative 30S ribosomal protein S10 [Hoeflea phototrophica DFL-43]
 gi|162281842|gb|EDQ32134.1| putative 30S ribosomal protein S10 [Hoeflea phototrophica DFL-43]
          Length = 81

 Score =  120 bits (300), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 55/80 (68%), Positives = 67/80 (83%)

Query: 25  REIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQLEMRIYKRLLYIIKPTPQ 84
           REIV T K++G+ + GP+P P  I +FTVNRSPH+DKKSR+Q EMR +KRLL I+ PTPQ
Sbjct: 2   REIVSTAKRTGASVRGPVPLPTRIEKFTVNRSPHIDKKSREQFEMRTHKRLLDIVDPTPQ 61

Query: 85  TVDALMKLDIAAGVNVVIKL 104
           TVDALMKLD+AAGV+V IKL
Sbjct: 62  TVDALMKLDLAAGVDVEIKL 81


>gi|26987194|ref|NP_742619.1| 30S ribosomal protein S10 [Pseudomonas putida KT2440]
 gi|70732883|ref|YP_262651.1| 30S ribosomal protein S10 [Pseudomonas fluorescens Pf-5]
 gi|77461301|ref|YP_350808.1| 30S ribosomal protein S10 [Pseudomonas fluorescens Pf0-1]
 gi|146281169|ref|YP_001171322.1| 30S ribosomal protein S10 [Pseudomonas stutzeri A1501]
 gi|148545738|ref|YP_001265840.1| 30S ribosomal protein S10 [Pseudomonas putida F1]
 gi|167031499|ref|YP_001666730.1| 30S ribosomal protein S10 [Pseudomonas putida GB-1]
 gi|170723907|ref|YP_001751595.1| 30S ribosomal protein S10 [Pseudomonas putida W619]
 gi|229592904|ref|YP_002875023.1| 30S ribosomal protein S10 [Pseudomonas fluorescens SBW25]
 gi|325272043|ref|ZP_08138484.1| 30S ribosomal protein S10 [Pseudomonas sp. TJI-51]
 gi|330812076|ref|YP_004356538.1| 30S ribosomal protein S10 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|38258503|sp|Q88QN6|RS10_PSEPK RecName: Full=30S ribosomal protein S10
 gi|115305646|sp|Q4K532|RS10_PSEF5 RecName: Full=30S ribosomal protein S10
 gi|115305648|sp|Q3K5Y7|RS10_PSEPF RecName: Full=30S ribosomal protein S10
 gi|166231315|sp|A5VXP6|RS10_PSEP1 RecName: Full=30S ribosomal protein S10
 gi|166231316|sp|A4VHM9|RS10_PSEU5 RecName: Full=30S ribosomal protein S10
 gi|189040384|sp|B0KK66|RS10_PSEPG RecName: Full=30S ribosomal protein S10
 gi|226705611|sp|B1JDW5|RS10_PSEPW RecName: Full=30S ribosomal protein S10
 gi|259494600|sp|C3K2X7|RS10_PSEFS RecName: Full=30S ribosomal protein S10
 gi|24981832|gb|AAN66083.1|AE016238_1 ribosomal protein S10 [Pseudomonas putida KT2440]
 gi|68347182|gb|AAY94788.1| ribosomal protein S10 [Pseudomonas fluorescens Pf-5]
 gi|77385304|gb|ABA76817.1| 30S ribosomal protein S10 [Pseudomonas fluorescens Pf0-1]
 gi|145569374|gb|ABP78480.1| ribosomal protein S10 [Pseudomonas stutzeri A1501]
 gi|148509796|gb|ABQ76656.1| SSU ribosomal protein S10P [Pseudomonas putida F1]
 gi|166857987|gb|ABY96394.1| ribosomal protein S10 [Pseudomonas putida GB-1]
 gi|169761910|gb|ACA75226.1| ribosomal protein S10 [Pseudomonas putida W619]
 gi|229364770|emb|CAY52768.1| 30S ribosomal protein S10 [Pseudomonas fluorescens SBW25]
 gi|310940984|dbj|BAJ24366.1| 30S ribosomal protein S10 [Pseudomonas putida]
 gi|310941014|dbj|BAJ24381.1| 30S ribosomal protein S10 [Pseudomonas putida]
 gi|310941044|dbj|BAJ24396.1| 30S ribosomal protein S10 [Pseudomonas putida]
 gi|310941074|dbj|BAJ24411.1| 30S ribosomal protein S10 [Pseudomonas putida]
 gi|310941605|dbj|BAJ24156.1| 30S ribosomal protein S10 [Pseudomonas putida]
 gi|310941635|dbj|BAJ24171.1| 30S ribosomal protein S10 [Pseudomonas fluorescens]
 gi|310941725|dbj|BAJ24216.1| 30S ribosomal protein S10 [Pseudomonas azotoformans]
 gi|310941755|dbj|BAJ24231.1| 30S ribosomal protein S10 [Pseudomonas chlororaphis subsp.
           chlororaphis]
 gi|310941785|dbj|BAJ24246.1| 30S ribosomal protein S10 [Pseudomonas fulva]
 gi|310941875|dbj|BAJ24291.1| 30S ribosomal protein S10 [Pseudomonas stutzeri]
 gi|310941905|dbj|BAJ24306.1| 30S ribosomal protein S10 [Pseudomonas putida]
 gi|310941935|dbj|BAJ24321.1| 30S ribosomal protein S10 [Pseudomonas fluorescens]
 gi|310941965|dbj|BAJ24336.1| 30S ribosomal protein S10 [Pseudomonas putida]
 gi|310941995|dbj|BAJ24351.1| 30S ribosomal protein S10 [Pseudomonas putida]
 gi|313496818|gb|ADR58184.1| RpsJ [Pseudomonas putida BIRD-1]
 gi|324102820|gb|EGC00226.1| 30S ribosomal protein S10 [Pseudomonas sp. TJI-51]
 gi|327380184|gb|AEA71534.1| 30S ribosomal protein S10 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327479322|gb|AEA82632.1| 30S ribosomal protein S10 [Pseudomonas stutzeri DSM 4166]
 gi|330962526|gb|EGH62786.1| 30S ribosomal protein S10 [Pseudomonas syringae pv. maculicola str.
           ES4326]
          Length = 103

 Score =  120 bits (300), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 77/101 (76%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N +I I LKAFD R++D S +EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +
Sbjct: 2   QNQQIRIRLKAFDHRLIDQSTQEIVETAKRTGAQVRGPIPLPTRKERFTVLVSPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KR+L I++PT +TVDALMKLD+AAGV V I L
Sbjct: 62  RDQYEIRTHKRVLDIVQPTDKTVDALMKLDLAAGVEVQISL 102


>gi|212704582|ref|ZP_03312710.1| hypothetical protein DESPIG_02644 [Desulfovibrio piger ATCC 29098]
 gi|220903934|ref|YP_002479246.1| ribosomal protein S10 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|303328095|ref|ZP_07358534.1| ribosomal protein S10 [Desulfovibrio sp. 3_1_syn3]
 gi|254809591|sp|B8IYH2|RS10_DESDA RecName: Full=30S ribosomal protein S10
 gi|212671981|gb|EEB32464.1| hypothetical protein DESPIG_02644 [Desulfovibrio piger ATCC 29098]
 gi|219868233|gb|ACL48568.1| ribosomal protein S10 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|302861921|gb|EFL84856.1| ribosomal protein S10 [Desulfovibrio sp. 3_1_syn3]
          Length = 105

 Score =  120 bits (300), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 76/98 (77%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I LKA+D RILD ++ EIV T + +G+ + GPIP P +I ++T+ RS HVDKKSR+Q
Sbjct: 8   RIRIKLKAYDYRILDKAVAEIVDTARNTGAGVAGPIPLPTNIHKYTIQRSVHVDKKSREQ 67

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMRI+KRL+ I++PT QTVDAL KL + AGV+V IKL
Sbjct: 68  FEMRIHKRLMDILEPTQQTVDALGKLSLPAGVDVEIKL 105


>gi|32491291|ref|NP_871545.1| 30S ribosomal protein S10 [Wigglesworthia glossinidia endosymbiont
           of Glossina brevipalpis]
 gi|31340408|sp|Q8D213|RS10_WIGBR RecName: Full=30S ribosomal protein S10
 gi|25166498|dbj|BAC24688.1| rpsJ [Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis]
          Length = 103

 Score =  120 bits (300), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 77/101 (76%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LKAFD R++D S  EIV T K++G+Q+ GPIP P    +FT+  SPHVDK +
Sbjct: 2   QNQRIRIRLKAFDHRLIDQSTSEIVETAKRTGAQVRGPIPLPTRKEKFTILVSPHVDKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRL+ I+KPT +TVDALM+LD+A+GV+V I L
Sbjct: 62  RDQYEIRTHKRLVDIVKPTEKTVDALMRLDLASGVDVQISL 102


>gi|153872678|ref|ZP_02001499.1| 30S ribosomal subunit protein S10 [Beggiatoa sp. PS]
 gi|152070859|gb|EDN68504.1| 30S ribosomal subunit protein S10 [Beggiatoa sp. PS]
          Length = 103

 Score =  120 bits (300), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 77/100 (77%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N RI I LKAFD +++D S REIV T +++G+Q+ GPIP P    RFTV  SPHV+K +R
Sbjct: 3   NQRIRIRLKAFDHKLIDGSAREIVETARRTGAQLRGPIPLPTKKERFTVLISPHVNKDAR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           DQ E+R +KRL+ I+ PT +TVD+LMKLD+AAGV+V IKL
Sbjct: 63  DQYEIRTHKRLIDILDPTDKTVDSLMKLDLAAGVDVQIKL 102


>gi|117620866|ref|YP_854838.1| ribosomal protein S10 [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
 gi|117562273|gb|ABK39221.1| ribosomal protein S10 [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
          Length = 134

 Score =  120 bits (300), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 59/104 (56%), Positives = 79/104 (75%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           ++ +N RI I LKAFD R++D S  EIV T K++G+Q+ GPIP P    RFTV  SPHV+
Sbjct: 30  LSMQNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVN 89

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K +RDQ E+R +KRL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 90  KDARDQYEIRTHKRLVDIVEPTDKTVDALMRLDLAAGVDVQISL 133


>gi|27364216|ref|NP_759744.1| 30S ribosomal protein S10 [Vibrio vulnificus CMCP6]
 gi|28897030|ref|NP_796635.1| 30S ribosomal protein S10 [Vibrio parahaemolyticus RIMD 2210633]
 gi|37678558|ref|NP_933167.1| 30S ribosomal protein S10 [Vibrio vulnificus YJ016]
 gi|91229292|ref|ZP_01262909.1| 30S ribosomal protein S10 [Vibrio alginolyticus 12G01]
 gi|153835826|ref|ZP_01988493.1| ribosomal protein S10 [Vibrio harveyi HY01]
 gi|153840339|ref|ZP_01993006.1| ribosomal protein S10 [Vibrio parahaemolyticus AQ3810]
 gi|153846160|ref|ZP_01993836.1| ribosomal protein S10 [Vibrio parahaemolyticus AQ3810]
 gi|156973050|ref|YP_001443957.1| 30S ribosomal protein S10 [Vibrio harveyi ATCC BAA-1116]
 gi|163803964|ref|ZP_02197790.1| 30S ribosomal protein S10 [Vibrio sp. AND4]
 gi|254506525|ref|ZP_05118667.1| ribosomal protein S10 [Vibrio parahaemolyticus 16]
 gi|260362277|ref|ZP_05775244.1| ribosomal protein S10 [Vibrio parahaemolyticus K5030]
 gi|260877948|ref|ZP_05890303.1| ribosomal protein S10 [Vibrio parahaemolyticus AN-5034]
 gi|260897592|ref|ZP_05906088.1| ribosomal protein S10 [Vibrio parahaemolyticus Peru-466]
 gi|260899522|ref|ZP_05907917.1| ribosomal protein S10 [Vibrio parahaemolyticus AQ4037]
 gi|261250418|ref|ZP_05942993.1| SSU ribosomal protein S10p (S20e) [Vibrio orientalis CIP 102891]
 gi|262392517|ref|YP_003284371.1| 30S ribosomal protein S10p [Vibrio sp. Ex25]
 gi|269959690|ref|ZP_06174070.1| 30S ribosomal protein S10 [Vibrio harveyi 1DA3]
 gi|269964735|ref|ZP_06178973.1| 30S ribosomal protein S10 [Vibrio alginolyticus 40B]
 gi|312884704|ref|ZP_07744405.1| 30S ribosomal protein S10 [Vibrio caribbenthicus ATCC BAA-2122]
 gi|320157602|ref|YP_004189981.1| 30S ribosomal protein S10p (S20e) [Vibrio vulnificus MO6-24/O]
 gi|323492118|ref|ZP_08097280.1| 30S ribosomal protein S10 [Vibrio brasiliensis LMG 20546]
 gi|323495503|ref|ZP_08100577.1| 30S ribosomal protein S10 [Vibrio sinaloensis DSM 21326]
 gi|44888372|sp|Q7MPI9|RS10_VIBVY RecName: Full=30S ribosomal protein S10
 gi|54039328|sp|P66347|RS10_VIBVU RecName: Full=30S ribosomal protein S10
 gi|54042105|sp|P66346|RS10_VIBPA RecName: Full=30S ribosomal protein S10
 gi|166231796|sp|A7MWI2|RS10_VIBHB RecName: Full=30S ribosomal protein S10
 gi|27360334|gb|AAO09271.1| ribosomal protein S10 [Vibrio vulnificus CMCP6]
 gi|28805238|dbj|BAC58519.1| ribosomal protein S10 [Vibrio parahaemolyticus RIMD 2210633]
 gi|37197298|dbj|BAC93138.1| ribosomal protein S10 [Vibrio vulnificus YJ016]
 gi|91187417|gb|EAS73765.1| 30S ribosomal protein S10 [Vibrio alginolyticus 12G01]
 gi|148865856|gb|EDL66819.1| ribosomal protein S10 [Vibrio harveyi HY01]
 gi|149744973|gb|EDM56299.1| ribosomal protein S10 [Vibrio parahaemolyticus AQ3810]
 gi|149745997|gb|EDM57127.1| ribosomal protein S10 [Vibrio parahaemolyticus AQ3810]
 gi|156524644|gb|ABU69730.1| hypothetical protein VIBHAR_00729 [Vibrio harveyi ATCC BAA-1116]
 gi|159172232|gb|EDP57137.1| 30S ribosomal protein S10 [Vibrio sp. AND4]
 gi|219550699|gb|EED27682.1| ribosomal protein S10 [Vibrio parahaemolyticus 16]
 gi|260938987|gb|EEX94974.1| SSU ribosomal protein S10p (S20e) [Vibrio orientalis CIP 102891]
 gi|262336111|gb|ACY49906.1| SSU ribosomal protein S10p (S20e) [Vibrio sp. Ex25]
 gi|269830634|gb|EEZ84855.1| 30S ribosomal protein S10 [Vibrio alginolyticus 40B]
 gi|269835613|gb|EEZ89692.1| 30S ribosomal protein S10 [Vibrio harveyi 1DA3]
 gi|308087543|gb|EFO37238.1| ribosomal protein S10 [Vibrio parahaemolyticus Peru-466]
 gi|308089949|gb|EFO39644.1| ribosomal protein S10 [Vibrio parahaemolyticus AN-5034]
 gi|308108781|gb|EFO46321.1| ribosomal protein S10 [Vibrio parahaemolyticus AQ4037]
 gi|308111333|gb|EFO48873.1| ribosomal protein S10 [Vibrio parahaemolyticus K5030]
 gi|309367617|gb|EFP95168.1| 30S ribosomal protein S10 [Vibrio caribbenthicus ATCC BAA-2122]
 gi|319932914|gb|ADV87778.1| SSU ribosomal protein S10p (S20e) [Vibrio vulnificus MO6-24/O]
 gi|323313679|gb|EGA66781.1| 30S ribosomal protein S10 [Vibrio brasiliensis LMG 20546]
 gi|323319384|gb|EGA72321.1| 30S ribosomal protein S10 [Vibrio sinaloensis DSM 21326]
 gi|328471833|gb|EGF42710.1| 30S ribosomal protein S10 [Vibrio parahaemolyticus 10329]
          Length = 103

 Score =  120 bits (300), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 79/101 (78%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LKAFD +++D+S  EIV T K++G+Q+ GPIP P    RFTV  SPHV+KK+
Sbjct: 2   QNQRIRIRLKAFDYKLIDASTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKKA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 62  RDQYEIRTHKRLIDIVEPTDKTVDALMRLDLAAGVDVQISL 102


>gi|254495710|ref|ZP_05108626.1| 30S ribosomal protein S10 [Legionella drancourtii LLAP12]
 gi|254355057|gb|EET13676.1| 30S ribosomal protein S10 [Legionella drancourtii LLAP12]
          Length = 105

 Score =  119 bits (299), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 60/102 (58%), Positives = 76/102 (74%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           S N  I I LK+FD R++D S REIV T K++G+QI GPIP P    +FTV  SPHV+K 
Sbjct: 2   SNNQNIKIRLKSFDHRLIDLSTREIVETAKRTGAQIRGPIPLPIRKEKFTVLTSPHVNKD 61

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +RDQ E+R +KRL+ I+ PT +TVDALMKLD+AAGV+V I L
Sbjct: 62  ARDQYELRTHKRLVVIVHPTEKTVDALMKLDLAAGVDVQISL 103


>gi|33152959|ref|NP_874312.1| 30S ribosomal protein S10 [Haemophilus ducreyi 35000HP]
 gi|44888426|sp|Q7VKD1|RS10_HAEDU RecName: Full=30S ribosomal protein S10
 gi|33149184|gb|AAP96701.1| 30S ribosomal protein S10 [Haemophilus ducreyi 35000HP]
          Length = 103

 Score =  119 bits (299), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 77/101 (76%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LKAFD R++D S  EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +
Sbjct: 2   QNQRIRIRLKAFDHRLIDQSTAEIVETAKRAGAQVRGPIPLPTRKERFTVLISPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 62  RDQYEIRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISL 102


>gi|56707477|ref|YP_169373.1| 30S ribosomal protein S10 [Francisella tularensis subsp. tularensis
           SCHU S4]
 gi|110669948|ref|YP_666505.1| 30S ribosomal protein S10 [Francisella tularensis subsp. tularensis
           FSC198]
 gi|118496851|ref|YP_897901.1| 30S ribosomal protein S10 [Francisella tularensis subsp. novicida
           U112]
 gi|134302586|ref|YP_001122557.1| 30S ribosomal protein S10 [Francisella tularensis subsp. tularensis
           WY96-3418]
 gi|187932144|ref|YP_001892129.1| 30S ribosomal protein S10 [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|81597929|sp|Q5NHW9|RS10_FRATT RecName: Full=30S ribosomal protein S10
 gi|122971068|sp|Q14JC1|RS10_FRAT1 RecName: Full=30S ribosomal protein S10
 gi|166231272|sp|A0Q4I2|RS10_FRATN RecName: Full=30S ribosomal protein S10
 gi|166231273|sp|A4IZT5|RS10_FRATW RecName: Full=30S ribosomal protein S10
 gi|226705449|sp|B2SDY6|RS10_FRATM RecName: Full=30S ribosomal protein S10
 gi|54112819|gb|AAV29043.1| NT02FT0097 [synthetic construct]
 gi|56603969|emb|CAG44957.1| 30S ribosomal protein S10 [Francisella tularensis subsp. tularensis
           SCHU S4]
 gi|110320281|emb|CAL08340.1| 30S ribosomal protein S10 [Francisella tularensis subsp. tularensis
           FSC198]
 gi|118422757|gb|ABK89147.1| 30S ribosomal protein S10 [Francisella novicida U112]
 gi|134050363|gb|ABO47434.1| ribosomal protein S10 [Francisella tularensis subsp. tularensis
           WY96-3418]
 gi|187713053|gb|ACD31350.1| 30S ribosomal protein S10 [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|282158621|gb|ADA78012.1| 30S ribosomal protein S10 [Francisella tularensis subsp. tularensis
           NE061598]
 gi|328675406|gb|AEB28081.1| SSU ribosomal protein S10p (S20e) [Francisella cf. novicida 3523]
 gi|328676320|gb|AEB27190.1| SSU ribosomal protein S10p (S20e) [Francisella cf. novicida Fx1]
          Length = 105

 Score =  119 bits (299), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 60/104 (57%), Positives = 79/104 (75%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M   N RI I LKAFD +++D S +EIV T KK+G+Q+ GPIP P    RFT+  SPHV+
Sbjct: 1   MAINNQRIRIRLKAFDHKLIDISTQEIVDTAKKTGAQVKGPIPLPVRKERFTILISPHVN 60

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KK+RDQ E+R +KRL+ I++PT +TVDALMKLD+A+GV+V I L
Sbjct: 61  KKARDQYEIRTHKRLIDIVEPTDKTVDALMKLDLASGVDVQISL 104


>gi|15599460|ref|NP_252954.1| 30S ribosomal protein S10 [Pseudomonas aeruginosa PAO1]
 gi|104779754|ref|YP_606252.1| 30S ribosomal protein S10 [Pseudomonas entomophila L48]
 gi|116052299|ref|YP_788855.1| 30S ribosomal protein S10 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|152988412|ref|YP_001346222.1| 30S ribosomal protein S10 [Pseudomonas aeruginosa PA7]
 gi|218889408|ref|YP_002438272.1| 30S ribosomal protein S10 [Pseudomonas aeruginosa LESB58]
 gi|254237127|ref|ZP_04930450.1| 30S ribosomal protein S10 [Pseudomonas aeruginosa C3719]
 gi|254242917|ref|ZP_04936239.1| 30S ribosomal protein S10 [Pseudomonas aeruginosa 2192]
 gi|296387179|ref|ZP_06876678.1| 30S ribosomal protein S10 [Pseudomonas aeruginosa PAb1]
 gi|17865596|sp|Q9HWD4|RS10_PSEAE RecName: Full=30S ribosomal protein S10
 gi|122261448|sp|Q02T81|RS10_PSEAB RecName: Full=30S ribosomal protein S10
 gi|122985972|sp|Q1IFW7|RS10_PSEE4 RecName: Full=30S ribosomal protein S10
 gi|166231313|sp|A6UZI7|RS10_PSEA7 RecName: Full=30S ribosomal protein S10
 gi|226705610|sp|B7V643|RS10_PSEA8 RecName: Full=30S ribosomal protein S10
 gi|9950482|gb|AAG07652.1|AE004842_1 30S ribosomal protein S10 [Pseudomonas aeruginosa PAO1]
 gi|95108741|emb|CAK13435.1| 30S ribosomal subunit protein S10 [Pseudomonas entomophila L48]
 gi|115587520|gb|ABJ13535.1| 30S ribosomal protein S10 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126169058|gb|EAZ54569.1| 30S ribosomal protein S10 [Pseudomonas aeruginosa C3719]
 gi|126196295|gb|EAZ60358.1| 30S ribosomal protein S10 [Pseudomonas aeruginosa 2192]
 gi|150963570|gb|ABR85595.1| ribosomal protein S10 [Pseudomonas aeruginosa PA7]
 gi|218769631|emb|CAW25391.1| 30S ribosomal protein S10 [Pseudomonas aeruginosa LESB58]
 gi|310941695|dbj|BAJ24201.1| 30S ribosomal protein S10 [Pseudomonas aeruginosa]
          Length = 103

 Score =  119 bits (299), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 77/101 (76%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N +I I LKAFD R++D S +EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +
Sbjct: 2   QNQQIRIRLKAFDHRLIDQSTQEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KR+L I++PT +TVDALMKLD+AAGV V I L
Sbjct: 62  RDQYEIRTHKRVLDIVQPTDKTVDALMKLDLAAGVEVQISL 102


>gi|15603281|ref|NP_246355.1| 30S ribosomal protein S10 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|16762842|ref|NP_458459.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|16766730|ref|NP_462345.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|22127859|ref|NP_671282.1| 30S ribosomal protein S10 [Yersinia pestis KIM 10]
 gi|29144329|ref|NP_807671.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|32035712|ref|ZP_00135593.1| COG0051: Ribosomal protein S10 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|37528544|ref|NP_931889.1| 30S ribosomal protein S10 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|45440066|ref|NP_991605.1| 30S ribosomal protein S10 [Yersinia pestis biovar Microtus str.
           91001]
 gi|51597989|ref|YP_072180.1| 30S ribosomal protein S10 [Yersinia pseudotuberculosis IP 32953]
 gi|56415360|ref|YP_152435.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62181945|ref|YP_218362.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|68249372|ref|YP_248484.1| 30S ribosomal protein S10 [Haemophilus influenzae 86-028NP]
 gi|108809255|ref|YP_653171.1| 30S ribosomal protein S10 [Yersinia pestis Antiqua]
 gi|108814020|ref|YP_649787.1| 30S ribosomal protein S10 [Yersinia pestis Nepal516]
 gi|113460207|ref|YP_718264.1| SSU ribosomal protein S10P [Haemophilus somnus 129PT]
 gi|123444099|ref|YP_001008069.1| 30S ribosomal protein S10 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|126209223|ref|YP_001054448.1| 30S ribosomal protein S10 [Actinobacillus pleuropneumoniae L20]
 gi|145597451|ref|YP_001161526.1| 30S ribosomal protein S10 [Yersinia pestis Pestoides F]
 gi|145628335|ref|ZP_01784136.1| 30S ribosomal protein S10 [Haemophilus influenzae 22.1-21]
 gi|145630521|ref|ZP_01786301.1| 30S ribosomal protein S10 [Haemophilus influenzae R3021]
 gi|145632129|ref|ZP_01787864.1| 30S ribosomal protein S10 [Haemophilus influenzae 3655]
 gi|145634813|ref|ZP_01790521.1| 30S ribosomal protein S10 [Haemophilus influenzae PittAA]
 gi|145636668|ref|ZP_01792335.1| 30S ribosomal protein S10 [Haemophilus influenzae PittHH]
 gi|145638424|ref|ZP_01794034.1| 30S ribosomal protein S10 [Haemophilus influenzae PittII]
 gi|145640869|ref|ZP_01796451.1| acetyl-CoA:acetoacetyl-CoA transferase subunit alpha [Haemophilus
           influenzae R3021]
 gi|148826578|ref|YP_001291331.1| 50S ribosomal protein L3 [Haemophilus influenzae PittEE]
 gi|148827965|ref|YP_001292718.1| acetyl-CoA:acetoacetyl-CoA transferase subunit alpha [Haemophilus
           influenzae PittGG]
 gi|150260744|ref|ZP_01917472.1| 30S ribosomal protein S10 [Yersinia pestis CA88-4125]
 gi|152972228|ref|YP_001337374.1| 30S ribosomal protein S10 [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|152978140|ref|YP_001343769.1| ribosomal protein S10 [Actinobacillus succinogenes 130Z]
 gi|153949097|ref|YP_001402864.1| ribosomal protein S10 [Yersinia pseudotuberculosis IP 31758]
 gi|156932230|ref|YP_001436146.1| hypothetical protein ESA_00001 [Cronobacter sakazakii ATCC BAA-894]
 gi|157148901|ref|YP_001456220.1| hypothetical protein CKO_04739 [Citrobacter koseri ATCC BAA-895]
 gi|157372777|ref|YP_001480766.1| 30S ribosomal protein S10 [Serratia proteamaculans 568]
 gi|161350025|ref|NP_438935.2| 30S ribosomal protein S10 [Haemophilus influenzae Rd KW20]
 gi|161506005|ref|YP_001573117.1| hypothetical protein SARI_04186 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|161510955|ref|YP_089241.2| 30S ribosomal protein S10 [Mannheimia succiniciproducens MBEL55E]
 gi|161616468|ref|YP_001590433.1| hypothetical protein SPAB_04283 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|162419476|ref|YP_001605174.1| ribosomal protein S10 [Yersinia pestis Angola]
 gi|165927881|ref|ZP_02223713.1| ribosomal protein S10 [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165940002|ref|ZP_02228538.1| ribosomal protein S10 [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165977195|ref|YP_001652788.1| ribosomal protein S10 [Actinobacillus pleuropneumoniae serovar 3
           str. JL03]
 gi|166010578|ref|ZP_02231476.1| ribosomal protein S10 [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166213264|ref|ZP_02239299.1| ribosomal protein S10 [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167399204|ref|ZP_02304728.1| ribosomal protein S10 [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167418843|ref|ZP_02310596.1| ribosomal protein S10 [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167425624|ref|ZP_02317377.1| ribosomal protein S10 [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|167554349|ref|ZP_02348090.1| ribosomal protein S10 [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|167854920|ref|ZP_02477696.1| fumarate hydratase [Haemophilus parasuis 29755]
 gi|168239827|ref|ZP_02664885.1| ribosomal protein S10 [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|168245311|ref|ZP_02670243.1| ribosomal protein S10 [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|168260849|ref|ZP_02682822.1| ribosomal protein S10 [Salmonella enterica subsp. enterica serovar
           Hadar str. RI_05P066]
 gi|168468000|ref|ZP_02701837.1| ribosomal protein S10 [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|170022543|ref|YP_001719048.1| ribosomal protein S10 [Yersinia pseudotuberculosis YPIII]
 gi|170718245|ref|YP_001785265.1| ribosomal protein S10 [Haemophilus somnus 2336]
 gi|183600754|ref|ZP_02962247.1| hypothetical protein PROSTU_04348 [Providencia stuartii ATCC 25827]
 gi|186897185|ref|YP_001874297.1| ribosomal protein S10 [Yersinia pseudotuberculosis PB1/+]
 gi|188535280|ref|YP_001909077.1| 30S ribosomal protein S10 [Erwinia tasmaniensis Et1/99]
 gi|190151113|ref|YP_001969638.1| 30S ribosomal protein S10 [Actinobacillus pleuropneumoniae serovar
           7 str. AP76]
 gi|194443646|ref|YP_002042691.1| ribosomal protein S10 [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194448691|ref|YP_002047464.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194468485|ref|ZP_03074469.1| ribosomal protein S10 [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|194737772|ref|YP_002116383.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197249343|ref|YP_002148360.1| ribosomal protein S10 [Salmonella enterica subsp. enterica serovar
           Agona str. SL483]
 gi|197263900|ref|ZP_03163974.1| ribosomal protein S10 [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197287067|ref|YP_002152939.1| 30S ribosomal protein S10 [Proteus mirabilis HI4320]
 gi|197364290|ref|YP_002143927.1| 30S ribosomal subunit protein S10 [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|198246251|ref|YP_002217403.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200387006|ref|ZP_03213618.1| ribosomal protein S10 [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|205354931|ref|YP_002228732.1| 30S ribosomal subunit protein S10 [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|206575812|ref|YP_002236280.1| ribosomal protein S10 [Klebsiella pneumoniae 342]
 gi|207858683|ref|YP_002245334.1| 30S ribosomal subunit protein S10 [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|212708980|ref|ZP_03317108.1| hypothetical protein PROVALCAL_00012 [Providencia alcalifaciens DSM
           30120]
 gi|213021589|ref|ZP_03336036.1| 30S ribosomal subunit protein S10 [Salmonella enterica subsp.
           enterica serovar Typhi str. 404ty]
 gi|213052952|ref|ZP_03345830.1| 30S ribosomal subunit protein S10 [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
 gi|213416461|ref|ZP_03349605.1| 30S ribosomal subunit protein S10 [Salmonella enterica subsp.
           enterica serovar Typhi str. E01-6750]
 gi|213425749|ref|ZP_03358499.1| 30S ribosomal subunit protein S10 [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213583773|ref|ZP_03365599.1| 30S ribosomal subunit protein S10 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
 gi|213613029|ref|ZP_03370855.1| 30S ribosomal subunit protein S10 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
 gi|213646334|ref|ZP_03376387.1| 30S ribosomal subunit protein S10 [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213865563|ref|ZP_03387682.1| 30S ribosomal subunit protein S10 [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|218550596|ref|YP_002384387.1| 30S ribosomal protein S10 [Escherichia fergusonii ATCC 35469]
 gi|218927414|ref|YP_002345289.1| 30S ribosomal protein S10 [Yersinia pestis CO92]
 gi|219871729|ref|YP_002476104.1| 30S ribosomal protein S10 [Haemophilus parasuis SH0165]
 gi|223041816|ref|ZP_03612006.1| 30S ribosomal protein S10 [Actinobacillus minor 202]
 gi|224585236|ref|YP_002639035.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|226329478|ref|ZP_03804996.1| hypothetical protein PROPEN_03387 [Proteus penneri ATCC 35198]
 gi|227115273|ref|ZP_03828929.1| 30S ribosomal protein S10 [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
 gi|227328950|ref|ZP_03832974.1| 30S ribosomal protein S10 [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
 gi|227354935|ref|ZP_03839349.1| ribosomal protein S10 [Proteus mirabilis ATCC 29906]
 gi|229836310|ref|ZP_04456477.1| 30S ribosomal subunit protein S10 [Yersinia pestis Pestoides A]
 gi|229840066|ref|ZP_04460225.1| 30S ribosomal subunit protein S10 [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229842148|ref|ZP_04462303.1| 30S ribosomal subunit protein S10 [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229844643|ref|ZP_04464782.1| 30S ribosomal protein S10 [Haemophilus influenzae 6P18H1]
 gi|229845826|ref|ZP_04465938.1| 30S ribosomal protein S10 [Haemophilus influenzae 7P49H1]
 gi|229904552|ref|ZP_04519663.1| 30S ribosomal subunit protein S10 [Yersinia pestis Nepal516]
 gi|237728656|ref|ZP_04559137.1| ribosomal protein S10 [Citrobacter sp. 30_2]
 gi|238752688|ref|ZP_04614159.1| 30S ribosomal protein S10 [Yersinia rohdei ATCC 43380]
 gi|238758763|ref|ZP_04619937.1| 30S ribosomal protein S10 [Yersinia aldovae ATCC 35236]
 gi|238763731|ref|ZP_04624690.1| 30S ribosomal protein S10 [Yersinia kristensenii ATCC 33638]
 gi|238783168|ref|ZP_04627194.1| 30S ribosomal protein S10 [Yersinia bercovieri ATCC 43970]
 gi|238788911|ref|ZP_04632701.1| 30S ribosomal protein S10 [Yersinia frederiksenii ATCC 33641]
 gi|238792937|ref|ZP_04636567.1| 30S ribosomal protein S10 [Yersinia intermedia ATCC 29909]
 gi|238797239|ref|ZP_04640740.1| 30S ribosomal protein S10 [Yersinia mollaretii ATCC 43969]
 gi|238896817|ref|YP_002921562.1| 30S ribosomal protein S10 [Klebsiella pneumoniae NTUH-K2044]
 gi|238913844|ref|ZP_04657681.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|238921443|ref|YP_002934958.1| 30S ribosomal protein S10 [Edwardsiella ictaluri 93-146]
 gi|240947885|ref|ZP_04752325.1| 30S ribosomal protein S10 [Actinobacillus minor NM305]
 gi|242237858|ref|YP_002986039.1| ribosomal protein S10 [Dickeya dadantii Ech703]
 gi|251787970|ref|YP_003002691.1| 30S ribosomal protein S10 [Dickeya zeae Ech1591]
 gi|251793826|ref|YP_003008558.1| 30S ribosomal protein S10 [Aggregatibacter aphrophilus NJ8700]
 gi|253690184|ref|YP_003019374.1| ribosomal protein S10 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|253991689|ref|YP_003043045.1| 30S ribosomal protein S10 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|254362075|ref|ZP_04978200.1| ribosomal protein S10 [Mannheimia haemolytica PHL213]
 gi|259910000|ref|YP_002650356.1| 30S ribosomal protein S10 [Erwinia pyrifoliae Ep1/96]
 gi|260599640|ref|YP_003212211.1| 30S ribosomal protein S10 [Cronobacter turicensis z3032]
 gi|260914681|ref|ZP_05921147.1| 30S ribosomal protein S10 [Pasteurella dagmatis ATCC 43325]
 gi|261342791|ref|ZP_05970649.1| ribosomal protein S10 [Enterobacter cancerogenus ATCC 35316]
 gi|261346936|ref|ZP_05974580.1| ribosomal protein S10 [Providencia rustigianii DSM 4541]
 gi|261493010|ref|ZP_05989552.1| RpsJ protein [Mannheimia haemolytica serotype A2 str. BOVINE]
 gi|261495170|ref|ZP_05991633.1| RpsJ protein [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|261823233|ref|YP_003261339.1| 30S ribosomal protein S10 [Pectobacterium wasabiae WPP163]
 gi|261866796|ref|YP_003254718.1| 30S ribosomal protein S10 [Aggregatibacter actinomycetemcomitans
           D11S-1]
 gi|262045178|ref|ZP_06018205.1| 30S ribosomal protein S10 [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|268593540|ref|ZP_06127761.1| ribosomal protein S10 [Providencia rettgeri DSM 1131]
 gi|269140571|ref|YP_003297272.1| 30S ribosomal protein S10 [Edwardsiella tarda EIB202]
 gi|270264374|ref|ZP_06192640.1| 30S ribosomal protein S10 [Serratia odorifera 4Rx13]
 gi|270488232|ref|ZP_06205306.1| ribosomal protein S10 [Yersinia pestis KIM D27]
 gi|271502247|ref|YP_003335273.1| 30S ribosomal protein S10 [Dickeya dadantii Ech586]
 gi|283788043|ref|YP_003367908.1| 30S ribosomal subunit protein S10 [Citrobacter rodentium ICC168]
 gi|283835738|ref|ZP_06355479.1| hypothetical protein CIT292_10130 [Citrobacter youngae ATCC 29220]
 gi|288933265|ref|YP_003437324.1| ribosomal protein S10 [Klebsiella variicola At-22]
 gi|289824749|ref|ZP_06544214.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|290477193|ref|YP_003470108.1| 30S ribosomal subunit protein S10 [Xenorhabdus bovienii SS-2004]
 gi|290512068|ref|ZP_06551436.1| 30S ribosomal protein S10 [Klebsiella sp. 1_1_55]
 gi|292489850|ref|YP_003532740.1| 30S ribosomal protein S10 [Erwinia amylovora CFBP1430]
 gi|292900892|ref|YP_003540261.1| 30S ribosomal protein S10 [Erwinia amylovora ATCC 49946]
 gi|293391694|ref|ZP_06636028.1| RpsJ protein [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|293393312|ref|ZP_06637626.1| 30S ribosomal protein S10 [Serratia odorifera DSM 4582]
 gi|294502288|ref|YP_003566350.1| 30S ribosomal protein S10 [Yersinia pestis Z176003]
 gi|294638053|ref|ZP_06716313.1| ribosomal protein S10 [Edwardsiella tarda ATCC 23685]
 gi|296105029|ref|YP_003615175.1| small subunit ribosomal protein S10 [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|300718706|ref|YP_003743509.1| 30S ribosomal protein S10 [Erwinia billingiae Eb661]
 gi|300721364|ref|YP_003710635.1| 30S ribosomal subunit protein S10 [Xenorhabdus nematophila ATCC
           19061]
 gi|303250011|ref|ZP_07336213.1| ribosomal protein S10 [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|303253185|ref|ZP_07339334.1| ribosomal protein S10 [Actinobacillus pleuropneumoniae serovar 2
           str. 4226]
 gi|304399292|ref|ZP_07381158.1| ribosomal protein S10 [Pantoea sp. aB]
 gi|307132840|ref|YP_003884856.1| 30S ribosomal subunit protein S10 [Dickeya dadantii 3937]
 gi|307246688|ref|ZP_07528758.1| 30S ribosomal protein S10 [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
 gi|307248830|ref|ZP_07530843.1| 30S ribosomal protein S10 [Actinobacillus pleuropneumoniae serovar
           2 str. S1536]
 gi|307251057|ref|ZP_07532981.1| 30S ribosomal protein S10 [Actinobacillus pleuropneumoniae serovar
           4 str. M62]
 gi|307253443|ref|ZP_07535314.1| 30S ribosomal protein S10 [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|307255673|ref|ZP_07537477.1| 30S ribosomal protein S10 [Actinobacillus pleuropneumoniae serovar
           9 str. CVJ13261]
 gi|307257856|ref|ZP_07539613.1| 30S ribosomal protein S10 [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|307260125|ref|ZP_07541835.1| 30S ribosomal protein S10 [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
 gi|307262254|ref|ZP_07543903.1| 30S ribosomal protein S10 [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
 gi|307264463|ref|ZP_07546048.1| 30S ribosomal protein S10 [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
 gi|308188358|ref|YP_003932489.1| 30S ribosomal protein S10 [Pantoea vagans C9-1]
 gi|311277724|ref|YP_003939955.1| ribosomal protein S10 [Enterobacter cloacae SCF1]
 gi|315633454|ref|ZP_07888744.1| 30S ribosomal protein S10 [Aggregatibacter segnis ATCC 33393]
 gi|317494343|ref|ZP_07952757.1| ribosomal protein S10 [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|319775290|ref|YP_004137778.1| 30S ribosomal subunit protein S10 [Haemophilus influenzae F3047]
 gi|319897730|ref|YP_004135927.1| 30S ribosomal subunit protein s10 [Haemophilus influenzae F3031]
 gi|322515636|ref|ZP_08068614.1| 30S ribosomal protein S10 [Actinobacillus ureae ATCC 25976]
 gi|330002295|ref|ZP_08304289.1| ribosomal protein S10 [Klebsiella sp. MS 92-3]
 gi|332163260|ref|YP_004299837.1| 30S ribosomal protein S10 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|54039358|sp|P67901|RS10_HAEIN RecName: Full=30S ribosomal protein S10
 gi|54039359|sp|P67902|RS10_PASMU RecName: Full=30S ribosomal protein S10
 gi|54039360|sp|P67903|RS10_PHOLL RecName: Full=30S ribosomal protein S10
 gi|54039361|sp|P67904|RS10_SALTY RecName: Full=30S ribosomal protein S10
 gi|54039362|sp|P67905|RS10_SALTI RecName: Full=30S ribosomal protein S10
 gi|54039363|sp|P67906|RS10_YERPE RecName: Full=30S ribosomal protein S10
 gi|75480347|sp|Q57J31|RS10_SALCH RecName: Full=30S ribosomal protein S10
 gi|81336201|sp|Q4QMC3|RS10_HAEI8 RecName: Full=30S ribosomal protein S10
 gi|81599605|sp|Q5PIV1|RS10_SALPA RecName: Full=30S ribosomal protein S10
 gi|81638246|sp|Q664S0|RS10_YERPS RecName: Full=30S ribosomal protein S10
 gi|115305626|sp|Q65QV4|RS10_MANSM RecName: Full=30S ribosomal protein S10
 gi|118597341|sp|Q1C2U6|RS10_YERPA RecName: Full=30S ribosomal protein S10
 gi|118597342|sp|Q1CCU3|RS10_YERPN RecName: Full=30S ribosomal protein S10
 gi|123131903|sp|Q0I164|RS10_HAES1 RecName: Full=30S ribosomal protein S10
 gi|166231234|sp|A3N357|RS10_ACTP2 RecName: Full=30S ribosomal protein S10
 gi|166231259|sp|A8AQM1|RS10_CITK8 RecName: Full=30S ribosomal protein S10
 gi|166231269|sp|A7MPI6|RS10_ENTS8 RecName: Full=30S ribosomal protein S10
 gi|166231276|sp|A5UDU7|RS10_HAEIE RecName: Full=30S ribosomal protein S10
 gi|166231277|sp|A5UHS9|RS10_HAEIG RecName: Full=30S ribosomal protein S10
 gi|166231279|sp|A6TEX3|RS10_KLEP7 RecName: Full=30S ribosomal protein S10
 gi|166231797|sp|A1JS48|RS10_YERE8 RecName: Full=30S ribosomal protein S10
 gi|166231798|sp|A4TGZ1|RS10_YERPP RecName: Full=30S ribosomal protein S10
 gi|166991571|sp|A8GKJ8|RS10_SERP5 RecName: Full=30S ribosomal protein S10
 gi|166991574|sp|A7FNN6|RS10_YERP3 RecName: Full=30S ribosomal protein S10
 gi|171472957|sp|A6VLI7|RS10_ACTSZ RecName: Full=30S ribosomal protein S10
 gi|189040375|sp|B0UX12|RS10_HAES2 RecName: Full=30S ribosomal protein S10
 gi|189040388|sp|A9MN45|RS10_SALAR RecName: Full=30S ribosomal protein S10
 gi|189040389|sp|A9MT00|RS10_SALPB RecName: Full=30S ribosomal protein S10
 gi|226705390|sp|B3GZ10|RS10_ACTP7 RecName: Full=30S ribosomal protein S10
 gi|226705391|sp|B0BST0|RS10_ACTPJ RecName: Full=30S ribosomal protein S10
 gi|226705444|sp|B2VK34|RS10_ERWT9 RecName: Full=30S ribosomal protein S10
 gi|226705445|sp|B7LS41|RS10_ESCF3 RecName: Full=30S ribosomal protein S10
 gi|226705580|sp|B5XN93|RS10_KLEP3 RecName: Full=30S ribosomal protein S10
 gi|226705609|sp|B4F1I3|RS10_PROMH RecName: Full=30S ribosomal protein S10
 gi|226705617|sp|B5F8F3|RS10_SALA4 RecName: Full=30S ribosomal protein S10
 gi|226705618|sp|B5FJL5|RS10_SALDC RecName: Full=30S ribosomal protein S10
 gi|226705619|sp|B5R292|RS10_SALEP RecName: Full=30S ribosomal protein S10
 gi|226705620|sp|B5RH14|RS10_SALG2 RecName: Full=30S ribosomal protein S10
 gi|226705621|sp|B4TKL6|RS10_SALHS RecName: Full=30S ribosomal protein S10
 gi|226705622|sp|B4SUU1|RS10_SALNS RecName: Full=30S ribosomal protein S10
 gi|226705623|sp|B5BGY7|RS10_SALPK RecName: Full=30S ribosomal protein S10
 gi|226705624|sp|B4TXE3|RS10_SALSV RecName: Full=30S ribosomal protein S10
 gi|226708313|sp|B2K5N1|RS10_YERPB RecName: Full=30S ribosomal protein S10
 gi|226708314|sp|A9R8Z5|RS10_YERPG RecName: Full=30S ribosomal protein S10
 gi|226708315|sp|B1JIW0|RS10_YERPY RecName: Full=30S ribosomal protein S10
 gi|254809581|sp|B8F754|RS10_HAEPS RecName: Full=30S ribosomal protein S10
 gi|254809983|sp|C0Q0B7|RS10_SALPC RecName: Full=30S ribosomal protein S10
 gi|259494590|sp|C5BGM6|RS10_EDWI9 RecName: Full=30S ribosomal protein S10
 gi|259494599|sp|C6DG75|RS10_PECCP RecName: Full=30S ribosomal protein S10
 gi|25294648|pir||AH1005 30S ribosomal chain protein S10 [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|21960994|gb|AAM87533.1|AE014002_6 30S ribosomal subunit protein S10 [Yersinia pestis KIM 10]
 gi|12721791|gb|AAK03500.1| RpS10 [Pasteurella multocida subsp. multocida str. Pm70]
 gi|16421998|gb|AAL22304.1| 30S ribosomal subunit protein S10 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|16505148|emb|CAD08172.1| 30S ribosomal subunit protein S10 [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29139967|gb|AAO71531.1| 30S ribosomal subunit protein S10 [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|36787982|emb|CAE17099.1| 30S ribosomal protein S10 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|45434921|gb|AAS60482.1| 30S ribosomal protein S10 [Yersinia pestis biovar Microtus str.
           91001]
 gi|51591271|emb|CAH22937.1| 30S ribosomal protein S10 [Yersinia pseudotuberculosis IP 32953]
 gi|56129617|gb|AAV79123.1| 30S ribosomal subunit protein S10 [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|62129578|gb|AAX67281.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|68057571|gb|AAX87824.1| 30S ribosomal protein S10 [Haemophilus influenzae 86-028NP]
 gi|108777668|gb|ABG20187.1| SSU ribosomal protein S10P [Yersinia pestis Nepal516]
 gi|108781168|gb|ABG15226.1| SSU ribosomal protein S10P [Yersinia pestis Antiqua]
 gi|112822250|gb|ABI24339.1| SSU ribosomal protein S10P [Haemophilus somnus 129PT]
 gi|115346025|emb|CAL18891.1| 30S ribosomal protein S10 [Yersinia pestis CO92]
 gi|122091060|emb|CAL13943.1| 30S ribosomal protein S10 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|126098015|gb|ABN74843.1| 30S ribosomal protein S10 [Actinobacillus pleuropneumoniae serovar
           5b str. L20]
 gi|144980110|gb|EDJ89769.1| 30S ribosomal protein S10 [Haemophilus influenzae 22.1-21]
 gi|144983911|gb|EDJ91353.1| 30S ribosomal protein S10 [Haemophilus influenzae R3021]
 gi|144987036|gb|EDJ93566.1| 30S ribosomal protein S10 [Haemophilus influenzae 3655]
 gi|145209147|gb|ABP38554.1| SSU ribosomal protein S10P [Yersinia pestis Pestoides F]
 gi|145267979|gb|EDK07975.1| 30S ribosomal protein S10 [Haemophilus influenzae PittAA]
 gi|145270194|gb|EDK10130.1| 30S ribosomal protein S10 [Haemophilus influenzae PittHH]
 gi|145272753|gb|EDK12660.1| 30S ribosomal protein S10 [Haemophilus influenzae PittII]
 gi|145274383|gb|EDK14247.1| acetyl-CoA:acetoacetyl-CoA transferase subunit alpha [Haemophilus
           influenzae 22.4-21]
 gi|148716738|gb|ABQ98948.1| 50S ribosomal protein L3 [Haemophilus influenzae PittEE]
 gi|148719207|gb|ABR00335.1| acetyl-CoA:acetoacetyl-CoA transferase subunit alpha [Haemophilus
           influenzae PittGG]
 gi|149290152|gb|EDM40229.1| 30S ribosomal protein S10 [Yersinia pestis CA88-4125]
 gi|150839863|gb|ABR73834.1| ribosomal protein S10 [Actinobacillus succinogenes 130Z]
 gi|150957077|gb|ABR79107.1| 30S ribosomal protein S10 [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|152960592|gb|ABS48053.1| ribosomal protein S10 [Yersinia pseudotuberculosis IP 31758]
 gi|153093631|gb|EDN74596.1| ribosomal protein S10 [Mannheimia haemolytica PHL213]
 gi|156530484|gb|ABU75310.1| hypothetical protein ESA_00001 [Cronobacter sakazakii ATCC BAA-894]
 gi|157086106|gb|ABV15784.1| hypothetical protein CKO_04739 [Citrobacter koseri ATCC BAA-895]
 gi|157324541|gb|ABV43638.1| ribosomal protein S10 [Serratia proteamaculans 568]
 gi|160867352|gb|ABX23975.1| hypothetical protein SARI_04186 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
 gi|161365832|gb|ABX69600.1| hypothetical protein SPAB_04283 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|162352291|gb|ABX86239.1| ribosomal protein S10 [Yersinia pestis Angola]
 gi|165877296|gb|ABY70344.1| ribosomal protein S10 [Actinobacillus pleuropneumoniae serovar 3
           str. JL03]
 gi|165912042|gb|EDR30683.1| ribosomal protein S10 [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165920157|gb|EDR37458.1| ribosomal protein S10 [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165990668|gb|EDR42969.1| ribosomal protein S10 [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166205562|gb|EDR50042.1| ribosomal protein S10 [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166962837|gb|EDR58858.1| ribosomal protein S10 [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167051708|gb|EDR63116.1| ribosomal protein S10 [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167055314|gb|EDR65108.1| ribosomal protein S10 [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|167853987|gb|EDS25225.1| fumarate hydratase [Haemophilus parasuis 29755]
 gi|168826374|gb|ACA31745.1| ribosomal protein S10 [Haemophilus somnus 2336]
 gi|169749077|gb|ACA66595.1| ribosomal protein S10 [Yersinia pseudotuberculosis YPIII]
 gi|186700211|gb|ACC90840.1| ribosomal protein S10 [Yersinia pseudotuberculosis PB1/+]
 gi|188019732|gb|EDU57772.1| hypothetical protein PROSTU_04348 [Providencia stuartii ATCC 25827]
 gi|188030322|emb|CAO98211.1| 30S ribosomal protein S10 [Erwinia tasmaniensis Et1/99]
 gi|189916244|gb|ACE62496.1| 30S ribosomal protein S10 [Actinobacillus pleuropneumoniae serovar
           7 str. AP76]
 gi|194402309|gb|ACF62531.1| ribosomal protein S10 [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194406995|gb|ACF67214.1| ribosomal protein S10 [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194454849|gb|EDX43688.1| ribosomal protein S10 [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|194684554|emb|CAR46378.1| 30S ribosomal protein S10 [Proteus mirabilis HI4320]
 gi|194713274|gb|ACF92495.1| ribosomal protein S10 [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|195628912|gb|EDX48322.1| ribosomal protein S10 [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|197095767|emb|CAR61337.1| 30S ribosomal subunit protein S10 [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|197213046|gb|ACH50443.1| ribosomal protein S10 [Salmonella enterica subsp. enterica serovar
           Agona str. SL483]
 gi|197242155|gb|EDY24775.1| ribosomal protein S10 [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197287550|gb|EDY26943.1| ribosomal protein S10 [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|197940767|gb|ACH78100.1| ribosomal protein S10 [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|199604104|gb|EDZ02649.1| ribosomal protein S10 [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|205274712|emb|CAR39768.1| 30S ribosomal subunit protein S10 [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|205321445|gb|EDZ09284.1| ribosomal protein S10 [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|205335971|gb|EDZ22735.1| ribosomal protein S10 [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|205350423|gb|EDZ37054.1| ribosomal protein S10 [Salmonella enterica subsp. enterica serovar
           Hadar str. RI_05P066]
 gi|206564870|gb|ACI06646.1| ribosomal protein S10 [Klebsiella pneumoniae 342]
 gi|206710486|emb|CAR34844.1| 30S ribosomal subunit protein S10 [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|212688346|gb|EEB47874.1| hypothetical protein PROVALCAL_00012 [Providencia alcalifaciens DSM
           30120]
 gi|218358137|emb|CAQ90784.1| 30S ribosomal subunit protein S10 [Escherichia fergusonii ATCC
           35469]
 gi|219691933|gb|ACL33156.1| 30S ribosomal protein S10 [Haemophilus parasuis SH0165]
 gi|223017385|gb|EEF15806.1| 30S ribosomal protein S10 [Actinobacillus minor 202]
 gi|224469764|gb|ACN47594.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|224965622|emb|CAX57154.1| 30S ribosomal protein S10 [Erwinia pyrifoliae Ep1/96]
 gi|225202664|gb|EEG85018.1| hypothetical protein PROPEN_03387 [Proteus penneri ATCC 35198]
 gi|226909278|gb|EEH95196.1| ribosomal protein S10 [Citrobacter sp. 30_2]
 gi|227165017|gb|EEI49856.1| ribosomal protein S10 [Proteus mirabilis ATCC 29906]
 gi|229678670|gb|EEO74775.1| 30S ribosomal subunit protein S10 [Yersinia pestis Nepal516]
 gi|229690458|gb|EEO82512.1| 30S ribosomal subunit protein S10 [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229696432|gb|EEO86479.1| 30S ribosomal subunit protein S10 [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229706378|gb|EEO92385.1| 30S ribosomal subunit protein S10 [Yersinia pestis Pestoides A]
 gi|229810830|gb|EEP46547.1| 30S ribosomal protein S10 [Haemophilus influenzae 7P49H1]
 gi|229812357|gb|EEP48047.1| 30S ribosomal protein S10 [Haemophilus influenzae 6P18H1]
 gi|238549144|dbj|BAH65495.1| 30S ribosomal protein S10 [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
 gi|238698033|gb|EEP90791.1| 30S ribosomal protein S10 [Yersinia kristensenii ATCC 33638]
 gi|238703060|gb|EEP95603.1| 30S ribosomal protein S10 [Yersinia aldovae ATCC 35236]
 gi|238709115|gb|EEQ01362.1| 30S ribosomal protein S10 [Yersinia rohdei ATCC 43380]
 gi|238715964|gb|EEQ07950.1| 30S ribosomal protein S10 [Yersinia bercovieri ATCC 43970]
 gi|238718876|gb|EEQ10691.1| 30S ribosomal protein S10 [Yersinia mollaretii ATCC 43969]
 gi|238722938|gb|EEQ14588.1| 30S ribosomal protein S10 [Yersinia frederiksenii ATCC 33641]
 gi|238727791|gb|EEQ19315.1| 30S ribosomal protein S10 [Yersinia intermedia ATCC 29909]
 gi|238871012|gb|ACR70723.1| 30S ribosomal protein S10, putative [Edwardsiella ictaluri 93-146]
 gi|240297847|gb|EER48283.1| 30S ribosomal protein S10 [Actinobacillus minor NM305]
 gi|242129915|gb|ACS84217.1| ribosomal protein S10 [Dickeya dadantii Ech703]
 gi|247535225|gb|ACS98471.1| ribosomal protein S10 [Aggregatibacter aphrophilus NJ8700]
 gi|247536591|gb|ACT05212.1| ribosomal protein S10 [Dickeya zeae Ech1591]
 gi|251756762|gb|ACT14838.1| ribosomal protein S10 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|253783139|emb|CAQ86304.1| 30s ribosomal subunit protein s10 [Photorhabdus asymbiotica]
 gi|259037498|gb|EEW38742.1| 30S ribosomal protein S10 [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|260218817|emb|CBA34172.1| 30S ribosomal protein S10 [Cronobacter turicensis z3032]
 gi|260631280|gb|EEX49465.1| 30S ribosomal protein S10 [Pasteurella dagmatis ATCC 43325]
 gi|261248597|emb|CBG26435.1| 30S ribosomal subunit protein S10 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|261309146|gb|EEY10386.1| RpsJ protein [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|261311354|gb|EEY12515.1| RpsJ protein [Mannheimia haemolytica serotype A2 str. BOVINE]
 gi|261412128|gb|ACX81499.1| hypothetical protein D11S_0075 [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261607246|gb|ACX89732.1| ribosomal protein S10 [Pectobacterium wasabiae WPP163]
 gi|262360368|gb|ACY57089.1| 30S ribosomal protein S10 [Yersinia pestis D106004]
 gi|262364320|gb|ACY60877.1| 30S ribosomal protein S10 [Yersinia pestis D182038]
 gi|267986232|gb|ACY86061.1| 30S ribosomal protein S10 [Edwardsiella tarda EIB202]
 gi|267995650|gb|ACY90535.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|270041510|gb|EFA14608.1| 30S ribosomal protein S10 [Serratia odorifera 4Rx13]
 gi|270336736|gb|EFA47513.1| ribosomal protein S10 [Yersinia pestis KIM D27]
 gi|270345802|gb|ACZ78567.1| ribosomal protein S10 [Dickeya dadantii Ech586]
 gi|282565001|gb|EFB70536.1| ribosomal protein S10 [Providencia rustigianii DSM 4541]
 gi|282951497|emb|CBG91196.1| 30S ribosomal subunit protein S10 [Citrobacter rodentium ICC168]
 gi|283480097|emb|CAY76013.1| 30S ribosomal protein S10 [Erwinia pyrifoliae DSM 12163]
 gi|284006164|emb|CBA71406.1| 30S ribosomal protein S10 [Arsenophonus nasoniae]
 gi|288314969|gb|EFC53907.1| ribosomal protein S10 [Enterobacter cancerogenus ATCC 35316]
 gi|288887994|gb|ADC56312.1| ribosomal protein S10 [Klebsiella variicola At-22]
 gi|289176541|emb|CBJ83350.1| 30S ribosomal subunit protein S10 [Xenorhabdus bovienii SS-2004]
 gi|289775858|gb|EFD83858.1| 30S ribosomal protein S10 [Klebsiella sp. 1_1_55]
 gi|290952228|gb|EFE02347.1| RpsJ protein [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|291068417|gb|EFE06526.1| ribosomal protein S10 [Citrobacter youngae ATCC 29220]
 gi|291088845|gb|EFE21406.1| ribosomal protein S10 [Edwardsiella tarda ATCC 23685]
 gi|291200740|emb|CBJ47873.1| 30S ribosomal protein S10 [Erwinia amylovora ATCC 49946]
 gi|291310818|gb|EFE51271.1| ribosomal protein S10 [Providencia rettgeri DSM 1131]
 gi|291424222|gb|EFE97437.1| 30S ribosomal protein S10 [Serratia odorifera DSM 4582]
 gi|291555287|emb|CBA23591.1| 30S ribosomal protein S10 [Erwinia amylovora CFBP1430]
 gi|294352747|gb|ADE63088.1| 30S ribosomal protein S10 [Yersinia pestis Z176003]
 gi|295059488|gb|ADF64226.1| small subunit ribosomal protein S10 [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295096962|emb|CBK86052.1| ribosomal protein S10, bacterial/organelle [Enterobacter cloacae
           subsp. cloacae NCTC 9394]
 gi|297627852|emb|CBJ88398.1| 30S ribosomal subunit protein S10 [Xenorhabdus nematophila ATCC
           19061]
 gi|299064542|emb|CAX61662.1| 30S ribosomal protein S10 [Erwinia billingiae Eb661]
 gi|301155329|emb|CBW14795.1| 30S ribosomal subunit protein S10 [Haemophilus parainfluenzae T3T1]
 gi|301159984|emb|CBW19503.1| 30S ribosomal subunit protein S10 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|301169493|emb|CBW29094.1| 30S ribosomal subunit protein S10 [Haemophilus influenzae 10810]
 gi|302647867|gb|EFL78074.1| ribosomal protein S10 [Actinobacillus pleuropneumoniae serovar 2
           str. 4226]
 gi|302651074|gb|EFL81228.1| ribosomal protein S10 [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|304353218|gb|EFM17599.1| ribosomal protein S10 [Pantoea sp. aB]
 gi|304560360|gb|ADM43024.1| SSU ribosomal protein S10p (S20e) [Edwardsiella tarda FL6-60]
 gi|306530369|gb|ADN00300.1| 30S ribosomal subunit protein S10 [Dickeya dadantii 3937]
 gi|306852388|gb|EFM84623.1| 30S ribosomal protein S10 [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
 gi|306854757|gb|EFM86947.1| 30S ribosomal protein S10 [Actinobacillus pleuropneumoniae serovar
           2 str. S1536]
 gi|306856887|gb|EFM89019.1| 30S ribosomal protein S10 [Actinobacillus pleuropneumoniae serovar
           4 str. M62]
 gi|306859122|gb|EFM91164.1| 30S ribosomal protein S10 [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|306861350|gb|EFM93340.1| 30S ribosomal protein S10 [Actinobacillus pleuropneumoniae serovar
           9 str. CVJ13261]
 gi|306863762|gb|EFM95688.1| 30S ribosomal protein S10 [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|306865771|gb|EFM97649.1| 30S ribosomal protein S10 [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
 gi|306868017|gb|EFM99844.1| 30S ribosomal protein S10 [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
 gi|306870160|gb|EFN01919.1| 30S ribosomal protein S10 [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
 gi|308058868|gb|ADO11040.1| 30S ribosomal protein S10 [Pantoea vagans C9-1]
 gi|308746919|gb|ADO46671.1| ribosomal protein S10 [Enterobacter cloacae SCF1]
 gi|309751563|gb|ADO81547.1| 30S ribosomal protein S10 [Haemophilus influenzae R2866]
 gi|309973733|gb|ADO96934.1| 30S ribosomal protein S10 [Haemophilus influenzae R2846]
 gi|310765599|gb|ADP10549.1| Ribosomal protein S10 [Erwinia sp. Ejp617]
 gi|312174032|emb|CBX82285.1| 30S ribosomal protein S10 [Erwinia amylovora ATCC BAA-2158]
 gi|312914464|dbj|BAJ38438.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|315477496|gb|EFU68238.1| 30S ribosomal protein S10 [Aggregatibacter segnis ATCC 33393]
 gi|316917593|gb|EFV38938.1| ribosomal protein S10 [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|317433236|emb|CBY81611.1| 30S ribosomal subunit protein S10 [Haemophilus influenzae F3031]
 gi|317449881|emb|CBY86092.1| 30S ribosomal subunit protein S10 [Haemophilus influenzae F3047]
 gi|318607745|emb|CBY29243.1| SSU ribosomal protein S10p (S20e) [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|320013341|gb|ADV96912.1| 30S ribosomal subunit protein S10 [Yersinia pestis biovar
           Medievalis str. Harbin 35]
 gi|320087886|emb|CBY97649.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
 gi|321226488|gb|EFX51538.1| SSU ribosomal protein S10p S20e [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|322118287|gb|EFX90570.1| 30S ribosomal protein S10 [Actinobacillus ureae ATCC 25976]
 gi|322615018|gb|EFY11942.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322617305|gb|EFY14206.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322625527|gb|EFY22352.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322626369|gb|EFY23178.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322632119|gb|EFY28872.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322635002|gb|EFY31725.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322643297|gb|EFY39864.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322646619|gb|EFY43126.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322649965|gb|EFY46384.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322652682|gb|EFY49022.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322659561|gb|EFY55805.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322665497|gb|EFY61684.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322670391|gb|EFY66530.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322670464|gb|EFY66598.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322675040|gb|EFY71123.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322681577|gb|EFY77606.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322685921|gb|EFY81910.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|322716432|gb|EFZ08003.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
 gi|323131799|gb|ADX19229.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|323194029|gb|EFZ79229.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323196453|gb|EFZ81604.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323202308|gb|EFZ87353.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323207343|gb|EFZ92293.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323211221|gb|EFZ96066.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323216070|gb|EGA00801.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323223439|gb|EGA07767.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323226831|gb|EGA11021.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323231807|gb|EGA15917.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323233240|gb|EGA17335.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323237307|gb|EGA21372.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323245542|gb|EGA29541.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323249048|gb|EGA32970.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323250671|gb|EGA34552.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323256900|gb|EGA40614.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323263049|gb|EGA46596.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323266049|gb|EGA49544.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323272806|gb|EGA56209.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
 gi|324112000|gb|EGC05979.1| ribosomal protein S10 [Escherichia fergusonii B253]
 gi|325498886|gb|EGC96745.1| Ribosomal protein S10 [Escherichia fergusonii ECD227]
 gi|325667490|gb|ADZ44134.1| 30S ribosomal protein S10 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|326625184|gb|EGE31529.1| 30S ribosomal protein S10 [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
 gi|326630080|gb|EGE36423.1| Ribosomal protein S10 [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 9]
 gi|328537368|gb|EGF63618.1| ribosomal protein S10 [Klebsiella sp. MS 92-3]
 gi|330432125|gb|AEC17184.1| 30S ribosomal protein S10 [Gallibacterium anatis UMN179]
 gi|330861856|emb|CBX72027.1| 30S ribosomal protein S10 [Yersinia enterocolitica W22703]
          Length = 103

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 77/101 (76%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LKAFD R++D S  EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +
Sbjct: 2   QNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 62  RDQYEIRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISL 102


>gi|90581757|ref|ZP_01237541.1| 30S ribosomal protein S10 [Vibrio angustum S14]
 gi|330447038|ref|ZP_08310688.1| ribosomal protein S10 [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|90437055|gb|EAS62262.1| 30S ribosomal protein S10 [Vibrio angustum S14]
 gi|328491229|dbj|GAA05185.1| ribosomal protein S10 [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 103

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 77/101 (76%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LKAFD R++D S  EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +
Sbjct: 2   QNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVKGPIPLPTRKERFTVLISPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 62  RDQYEIRTHKRLIDIVEPTDKTVDALMRLDLAAGVDVQISL 102


>gi|281358742|ref|ZP_06245218.1| ribosomal protein S10 [Victivallis vadensis ATCC BAA-548]
 gi|281314769|gb|EFA98806.1| ribosomal protein S10 [Victivallis vadensis ATCC BAA-548]
          Length = 107

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 55/102 (53%), Positives = 76/102 (74%)

Query: 2   TSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDK 61
           T +N RI I L+A++ RILD S+ EI+   K++GS + GP+P P  I R+TVNRSPHVDK
Sbjct: 3   TGKNQRIRIRLQAYEHRILDQSVNEILEAAKRTGSMVAGPVPLPTRIERWTVNRSPHVDK 62

Query: 62  KSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           KS +Q E+R +KR+L I+ PT +TVD L KL++ AGV++ IK
Sbjct: 63  KSMEQFEIRTHKRMLDIVNPTAKTVDELKKLNLPAGVDITIK 104


>gi|52308156|gb|AAU38656.1| RpsJ protein [Mannheimia succiniciproducens MBEL55E]
          Length = 122

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 77/101 (76%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LKAFD R++D S  EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +
Sbjct: 21  QNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDA 80

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 81  RDQYEIRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISL 121


>gi|269104011|ref|ZP_06156708.1| SSU ribosomal protein S10p (S20e) [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268163909|gb|EEZ42405.1| SSU ribosomal protein S10p (S20e) [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 103

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 77/101 (76%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LKAFD R++D S  EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +
Sbjct: 2   QNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVKGPIPLPTRKERFTVLISPHVNKTA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 62  RDQYEIRTHKRLIDIVEPTDKTVDALMRLDLAAGVDVQISL 102


>gi|292492420|ref|YP_003527859.1| ribosomal protein S10 [Nitrosococcus halophilus Nc4]
 gi|291581015|gb|ADE15472.1| ribosomal protein S10 [Nitrosococcus halophilus Nc4]
          Length = 104

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 58/97 (59%), Positives = 75/97 (77%)

Query: 8   ICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQL 67
           I I LKAFD R++D S REIV T K++G+ + GPIP P    RFT+  SPHV+K +RDQ 
Sbjct: 7   IRIRLKAFDHRLIDQSAREIVDTAKRTGAHVRGPIPLPTRKERFTILISPHVNKDARDQY 66

Query: 68  EMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           E+R +KRL+ I++PT +TVDALMKLD+AAGV+V IKL
Sbjct: 67  EIRTHKRLMDIVEPTEKTVDALMKLDLAAGVDVQIKL 103


>gi|145300936|ref|YP_001143777.1| ribosomal protein S10 [Aeromonas salmonicida subsp. salmonicida
           A449]
 gi|142853708|gb|ABO92029.1| ribosomal protein S10 [Aeromonas salmonicida subsp. salmonicida
           A449]
          Length = 116

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/104 (56%), Positives = 79/104 (75%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           ++ +N RI I LKAFD R++D S  EIV T K++G+Q+ GPIP P    RFTV  SPHV+
Sbjct: 12  LSMQNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVN 71

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K +RDQ E+R +KRL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 72  KDARDQYEIRTHKRLVDIVEPTDKTVDALMRLDLAAGVDVQISL 115


>gi|90409444|ref|ZP_01217508.1| 30S ribosomal protein S10 [Psychromonas sp. CNPT3]
 gi|119947127|ref|YP_944807.1| ribosomal protein S10 [Psychromonas ingrahamii 37]
 gi|166231317|sp|A1T0E3|RS10_PSYIN RecName: Full=30S ribosomal protein S10
 gi|90309446|gb|EAS37667.1| 30S ribosomal protein S10 [Psychromonas sp. CNPT3]
 gi|119865731|gb|ABM05208.1| SSU ribosomal protein S10P [Psychromonas ingrahamii 37]
          Length = 103

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 77/101 (76%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LKAFD +++D S  EIV T K++G+Q+ GPIP P    RFT+  SPHV+K +
Sbjct: 2   QNQRIRIRLKAFDHKLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTILVSPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRL+ I++PT +TVDALMKLD+AAGV+V I L
Sbjct: 62  RDQYEIRTHKRLIDIVEPTEKTVDALMKLDLAAGVDVQISL 102


>gi|134298092|ref|YP_001111588.1| 30S ribosomal protein S10 [Desulfotomaculum reducens MI-1]
 gi|172044218|sp|A4J110|RS10_DESRM RecName: Full=30S ribosomal protein S10
 gi|134050792|gb|ABO48763.1| SSU ribosomal protein S10P [Desulfotomaculum reducens MI-1]
          Length = 102

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 79/101 (78%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N +I I LKAFD ++LD S  +IV T K++G+Q+ GP+P P     +T+ RSPHV+K S
Sbjct: 2   KNQKIRIRLKAFDHQMLDQSATKIVDTAKRTGAQVAGPVPLPTEKSIYTILRSPHVNKDS 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           R+Q EMR++KRL+ I++PTP+TVDALM+LD+ AGV++ IKL
Sbjct: 62  REQFEMRVHKRLIDILEPTPKTVDALMRLDLPAGVDIEIKL 102


>gi|270157911|ref|ZP_06186568.1| ribosomal protein S10 [Legionella longbeachae D-4968]
 gi|289163829|ref|YP_003453967.1| 30S ribosomal subunit protein S10 [Legionella longbeachae NSW150]
 gi|269989936|gb|EEZ96190.1| ribosomal protein S10 [Legionella longbeachae D-4968]
 gi|288857002|emb|CBJ10816.1| 30S ribosomal subunit protein S10 [Legionella longbeachae NSW150]
          Length = 105

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 60/102 (58%), Positives = 76/102 (74%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           S N  I I LK+FD R++D S REIV T K++G+QI GPIP P    +FTV  SPHV+K 
Sbjct: 2   SSNQNIKIRLKSFDHRLIDLSTREIVETAKRTGAQIRGPIPLPIRKEKFTVLTSPHVNKD 61

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +RDQ E+R +KRL+ I+ PT +TVDALMKLD+AAGV+V I L
Sbjct: 62  ARDQYELRTHKRLVVIVHPTEKTVDALMKLDLAAGVDVQISL 103


>gi|262273380|ref|ZP_06051194.1| SSU ribosomal protein S10p (S20e) [Grimontia hollisae CIP 101886]
 gi|262222358|gb|EEY73669.1| SSU ribosomal protein S10p (S20e) [Grimontia hollisae CIP 101886]
          Length = 103

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 77/101 (76%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LKAFD R++D S  EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +
Sbjct: 2   QNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 62  RDQYEIRTHKRLIDIVEPTDKTVDALMRLDLAAGVDVQISL 102


>gi|27904943|ref|NP_778069.1| 30S ribosomal protein S10 [Buchnera aphidicola str. Bp (Baizongia
           pistaciae)]
 gi|31076918|sp|Q89A67|RS10_BUCBP RecName: Full=30S ribosomal protein S10
 gi|27904341|gb|AAO27174.1| 30S ribosomal protein S10 [Buchnera aphidicola str. Bp (Baizongia
           pistaciae)]
          Length = 104

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 58/102 (56%), Positives = 77/102 (75%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
            +N RI I LKAFD R++D S  EIV T K++G+Q+ GPIP P    +FTV  SPHV+K 
Sbjct: 2   QQNQRIRIRLKAFDHRLIDQSTSEIVETAKRTGAQVRGPIPLPTHKEKFTVLISPHVNKD 61

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +RDQ E+R +KRL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 62  ARDQYEIRTHKRLIDIVEPTEKTVDALMRLDLAAGVDVQISL 103


>gi|15617119|ref|NP_240332.1| 30S ribosomal protein S10 [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|219681871|ref|YP_002468257.1| 30S ribosomal protein S10 [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|219682426|ref|YP_002468810.1| 30S ribosomal protein S10 [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|257471576|ref|ZP_05635575.1| 30S ribosomal protein S10 [Buchnera aphidicola str. LSR1
           (Acyrthosiphon pisum)]
 gi|11387087|sp|P57592|RS10_BUCAI RecName: Full=30S ribosomal protein S10
 gi|254809602|sp|B8D850|RS10_BUCAT RecName: Full=30S ribosomal protein S10
 gi|254809603|sp|B8D9U8|RS10_BUCA5 RecName: Full=30S ribosomal protein S10
 gi|25294638|pir||B84991 30S ribosomal protein S10 [imported] - Buchnera sp. (strain APS)
 gi|10039184|dbj|BAB13218.1| 30S ribosomal protein S10 [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|219622159|gb|ACL30315.1| 30S ribosomal protein S10 [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|219624714|gb|ACL30869.1| 30S ribosomal protein S10 [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|311086247|gb|ADP66329.1| 30S ribosomal protein S10 [Buchnera aphidicola str. LL01
           (Acyrthosiphon pisum)]
 gi|311086824|gb|ADP66905.1| 30S ribosomal protein S10 [Buchnera aphidicola str. TLW03
           (Acyrthosiphon pisum)]
 gi|311087411|gb|ADP67491.1| 30S ribosomal protein S10 [Buchnera aphidicola str. JF99
           (Acyrthosiphon pisum)]
 gi|311087906|gb|ADP67985.1| 30S ribosomal protein S10 [Buchnera aphidicola str. JF98
           (Acyrthosiphon pisum)]
          Length = 103

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 77/101 (76%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LKAFD R++D S  EIV T K++G+Q+ GPIP P    RFT+  SPHV+K +
Sbjct: 2   QNQRIRIRLKAFDHRLIDQSTTEIVETAKRTGAQVRGPIPLPTRKERFTILVSPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 62  RDQYEIRTHKRLIDIVEPTEKTVDALMRLDLAAGVDVQISL 102


>gi|291619177|ref|YP_003521919.1| RpsJ [Pantoea ananatis LMG 20103]
 gi|317049841|ref|YP_004117489.1| 30S ribosomal protein S10 [Pantoea sp. At-9b]
 gi|291154207|gb|ADD78791.1| RpsJ [Pantoea ananatis LMG 20103]
 gi|316951458|gb|ADU70933.1| ribosomal protein S10 [Pantoea sp. At-9b]
 gi|327395507|dbj|BAK12929.1| 30S ribosomal protein S10 RpsJ [Pantoea ananatis AJ13355]
          Length = 103

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 76/100 (76%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N RI I LKAFD R++D S  EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +R
Sbjct: 3   NQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDAR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           DQ E+R +KRL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 63  DQYEIRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISL 102


>gi|220935493|ref|YP_002514392.1| ribosomal protein S10 [Thioalkalivibrio sp. HL-EbGR7]
 gi|254765356|sp|B8GV59|RS10_THISH RecName: Full=30S ribosomal protein S10
 gi|219996803|gb|ACL73405.1| ribosomal protein S10 [Thioalkalivibrio sp. HL-EbGR7]
          Length = 103

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 76/98 (77%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I LKAFD R++D S  EIV T K++G+++ GPIP P  + RFTV  SPHV+K +RDQ
Sbjct: 5   RIRIRLKAFDHRLIDRSASEIVETAKRTGARVKGPIPLPTKMERFTVLISPHVNKDARDQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRL+ I+ PT +TVDALMKLD+AAGV+V IKL
Sbjct: 65  YEIRTHKRLMDIMDPTDKTVDALMKLDLAAGVDVQIKL 102


>gi|83648853|ref|YP_437288.1| 30S ribosomal protein S10 [Hahella chejuensis KCTC 2396]
 gi|115305623|sp|Q2S911|RS10_HAHCH RecName: Full=30S ribosomal protein S10
 gi|83636896|gb|ABC32863.1| ribosomal protein S10 [Hahella chejuensis KCTC 2396]
          Length = 103

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 76/98 (77%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD R++D S +EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +RDQ
Sbjct: 5   KIRIRLKAFDYRLIDQSTQEIVDTAKRTGAQVRGPIPLPTKKERFTVLISPHVNKDARDQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRLL I++PT +TVDALMKLD+AAGV+V I L
Sbjct: 65  YEIRTHKRLLDIVEPTEKTVDALMKLDLAAGVDVQISL 102


>gi|89076771|ref|ZP_01163044.1| 30S ribosomal protein S10 [Photobacterium sp. SKA34]
 gi|89047584|gb|EAR53198.1| 30S ribosomal protein S10 [Photobacterium sp. SKA34]
          Length = 101

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 76/100 (76%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N RI I LKAFD R++D S  EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +R
Sbjct: 1   NQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVKGPIPLPTRKERFTVLISPHVNKDAR 60

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           DQ E+R +KRL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 61  DQYEIRTHKRLIDIVEPTDKTVDALMRLDLAAGVDVQISL 100


>gi|239948320|ref|ZP_04700073.1| ribosomal protein S10 [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|241563416|ref|XP_002401695.1| 30S ribosomal protein S10, putative [Ixodes scapularis]
 gi|215501887|gb|EEC11381.1| 30S ribosomal protein S10, putative [Ixodes scapularis]
 gi|239922596|gb|EER22620.1| ribosomal protein S10 [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 105

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 73/98 (74%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK+FD R LD + +EIV   K++ + I GPIP PR I RFTVNRSPHV KKSR+Q
Sbjct: 4   KIKIRLKSFDHRSLDQATKEIVSAVKRTFANINGPIPLPRQIERFTVNRSPHVHKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRLL I  P P  VDAL K+D+AAGV+VVI+L
Sbjct: 64  FEIRKHKRLLVIDDPNPAVVDALSKVDLAAGVDVVIEL 101


>gi|237806874|ref|YP_002891314.1| 30S ribosomal protein S10 [Tolumonas auensis DSM 9187]
 gi|320540610|ref|ZP_08040260.1| 30S ribosomal subunit protein S10 [Serratia symbiotica str. Tucson]
 gi|330827882|ref|YP_004390834.1| ribosomal protein S10 [Aeromonas veronii B565]
 gi|259494612|sp|C4L7S9|RS10_TOLAT RecName: Full=30S ribosomal protein S10
 gi|237499135|gb|ACQ91728.1| ribosomal protein S10 [Tolumonas auensis DSM 9187]
 gi|320029541|gb|EFW11570.1| 30S ribosomal subunit protein S10 [Serratia symbiotica str. Tucson]
 gi|328803018|gb|AEB48217.1| Ribosomal protein S10 [Aeromonas veronii B565]
          Length = 103

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 77/101 (76%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LKAFD R++D S  EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +
Sbjct: 2   QNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 62  RDQYEIRTHKRLVDIVEPTDKTVDALMRLDLAAGVDVQISL 102


>gi|325577126|ref|ZP_08147610.1| 30S ribosomal protein S10 [Haemophilus parainfluenzae ATCC 33392]
 gi|325160708|gb|EGC72829.1| 30S ribosomal protein S10 [Haemophilus parainfluenzae ATCC 33392]
          Length = 120

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 77/101 (76%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LKAFD R++D S  EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +
Sbjct: 19  QNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDA 78

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 79  RDQYEIRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISL 119


>gi|167626040|ref|YP_001676334.1| 30S ribosomal protein S10 [Shewanella halifaxensis HAW-EB4]
 gi|189040392|sp|B0TM13|RS10_SHEHH RecName: Full=30S ribosomal protein S10
 gi|167356062|gb|ABZ78675.1| ribosomal protein S10 [Shewanella halifaxensis HAW-EB4]
          Length = 103

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 76/101 (75%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LK FD R++D S  EIV T K++G+Q+ GPIP P    RFT+  SPHV+K +
Sbjct: 2   QNQRIRIRLKGFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTILTSPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 62  RDQYELRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISL 102


>gi|84394649|ref|ZP_00993341.1| 30S ribosomal protein S10 [Vibrio splendidus 12B01]
 gi|86148882|ref|ZP_01067134.1| 30S ribosomal protein S10 [Vibrio sp. MED222]
 gi|84374731|gb|EAP91686.1| 30S ribosomal protein S10 [Vibrio splendidus 12B01]
 gi|85833334|gb|EAQ51540.1| 30S ribosomal protein S10 [Vibrio sp. MED222]
          Length = 103

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 78/101 (77%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LKAFD +++D+S  EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +
Sbjct: 2   QNQRIRIRLKAFDYKLIDASTAEIVETAKRTGAQVRGPIPLPTRKERFTVLTSPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 62  RDQYEIRTHKRLIDIVEPTDKTVDALMRLDLAAGVDVQISL 102


>gi|260579867|ref|ZP_05847697.1| ribosomal protein S10 [Haemophilus influenzae RdAW]
 gi|260581594|ref|ZP_05849391.1| ribosomal protein S10 [Haemophilus influenzae NT127]
 gi|329122782|ref|ZP_08251354.1| 30S ribosomal protein S10 [Haemophilus aegyptius ATCC 11116]
 gi|1573786|gb|AAC22435.1| ribosomal protein S10 (rpS10) [Haemophilus influenzae Rd KW20]
 gi|260093151|gb|EEW77084.1| ribosomal protein S10 [Haemophilus influenzae RdAW]
 gi|260095187|gb|EEW79078.1| ribosomal protein S10 [Haemophilus influenzae NT127]
 gi|327472046|gb|EGF17484.1| 30S ribosomal protein S10 [Haemophilus aegyptius ATCC 11116]
          Length = 118

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 77/101 (76%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LKAFD R++D S  EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +
Sbjct: 17  QNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDA 76

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 77  RDQYEIRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISL 117


>gi|222056706|ref|YP_002539068.1| ribosomal protein S10 [Geobacter sp. FRC-32]
 gi|254809585|sp|B9M6U6|RS10_GEOSF RecName: Full=30S ribosomal protein S10
 gi|221565995|gb|ACM21967.1| ribosomal protein S10 [Geobacter sp. FRC-32]
          Length = 102

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/104 (56%), Positives = 81/104 (77%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+ IRI   LKA+D ++LD S+ EIV T K++G+++ GPIP P  + ++ V R PHVD
Sbjct: 1   MPSQKIRIR--LKAYDHKLLDVSVGEIVDTAKRTGARVAGPIPLPTVVNKYCVLRGPHVD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q E+R +KRL+ I++PT QTVDALMKLD++AGV+V IKL
Sbjct: 59  KKSREQFEIRTHKRLIDILEPTQQTVDALMKLDLSAGVDVEIKL 102


>gi|21672771|ref|NP_660838.1| 30S ribosomal protein S10 [Buchnera aphidicola str. Sg (Schizaphis
           graminum)]
 gi|25009152|sp|Q8K949|RS10_BUCAP RecName: Full=30S ribosomal protein S10
 gi|21623418|gb|AAM68049.1| 30S ribosomal protein S10 [Buchnera aphidicola str. Sg (Schizaphis
           graminum)]
          Length = 103

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 77/101 (76%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LKAFD R++D S  EIV T K++G+Q+ GPIP P    RFT+  SPHV+K +
Sbjct: 2   QNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTILISPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 62  RDQYEIRTHKRLIDIVEPTEKTVDALMRLDLAAGVDVQISL 102


>gi|50122952|ref|YP_052119.1| 30S ribosomal protein S10 [Pectobacterium atrosepticum SCRI1043]
 gi|85060257|ref|YP_455959.1| 30S ribosomal protein S10 [Sodalis glossinidius str. 'morsitans']
 gi|146313386|ref|YP_001178460.1| SSU ribosomal protein S10P [Enterobacter sp. 638]
 gi|322831071|ref|YP_004211098.1| ribosomal protein S10 [Rahnella sp. Y9602]
 gi|81643767|sp|Q6CZW9|RS10_ERWCT RecName: Full=30S ribosomal protein S10
 gi|118597322|sp|Q2NQM1|RS10_SODGM RecName: Full=30S ribosomal protein S10
 gi|166991568|sp|A4WFC9|RS10_ENT38 RecName: Full=30S ribosomal protein S10
 gi|49613478|emb|CAG76929.1| 30S ribosomal subunit protein S10 [Pectobacterium atrosepticum
           SCRI1043]
 gi|84780777|dbj|BAE75554.1| 30S ribosomal protein S10 [Sodalis glossinidius str. 'morsitans']
 gi|145320262|gb|ABP62409.1| SSU ribosomal protein S10P [Enterobacter sp. 638]
 gi|321166272|gb|ADW71971.1| ribosomal protein S10 [Rahnella sp. Y9602]
          Length = 103

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 77/101 (76%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LKAFD R++D S  EIV T K++G+Q+ GPIP P    RFT+  SPHV+K +
Sbjct: 2   QNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTILISPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 62  RDQYEIRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISL 102


>gi|67458669|ref|YP_246293.1| 30S ribosomal protein S10 [Rickettsia felis URRWXCal2]
 gi|75536866|sp|Q4UMT0|RS10_RICFE RecName: Full=30S ribosomal protein S10
 gi|67004202|gb|AAY61128.1| 30S ribosomal protein S10 [Rickettsia felis URRWXCal2]
          Length = 105

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 73/98 (74%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK+FD R LD + +EIV   K++ + I GPIP PR I RFTVNRSPHV KKSR+Q
Sbjct: 4   KIKIRLKSFDHRSLDQATKEIVSAVKRTFANINGPIPLPRKIERFTVNRSPHVHKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRLL I  P P  VDAL K+D+AAGV+VVI+L
Sbjct: 64  FEIRKHKRLLVIDDPNPAVVDALSKVDLAAGVDVVIEL 101


>gi|196019518|ref|XP_002118991.1| hypothetical protein TRIADDRAFT_35047 [Trichoplax adhaerens]
 gi|190577416|gb|EDV18522.1| hypothetical protein TRIADDRAFT_35047 [Trichoplax adhaerens]
          Length = 110

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/97 (60%), Positives = 77/97 (79%), Gaps = 1/97 (1%)

Query: 8   ICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQL 67
           I + LKAF+ R+LD +++EIV T  + G++  GPIP PR I +FTVNRSPHVDKKSR+Q 
Sbjct: 7   IELKLKAFEPRVLDKAVKEIVDTISRIGARYRGPIPMPRKISKFTVNRSPHVDKKSREQF 66

Query: 68  EMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           E+R + R L II+ +PQTVDALMKLDIAAGV++ IK+
Sbjct: 67  EIRDHTRFL-IIEASPQTVDALMKLDIAAGVDIKIKM 102


>gi|52840573|ref|YP_094372.1| 30S ribosomal protein S10 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|54293320|ref|YP_125735.1| 30S ribosomal protein S10 [Legionella pneumophila str. Lens]
 gi|54296364|ref|YP_122733.1| 30S ribosomal protein S10 [Legionella pneumophila str. Paris]
 gi|148361054|ref|YP_001252261.1| 30S ribosomal protein S10 [Legionella pneumophila str. Corby]
 gi|296105877|ref|YP_003617577.1| small subunit ribosomal protein S10 [Legionella pneumophila 2300/99
           Alcoy]
 gi|81601550|sp|Q5WZL3|RS10_LEGPL RecName: Full=30S ribosomal protein S10
 gi|81602028|sp|Q5X860|RS10_LEGPA RecName: Full=30S ribosomal protein S10
 gi|81603557|sp|Q5ZYP4|RS10_LEGPH RecName: Full=30S ribosomal protein S10
 gi|166231281|sp|A5IHR5|RS10_LEGPC RecName: Full=30S ribosomal protein S10
 gi|52627684|gb|AAU26425.1| 30S ribosomal protein S10 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|53750149|emb|CAH11541.1| 30S ribosomal subunit protein S10 [Legionella pneumophila str.
           Paris]
 gi|53753152|emb|CAH14599.1| 30S ribosomal subunit protein S10 [Legionella pneumophila str.
           Lens]
 gi|148282827|gb|ABQ56915.1| 30S ribosomal protein S10 [Legionella pneumophila str. Corby]
 gi|295647778|gb|ADG23625.1| small subunit ribosomal protein S10 [Legionella pneumophila 2300/99
           Alcoy]
 gi|307609137|emb|CBW98584.1| 30S ribosomal subunit protein S10 [Legionella pneumophila 130b]
          Length = 105

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 60/102 (58%), Positives = 76/102 (74%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           S N  I I LK+FD R++D S REIV T K++G+QI GPIP P    +FTV  SPHV+K 
Sbjct: 2   SSNQNIKIRLKSFDHRLIDLSTREIVDTAKRTGAQIRGPIPLPIRKEKFTVLTSPHVNKD 61

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +RDQ E+R +KRL+ I+ PT +TVDALMKLD+AAGV+V I L
Sbjct: 62  ARDQYELRTHKRLVVIVHPTEKTVDALMKLDLAAGVDVQISL 103


>gi|320108397|ref|YP_004183987.1| 30S ribosomal protein S10 [Terriglobus saanensis SP1PR4]
 gi|319926918|gb|ADV83993.1| ribosomal protein S10 [Terriglobus saanensis SP1PR4]
          Length = 106

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 58/97 (59%), Positives = 75/97 (77%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I LKA+D R+LD+S  EIV T K++G+Q+ GPIP P    ++ V RSPHVDKKSR+ 
Sbjct: 6   RIRIRLKAYDYRVLDTSTGEIVETAKRTGAQVAGPIPLPTMKNKYCVLRSPHVDKKSREA 65

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E+R +KRL+ I++PT QTVDALMKLD+ AGV+V IK
Sbjct: 66  FEIRTHKRLIDILEPTQQTVDALMKLDLPAGVDVEIK 102


>gi|87122970|ref|ZP_01078831.1| ribosomal protein S10 [Marinomonas sp. MED121]
 gi|86161738|gb|EAQ63042.1| ribosomal protein S10 [Marinomonas sp. MED121]
          Length = 103

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 60/104 (57%), Positives = 79/104 (75%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+ IRI   LKAFD R++D+S +EIV T K++G+Q+ GPIP P    R+TV  SPHV+
Sbjct: 1   MQSQKIRIR--LKAFDHRLIDASTQEIVETAKRTGAQVRGPIPLPTRKERYTVLISPHVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K +RDQ E+R +KR+L I++PT +TVDALMKLD+AAGV V I L
Sbjct: 59  KDARDQYEIRTHKRVLDIVEPTEKTVDALMKLDLAAGVEVQISL 102


>gi|119773353|ref|YP_926093.1| 30S ribosomal protein S10 [Shewanella amazonensis SB2B]
 gi|166231777|sp|A1S217|RS10_SHEAM RecName: Full=30S ribosomal protein S10
 gi|119765853|gb|ABL98423.1| SSU ribosomal protein S10P [Shewanella amazonensis SB2B]
          Length = 103

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 76/101 (75%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LK FD R++D S  EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +
Sbjct: 2   QNQRIRIRLKGFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 62  RDQYELRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISL 102


>gi|77165788|ref|YP_344313.1| 30S ribosomal protein S10 [Nitrosococcus oceani ATCC 19707]
 gi|254433713|ref|ZP_05047221.1| ribosomal protein S10 [Nitrosococcus oceani AFC27]
 gi|115305637|sp|Q3J8R3|RS10_NITOC RecName: Full=30S ribosomal protein S10
 gi|76884102|gb|ABA58783.1| SSU ribosomal protein S10P [Nitrosococcus oceani ATCC 19707]
 gi|207090046|gb|EDZ67317.1| ribosomal protein S10 [Nitrosococcus oceani AFC27]
          Length = 104

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 58/97 (59%), Positives = 74/97 (76%)

Query: 8   ICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQL 67
           I I LKAFD R++D S REIV T K++G+ + GPIP P    RFT+  SPHV+K +RDQ 
Sbjct: 7   IRIRLKAFDHRLIDQSAREIVDTAKRTGAHVRGPIPLPTRKERFTILISPHVNKDARDQY 66

Query: 68  EMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           E+R +KRL+ I+ PT +TVDALMKLD+AAGV+V IKL
Sbjct: 67  EIRTHKRLMDIVDPTEKTVDALMKLDLAAGVDVQIKL 103


>gi|329298534|ref|ZP_08255870.1| 30S ribosomal protein S10 [Plautia stali symbiont]
          Length = 103

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 76/100 (76%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N RI I LKAFD R++D S  EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +R
Sbjct: 3   NQRIRIRLKAFDHRLIDRSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDAR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           DQ E+R +KRL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 63  DQYEIRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISL 102


>gi|89255669|ref|YP_513030.1| 30S ribosomal protein S10 [Francisella tularensis subsp. holarctica
           LVS]
 gi|115314170|ref|YP_762893.1| 30S ribosomal protein S10 [Francisella tularensis subsp. holarctica
           OSU18]
 gi|156501619|ref|YP_001427684.1| 30S ribosomal protein S10 [Francisella tularensis subsp. holarctica
           FTNF002-00]
 gi|167009890|ref|ZP_02274821.1| ribosomal protein S10 [Francisella tularensis subsp. holarctica
           FSC200]
 gi|167626807|ref|YP_001677307.1| 30S ribosomal protein S10 [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|241667388|ref|ZP_04754966.1| 30S ribosomal protein S10 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254875937|ref|ZP_05248647.1| 30S ribosomal protein S10 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|290953212|ref|ZP_06557833.1| 30S ribosomal protein S10 [Francisella tularensis subsp. holarctica
           URFT1]
 gi|295313580|ref|ZP_06804169.1| 30S ribosomal protein S10 [Francisella tularensis subsp. holarctica
           URFT1]
 gi|118597178|sp|Q2A5H1|RS10_FRATH RecName: Full=30S ribosomal protein S10
 gi|122325788|sp|Q0BNS8|RS10_FRATO RecName: Full=30S ribosomal protein S10
 gi|166231271|sp|A7N9S5|RS10_FRATF RecName: Full=30S ribosomal protein S10
 gi|189040373|sp|B0U0Z0|RS10_FRAP2 RecName: Full=30S ribosomal protein S10
 gi|89143500|emb|CAJ78676.1| 30S ribosomal protein S10 [Francisella tularensis subsp. holarctica
           LVS]
 gi|115129069|gb|ABI82256.1| ribosomal protein S10 [Francisella tularensis subsp. holarctica
           OSU18]
 gi|156252222|gb|ABU60728.1| ribosomal protein S10 [Francisella tularensis subsp. holarctica
           FTNF002-00]
 gi|167596808|gb|ABZ86806.1| ribosomal protein S10 [Francisella philomiragia subsp. philomiragia
           ATCC 25017]
 gi|254841958|gb|EET20372.1| 30S ribosomal protein S10 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 105

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/104 (56%), Positives = 79/104 (75%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M   N RI I LKAFD +++D S +EIV T KK+G+Q+ GPIP P    +FT+  SPHV+
Sbjct: 1   MAINNQRIRIRLKAFDHKLIDISTQEIVDTAKKTGAQVKGPIPLPVRKEKFTILISPHVN 60

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KK+RDQ E+R +KRL+ I++PT +TVDALMKLD+A+GV+V I L
Sbjct: 61  KKARDQYEIRTHKRLIDIVEPTDKTVDALMKLDLASGVDVQISL 104


>gi|300114737|ref|YP_003761312.1| 30S ribosomal protein S10 [Nitrosococcus watsonii C-113]
 gi|299540674|gb|ADJ28991.1| ribosomal protein S10 [Nitrosococcus watsonii C-113]
          Length = 104

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 58/97 (59%), Positives = 74/97 (76%)

Query: 8   ICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQL 67
           I I LKAFD R++D S REIV T K++G+ + GPIP P    RFT+  SPHV+K +RDQ 
Sbjct: 7   IRIRLKAFDHRLIDQSAREIVGTAKRTGAHVRGPIPLPTRKERFTILISPHVNKDARDQY 66

Query: 68  EMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           E+R +KRL+ I+ PT +TVDALMKLD+AAGV+V IKL
Sbjct: 67  EIRTHKRLMDIVDPTEKTVDALMKLDLAAGVDVQIKL 103


>gi|59710841|ref|YP_203617.1| 30S ribosomal protein S10 [Vibrio fischeri ES114]
 gi|197334021|ref|YP_002154995.1| ribosomal protein S10 [Vibrio fischeri MJ11]
 gi|209693923|ref|YP_002261851.1| 30S ribosomal protein S10 [Aliivibrio salmonicida LFI1238]
 gi|75431861|sp|Q5E8B7|RS10_VIBF1 RecName: Full=30S ribosomal protein S10
 gi|226705392|sp|B6EPS4|RS10_ALISL RecName: Full=30S ribosomal protein S10
 gi|226705644|sp|B5FG08|RS10_VIBFM RecName: Full=30S ribosomal protein S10
 gi|59478942|gb|AAW84729.1| 30S ribosomal subunit protein S10 [Vibrio fischeri ES114]
 gi|197315511|gb|ACH64958.1| ribosomal protein S10 [Vibrio fischeri MJ11]
 gi|208007874|emb|CAQ78004.1| 30S ribosomal subunit protein S10 [Aliivibrio salmonicida LFI1238]
          Length = 103

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 77/101 (76%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LKAFD +++D S  EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +
Sbjct: 2   QNQRIRIRLKAFDYKLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLTSPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 62  RDQYEIRTHKRLIDIVEPTDKTVDALMRLDLAAGVDVQISL 102


>gi|319760328|ref|YP_004124266.1| 30S ribosomal protein S10 [Candidatus Blochmannia vafer str. BVAF]
 gi|318039042|gb|ADV33592.1| 30S ribosomal protein S10 [Candidatus Blochmannia vafer str. BVAF]
          Length = 103

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 76/101 (75%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LKAFD R++D S  EIV T K++G+Q+ GP+P P    RFT+  SPHV+K +
Sbjct: 2   QNQRIRIRLKAFDHRLIDKSTLEIVETAKRTGAQVHGPVPLPTRKERFTILVSPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRL+ I+ PT +TVDALMKLD+AAGV+V I L
Sbjct: 62  RDQYEIRTHKRLIDIVDPTDKTVDALMKLDLAAGVDVQISL 102


>gi|253995717|ref|YP_003047781.1| 30S ribosomal protein S10 [Methylotenera mobilis JLW8]
 gi|253982396|gb|ACT47254.1| ribosomal protein S10 [Methylotenera mobilis JLW8]
          Length = 102

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/104 (56%), Positives = 79/104 (75%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           MT++ IRI   LKAFD R++D S +EIV T K++G+ + GP+P P  I RF + RSPHV+
Sbjct: 1   MTNQKIRIR--LKAFDYRLIDQSAQEIVETAKRTGAVVKGPVPLPTRIERFDILRSPHVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SRDQ E+R ++RL+ I+ PT +TVDALMKLD+ AGV+V IKL
Sbjct: 59  KTSRDQFEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKL 102


>gi|218779763|ref|YP_002431081.1| ribosomal protein S10 [Desulfatibacillum alkenivorans AK-01]
 gi|259494586|sp|B8FET6|RS10_DESAA RecName: Full=30S ribosomal protein S10
 gi|218761147|gb|ACL03613.1| ribosomal protein S10 [Desulfatibacillum alkenivorans AK-01]
          Length = 103

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 79/100 (79%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA+D ++LD S  +IV T +++G+++VGPIP P  I ++ V RSPHVDKKSR
Sbjct: 4   NDKIRIRLKAYDHKLLDQSAADIVDTARRTGAKVVGPIPLPTRINKYCVLRSPHVDKKSR 63

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q E+R +KRLL I++PT QTVDALMKLD++ GV+V IK+
Sbjct: 64  EQFEVRTHKRLLDILEPTQQTVDALMKLDLSPGVDVEIKV 103


>gi|51473840|ref|YP_067597.1| 30S ribosomal protein S10 [Rickettsia typhi str. Wilmington]
 gi|81610770|sp|Q68W77|RS10_RICTY RecName: Full=30S ribosomal protein S10
 gi|51460152|gb|AAU04115.1| 30S ribosomal protein S10 [Rickettsia typhi str. Wilmington]
          Length = 105

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 73/98 (74%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK+FD R LD + +EIV   K++ + I GPIP PR I RFTVNRSPHV KKSR+Q
Sbjct: 4   KIKIRLKSFDHRSLDQATKEIVSAVKRTFATINGPIPLPRKIERFTVNRSPHVHKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRLL I  P P  VDAL K+D+AAGV+VVI+L
Sbjct: 64  FEIRKHKRLLVIDDPNPAVVDALSKVDLAAGVDVVIEL 101


>gi|322436547|ref|YP_004218759.1| ribosomal protein S10 [Acidobacterium sp. MP5ACTX9]
 gi|321164274|gb|ADW69979.1| ribosomal protein S10 [Acidobacterium sp. MP5ACTX9]
          Length = 105

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 58/97 (59%), Positives = 75/97 (77%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I LKA+D R+LD+S  EIV T K++G+Q+ GPIP P    ++ V RSPHVDKKSR+ 
Sbjct: 5   RIRIRLKAYDYRVLDTSTGEIVETAKRTGAQVAGPIPLPTMKNKYCVLRSPHVDKKSREA 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E+R +KRL+ I++PT QTVDALMKLD+ AGV+V IK
Sbjct: 65  FEIRTHKRLIDILEPTQQTVDALMKLDLPAGVDVEIK 101


>gi|126666814|ref|ZP_01737791.1| ribosomal protein S10 [Marinobacter sp. ELB17]
 gi|126628859|gb|EAZ99479.1| ribosomal protein S10 [Marinobacter sp. ELB17]
          Length = 103

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 60/104 (57%), Positives = 79/104 (75%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+ IRI   LKAFD R++D S +EIV T K++G+Q+ GPIP P    +FT+  SPHV+
Sbjct: 1   MQSQKIRIR--LKAFDYRLIDQSTQEIVDTAKRTGAQVRGPIPLPTRKEKFTILVSPHVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K +RDQ E+R +KRLL I++PT +TVDALMKLD+AAGV+V I L
Sbjct: 59  KDARDQYEIRTHKRLLDIVEPTEKTVDALMKLDLAAGVDVQISL 102


>gi|94500994|ref|ZP_01307519.1| ribosomal protein S10 [Oceanobacter sp. RED65]
 gi|94426934|gb|EAT11917.1| ribosomal protein S10 [Oceanobacter sp. RED65]
          Length = 103

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 76/101 (75%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N +I I LKAFD R++D S +EIV T K++G+Q+ GPIP P    R TV  SPHV+K +
Sbjct: 2   QNQKIRIRLKAFDHRLIDQSTQEIVETAKRTGAQVRGPIPLPTRKERLTVLISPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KR+L I++PT +TVDALMKLD+AAGV V I L
Sbjct: 62  RDQYEIRTHKRMLDIVEPTEKTVDALMKLDLAAGVEVQISL 102


>gi|17547739|ref|NP_521141.1| 30S ribosomal protein S10 [Ralstonia solanacearum GMI1000]
 gi|83748148|ref|ZP_00945175.1| SSU ribosomal protein S10P [Ralstonia solanacearum UW551]
 gi|300690159|ref|YP_003751154.1| 30S ribosomal subunit protein S10 [Ralstonia solanacearum PSI07]
 gi|300702779|ref|YP_003744380.1| 30S ribosomal protein S10 [Ralstonia solanacearum CFBP2957]
 gi|20140044|sp|Q8XV11|RS10_RALSO RecName: Full=30S ribosomal protein S10
 gi|17430044|emb|CAD16729.1| probable 30s ribosomal protein s10 [Ralstonia solanacearum GMI1000]
 gi|83725116|gb|EAP72267.1| SSU ribosomal protein S10P [Ralstonia solanacearum UW551]
 gi|299065414|emb|CBJ36583.1| 30S ribosomal subunit protein S10 [Ralstonia solanacearum CMR15]
 gi|299070441|emb|CBJ41736.1| 30S ribosomal subunit protein S10 [Ralstonia solanacearum CFBP2957]
 gi|299077219|emb|CBJ49845.1| 30S ribosomal subunit protein S10 [Ralstonia solanacearum PSI07]
          Length = 104

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 58/102 (56%), Positives = 77/102 (75%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
            +N +I I LKAFD R++D S  EIV T K++G+ + GP+P P  I+RF V RSPHV+K 
Sbjct: 2   QQNQKIRIRLKAFDYRLIDQSAAEIVETAKRTGAIVKGPVPLPTRIQRFDVLRSPHVNKT 61

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           SRDQ E+R ++RL+ I+ PT +TVDALMKLD+ AGV+V IKL
Sbjct: 62  SRDQFEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKL 103


>gi|146308924|ref|YP_001189389.1| 30S ribosomal protein S10 [Pseudomonas mendocina ymp]
 gi|226942777|ref|YP_002797850.1| 30S ribosomal protein S10 [Azotobacter vinelandii DJ]
 gi|330505208|ref|YP_004382077.1| ribosomal protein S10 [Pseudomonas mendocina NK-01]
 gi|166231314|sp|A4XZ91|RS10_PSEMY RecName: Full=30S ribosomal protein S10
 gi|259494582|sp|C1DKL2|RS10_AZOVD RecName: Full=30S ribosomal protein S10
 gi|145577125|gb|ABP86657.1| SSU ribosomal protein S10P [Pseudomonas mendocina ymp]
 gi|226717704|gb|ACO76875.1| 30S ribosomal protein S10 [Azotobacter vinelandii DJ]
 gi|310941665|dbj|BAJ24186.1| 30S ribosomal protein S10 [Pseudomonas alcaligenes]
 gi|310941815|dbj|BAJ24261.1| 30S ribosomal protein S10 [Pseudomonas mendocina]
 gi|328919494|gb|AEB60325.1| ribosomal protein S10 [Pseudomonas mendocina NK-01]
          Length = 103

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 77/101 (76%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N +I I LKAFD R++D S +EIV T K++G+Q+ GPIP P    R+TV  SPHV+K +
Sbjct: 2   QNQQIRIRLKAFDHRLIDQSTQEIVETAKRTGAQVRGPIPLPTRKERYTVLISPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KR+L I++PT +TVDALMKLD+AAGV V I L
Sbjct: 62  RDQYEIRTHKRVLDIVQPTDKTVDALMKLDLAAGVEVQISL 102


>gi|15604506|ref|NP_221024.1| 30S ribosomal protein S10 [Rickettsia prowazekii str. Madrid E]
 gi|1350918|sp|P48850|RS10_RICPR RecName: Full=30S ribosomal protein S10
 gi|987971|emb|CAA90882.1| ribosomal protein S10 [Rickettsia prowazekii]
 gi|3861200|emb|CAA15100.1| 30S RIBOSOMAL PROTEIN S10 (rpsJ) [Rickettsia prowazekii]
 gi|292572288|gb|ADE30203.1| 30S ribosomal protein S10 [Rickettsia prowazekii Rp22]
          Length = 105

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 73/98 (74%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK+FD R LD + +EIV   K++ + I GPIP PR I RFTVNRSPHV KKSR+Q
Sbjct: 4   KIKIRLKSFDHRSLDQATKEIVSAVKRTFATINGPIPLPRKIERFTVNRSPHVHKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRLL I  P P  VDAL K+D+AAGV+VVI+L
Sbjct: 64  FEIRKHKRLLVIDDPNPAVVDALSKVDLAAGVDVVIEL 101


>gi|198282636|ref|YP_002218957.1| 30S ribosomal protein S10 [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218666591|ref|YP_002424829.1| ribosomal protein S10 [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|226705388|sp|B7J466|RS10_ACIF2 RecName: Full=30S ribosomal protein S10
 gi|226705389|sp|B5ELX8|RS10_ACIF5 RecName: Full=30S ribosomal protein S10
 gi|198247157|gb|ACH82750.1| ribosomal protein S10 [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218518804|gb|ACK79390.1| ribosomal protein S10 [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 102

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 61/104 (58%), Positives = 77/104 (74%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S  IRI   LK++D R+LD S  EIV T +++G+++ GPIP P  I RFTV RSPHVD
Sbjct: 1   MDSSKIRIR--LKSYDYRMLDISAAEIVETARRTGARVCGPIPLPTKIERFTVLRSPHVD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K +RDQ E R +KRLL I+ P  +TVDAL+KLD+AAGV+V IKL
Sbjct: 59  KNARDQFEQRTHKRLLDILDPNDKTVDALIKLDLAAGVDVEIKL 102


>gi|152998272|ref|YP_001343107.1| 30S ribosomal protein S10 [Marinomonas sp. MWYL1]
 gi|326793557|ref|YP_004311377.1| ribosomal protein S10 [Marinomonas mediterranea MMB-1]
 gi|189040377|sp|A6W393|RS10_MARMS RecName: Full=30S ribosomal protein S10
 gi|150839196|gb|ABR73172.1| ribosomal protein S10 [Marinomonas sp. MWYL1]
 gi|326544321|gb|ADZ89541.1| ribosomal protein S10 [Marinomonas mediterranea MMB-1]
          Length = 103

 Score =  118 bits (296), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 60/104 (57%), Positives = 79/104 (75%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+ IRI   LKAFD R++D+S +EIV T K++G+Q+ GPIP P    R+TV  SPHV+
Sbjct: 1   MQSQKIRIR--LKAFDHRLIDASTQEIVDTAKRTGAQVRGPIPLPTRKERYTVLISPHVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K +RDQ E+R +KR+L I++PT +TVDALMKLD+AAGV V I L
Sbjct: 59  KDARDQYEIRTHKRVLDIVEPTEKTVDALMKLDLAAGVEVQISL 102


>gi|323703549|ref|ZP_08115195.1| ribosomal protein S10 [Desulfotomaculum nigrificans DSM 574]
 gi|323531540|gb|EGB21433.1| ribosomal protein S10 [Desulfotomaculum nigrificans DSM 574]
          Length = 102

 Score =  118 bits (296), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 57/104 (54%), Positives = 80/104 (76%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+ IRI   LKAFD ++LD S  +IV T K++G+Q+ GP+P P     +T+ RSPHV+
Sbjct: 1   MKSQKIRIR--LKAFDHQMLDQSATKIVDTAKRTGAQVAGPVPLPTEKSIYTILRSPHVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+Q EMR++KRL+ I++PTP+TVDALM+LD+ AGV++ IKL
Sbjct: 59  KDSREQFEMRVHKRLIDILEPTPKTVDALMRLDLPAGVDIEIKL 102


>gi|190572943|ref|YP_001970788.1| 30S ribosomal protein S10 [Stenotrophomonas maltophilia K279a]
 gi|194364533|ref|YP_002027143.1| 30S ribosomal protein S10 [Stenotrophomonas maltophilia R551-3]
 gi|254523904|ref|ZP_05135959.1| ribosomal protein S10 [Stenotrophomonas sp. SKA14]
 gi|226705629|sp|B4SKW2|RS10_STRM5 RecName: Full=30S ribosomal protein S10
 gi|226705630|sp|B2FQ44|RS10_STRMK RecName: Full=30S ribosomal protein S10
 gi|190010865|emb|CAQ44474.1| putative 30S ribosomal protein S10 [Stenotrophomonas maltophilia
           K279a]
 gi|194347337|gb|ACF50460.1| ribosomal protein S10 [Stenotrophomonas maltophilia R551-3]
 gi|219721495|gb|EED40020.1| ribosomal protein S10 [Stenotrophomonas sp. SKA14]
          Length = 103

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 74/98 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD R++D S  EIV T K++G+Q+ GPIP P  I R+TV  SPHVDK +RDQ
Sbjct: 5   KIRIRLKAFDHRLIDRSASEIVETAKRTGAQVRGPIPLPTKIERYTVLVSPHVDKDARDQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R +KR+L I+ P  +TVDALMKL++AAGV+V IKL
Sbjct: 65  YETRTHKRVLDIVDPNDKTVDALMKLELAAGVDVQIKL 102


>gi|187930365|ref|YP_001900852.1| 30S ribosomal protein S10 [Ralstonia pickettii 12J]
 gi|241664533|ref|YP_002982893.1| 30S ribosomal protein S10 [Ralstonia pickettii 12D]
 gi|309782833|ref|ZP_07677553.1| ribosomal protein S10 [Ralstonia sp. 5_7_47FAA]
 gi|226705612|sp|B2UEM0|RS10_RALPJ RecName: Full=30S ribosomal protein S10
 gi|187727255|gb|ACD28420.1| ribosomal protein S10 [Ralstonia pickettii 12J]
 gi|240866560|gb|ACS64221.1| ribosomal protein S10 [Ralstonia pickettii 12D]
 gi|308918257|gb|EFP63934.1| ribosomal protein S10 [Ralstonia sp. 5_7_47FAA]
          Length = 103

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 77/101 (76%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N +I I LKAFD R++D S  EIV T K++G+ + GP+P P  I+RF V RSPHV+K S
Sbjct: 2   QNQKIRIRLKAFDYRLIDQSAAEIVETAKRTGAIVKGPVPLPTRIQRFDVLRSPHVNKTS 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R ++RL+ I+ PT +TVDALMKLD+ AGV+V IKL
Sbjct: 62  RDQFEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKL 102


>gi|329901061|ref|ZP_08272687.1| SSU ribosomal protein S10p (S20e) [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327549261|gb|EGF33839.1| SSU ribosomal protein S10p (S20e) [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 105

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 60/104 (57%), Positives = 77/104 (74%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M+S N  I I LKAFD R++D S  EIV T K++G+ + GP+P P  I+RF V RSPHV+
Sbjct: 1   MSSPNQEIRIRLKAFDYRLIDQSALEIVETAKRTGAVVKGPVPLPTRIQRFDVLRSPHVN 60

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SRDQ E+R + RL+ I+ PT +TVDALMKLD+ AGV+V IKL
Sbjct: 61  KTSRDQFEIRTHVRLIDIVNPTDKTVDALMKLDLPAGVDVEIKL 104


>gi|71891974|ref|YP_277704.1| 30S ribosomal subunit protein S10 [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
 gi|115305608|sp|Q493K9|RS10_BLOPB RecName: Full=30S ribosomal protein S10
 gi|71796080|gb|AAZ40831.1| 30S ribosomal subunit protein S10 [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
          Length = 103

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 77/101 (76%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LKAFD R++D S  EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +
Sbjct: 2   QNQRIRIRLKAFDHRLIDKSTVEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 62  RDQYEIRTHKRLIDIVEPTDKTVDALMRLDLAAGVDVQISL 102


>gi|257454046|ref|ZP_05619320.1| ribosomal protein S10 [Enhydrobacter aerosaccus SK60]
 gi|257448524|gb|EEV23493.1| ribosomal protein S10 [Enhydrobacter aerosaccus SK60]
          Length = 103

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 77/100 (77%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LK+FD R++D S +EIV T K++G+Q+ GP+P P  I RF +  SPHV+K +R
Sbjct: 3   NQKIRIRLKSFDHRLIDQSAQEIVDTAKRTGAQVRGPVPLPTRIERFNILTSPHVNKDAR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           DQ E+R +KR++ I++PT +TVDALMKLD+AAGV+V I L
Sbjct: 63  DQYEIRTFKRMVDIVQPTDKTVDALMKLDLAAGVDVQIAL 102


>gi|74316422|ref|YP_314162.1| 30S ribosomal protein S10 [Thiobacillus denitrificans ATCC 25259]
 gi|118597337|sp|Q3SLQ0|RS10_THIDA RecName: Full=30S ribosomal protein S10
 gi|74055917|gb|AAZ96357.1| Ribosomal protein S10 [Thiobacillus denitrificans ATCC 25259]
          Length = 102

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 77/101 (76%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N +I I LKAFD +++D S  EIV T K++G+ + GP+P P SI RF V RSPHV+K S
Sbjct: 2   QNQKIRIRLKAFDYKLIDQSALEIVETAKRTGAVVKGPVPLPTSIERFDVLRSPHVNKSS 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R ++RL+ I+ PT +TVDALMKLD+ AGV+V IKL
Sbjct: 62  RDQFEIRTHRRLMDIMDPTDKTVDALMKLDLPAGVDVEIKL 102


>gi|91785466|ref|YP_560672.1| 30S ribosomal protein S10 [Burkholderia xenovorans LB400]
 gi|186477589|ref|YP_001859059.1| 30S ribosomal protein S10 [Burkholderia phymatum STM815]
 gi|187925617|ref|YP_001897259.1| 30S ribosomal protein S10 [Burkholderia phytofirmans PsJN]
 gi|209521386|ref|ZP_03270099.1| ribosomal protein S10 [Burkholderia sp. H160]
 gi|295677933|ref|YP_003606457.1| ribosomal protein S10 [Burkholderia sp. CCGE1002]
 gi|296163322|ref|ZP_06846083.1| ribosomal protein S10 [Burkholderia sp. Ch1-1]
 gi|307731256|ref|YP_003908480.1| 30S ribosomal protein S10 [Burkholderia sp. CCGE1003]
 gi|323527603|ref|YP_004229756.1| 30S ribosomal protein S10 [Burkholderia sp. CCGE1001]
 gi|118597166|sp|Q13TG9|RS10_BURXL RecName: Full=30S ribosomal protein S10
 gi|226705413|sp|B2JIG7|RS10_BURP8 RecName: Full=30S ribosomal protein S10
 gi|226705414|sp|B2T752|RS10_BURPP RecName: Full=30S ribosomal protein S10
 gi|91689420|gb|ABE32620.1| SSU ribosomal protein S10P [Burkholderia xenovorans LB400]
 gi|184194048|gb|ACC72013.1| ribosomal protein S10 [Burkholderia phymatum STM815]
 gi|187716811|gb|ACD18035.1| ribosomal protein S10 [Burkholderia phytofirmans PsJN]
 gi|209498206|gb|EDZ98348.1| ribosomal protein S10 [Burkholderia sp. H160]
 gi|295437776|gb|ADG16946.1| ribosomal protein S10 [Burkholderia sp. CCGE1002]
 gi|295886461|gb|EFG66318.1| ribosomal protein S10 [Burkholderia sp. Ch1-1]
 gi|307585791|gb|ADN59189.1| ribosomal protein S10 [Burkholderia sp. CCGE1003]
 gi|323384605|gb|ADX56696.1| ribosomal protein S10 [Burkholderia sp. CCGE1001]
          Length = 103

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 78/101 (77%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N +I I LKAFD R++D S  EIV T K++G+ + GP+P P  I+RF + RSPHV+K S
Sbjct: 2   QNQKIRIRLKAFDYRLIDQSAAEIVDTAKRTGAIVRGPVPLPTRIQRFDILRSPHVNKTS 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQLE+R ++RL+ I+ PT +TVDALMKLD+ AGV+V IKL
Sbjct: 62  RDQLEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKL 102


>gi|114778825|ref|ZP_01453632.1| Ribosomal protein S10 [Mariprofundus ferrooxydans PV-1]
 gi|114550956|gb|EAU53520.1| Ribosomal protein S10 [Mariprofundus ferrooxydans PV-1]
          Length = 102

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 61/104 (58%), Positives = 79/104 (75%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M +++IRI   LKAFD RILD S  +IV T K++G+++ GPIP P  IR+F V +SPH  
Sbjct: 1   MATQSIRIR--LKAFDHRILDKSAADIVATAKRTGAEVRGPIPIPTKIRKFCVIKSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+Q E+R +KR+L I KPTPQTVDALMKLD+ +GV+V IKL
Sbjct: 59  KDSREQFEIRTHKRVLDIDKPTPQTVDALMKLDLPSGVDVEIKL 102


>gi|91791538|ref|YP_561189.1| ribosomal protein S10 [Shewanella denitrificans OS217]
 gi|123166587|sp|Q12SW0|RS10_SHEDO RecName: Full=30S ribosomal protein S10
 gi|91713540|gb|ABE53466.1| SSU ribosomal protein S10P [Shewanella denitrificans OS217]
          Length = 103

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 76/101 (75%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LK FD R++D S  EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +
Sbjct: 2   QNQRIRIRLKGFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 62  RDQYEIRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISL 102


>gi|308047990|ref|YP_003911556.1| 30S ribosomal protein S10P [Ferrimonas balearica DSM 9799]
 gi|307630180|gb|ADN74482.1| SSU ribosomal protein S10P [Ferrimonas balearica DSM 9799]
          Length = 103

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 77/101 (76%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LKAFD R++D S  EIV T K++G+Q+ GPIP P    R+TV  SPHV+K +
Sbjct: 2   QNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERYTVLISPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 62  RDQYEIRTHKRLVDIVEPTDKTVDALMRLDLAAGVDVQISL 102


>gi|95931443|ref|ZP_01314149.1| ribosomal protein S10 [Desulfuromonas acetoxidans DSM 684]
 gi|95132511|gb|EAT14204.1| ribosomal protein S10 [Desulfuromonas acetoxidans DSM 684]
          Length = 102

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 60/104 (57%), Positives = 79/104 (75%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M+S+ IRI   LKA+D ++LD ++ EIV T K++GS + GPIP P  I ++ V R PHV+
Sbjct: 1   MSSQKIRIR--LKAYDHKLLDMAVNEIVDTVKRTGSHLAGPIPLPTVINKYCVLRGPHVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q E+R +KRLL I+ PT QTVDALMKLD++AGV V IKL
Sbjct: 59  KKSREQFEIRTHKRLLDILDPTQQTVDALMKLDLSAGVFVEIKL 102


>gi|157377450|ref|YP_001476050.1| ribosomal protein S10 [Shewanella sediminis HAW-EB3]
 gi|157960013|ref|YP_001500047.1| 30S ribosomal protein S10 [Shewanella pealeana ATCC 700345]
 gi|163752593|ref|ZP_02159772.1| 30S ribosomal protein S10 [Shewanella benthica KT99]
 gi|170729010|ref|YP_001763036.1| 30S ribosomal protein S10 [Shewanella woodyi ATCC 51908]
 gi|294142934|ref|YP_003558912.1| 30S ribosomal protein S10 [Shewanella violacea DSS12]
 gi|189040393|sp|A8GYX5|RS10_SHEPA RecName: Full=30S ribosomal protein S10
 gi|189040394|sp|A8G1E9|RS10_SHESH RecName: Full=30S ribosomal protein S10
 gi|226705625|sp|B1KMY4|RS10_SHEWM RecName: Full=30S ribosomal protein S10
 gi|157319824|gb|ABV38922.1| ribosomal protein S10 [Shewanella sediminis HAW-EB3]
 gi|157845013|gb|ABV85512.1| ribosomal protein S10 [Shewanella pealeana ATCC 700345]
 gi|161327505|gb|EDP98712.1| 30S ribosomal protein S10 [Shewanella benthica KT99]
 gi|169814357|gb|ACA88941.1| ribosomal protein S10 [Shewanella woodyi ATCC 51908]
 gi|293329403|dbj|BAJ04134.1| ribosomal protein S10 [Shewanella violacea DSS12]
          Length = 103

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 76/101 (75%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LK FD R++D S  EIV T K++G+Q+ GPIP P    R+T+  SPHV+K +
Sbjct: 2   QNQRIRIRLKGFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERYTILTSPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 62  RDQYELRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISL 102


>gi|323700805|ref|ZP_08112717.1| ribosomal protein S10 [Desulfovibrio sp. ND132]
 gi|323460737|gb|EGB16602.1| ribosomal protein S10 [Desulfovibrio desulfuricans ND132]
          Length = 106

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 74/98 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I L+A+D RILD ++ EIV T + +G+ I GP+P P  I R TV +S HVDKKSR+Q
Sbjct: 9   RIRIKLRAYDYRILDKAVTEIVDTARNTGAAIAGPVPLPTDIHRTTVQKSVHVDKKSREQ 68

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMRI+KRLL I++PT QTVDAL KL + AGV+V IKL
Sbjct: 69  FEMRIHKRLLDILEPTQQTVDALGKLSLPAGVDVEIKL 106


>gi|157964807|ref|YP_001499631.1| 30S ribosomal protein S10 [Rickettsia massiliae MTU5]
 gi|166991570|sp|A8F2E8|RS10_RICM5 RecName: Full=30S ribosomal protein S10
 gi|157844583|gb|ABV85084.1| 30S ribosomal protein S10 [Rickettsia massiliae MTU5]
          Length = 105

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 73/98 (74%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK+FD R LD + +EIV   K++ + I GPIP PR I RFTVNRSPHV KKSR+Q
Sbjct: 4   KIKIRLKSFDHRSLDQATKEIVSAVKRTFANINGPIPLPRKIGRFTVNRSPHVHKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRLL I  P P  VDAL K+D+AAGV+VVI+L
Sbjct: 64  FEIRKHKRLLVIGDPNPAVVDALSKVDLAAGVDVVIEL 101


>gi|34581368|ref|ZP_00142848.1| 30S ribosomal protein S10 [Rickettsia sibirica 246]
 gi|229587010|ref|YP_002845511.1| 30S ribosomal protein S10 [Rickettsia africae ESF-5]
 gi|259494602|sp|C3PPA8|RS10_RICAE RecName: Full=30S ribosomal protein S10
 gi|28262753|gb|EAA26257.1| 30S ribosomal protein S10 [Rickettsia sibirica 246]
 gi|228022060|gb|ACP53768.1| 30S ribosomal protein S10 [Rickettsia africae ESF-5]
          Length = 105

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 73/98 (74%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK+FD R LD + +EIV   K++ + I GPIP P+ I RFTVNRSPHV KKSR+Q
Sbjct: 4   KIKIRLKSFDHRSLDQATKEIVSAVKRTFANINGPIPLPKKIERFTVNRSPHVHKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRLL I  P P  VDAL K+D+AAGV+VVI+L
Sbjct: 64  FEIRKHKRLLVIGDPNPAVVDALSKVDLAAGVDVVIEL 101


>gi|256821661|ref|YP_003145624.1| 30S ribosomal protein S10 [Kangiella koreensis DSM 16069]
 gi|256795200|gb|ACV25856.1| ribosomal protein S10 [Kangiella koreensis DSM 16069]
          Length = 103

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 75/98 (76%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I LKAFD +++D S  EIV T K++G+Q+ GPIP P    RFT+  SPHV+K +RDQ
Sbjct: 5   RIRIRLKAFDHKLIDQSTSEIVNTAKRTGAQVKGPIPLPTRKERFTILVSPHVNKDARDQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRL+ II+PT +TVDALMKLD+AAGV+V I L
Sbjct: 65  YEIRTHKRLVDIIEPTEKTVDALMKLDLAAGVDVQISL 102


>gi|15642592|ref|NP_232225.1| 30S ribosomal protein S10 [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121728987|ref|ZP_01681990.1| ribosomal protein S10 [Vibrio cholerae V52]
 gi|147675533|ref|YP_001218091.1| 30S ribosomal protein S10 [Vibrio cholerae O395]
 gi|153214883|ref|ZP_01949681.1| ribosomal protein S10 [Vibrio cholerae 1587]
 gi|153803654|ref|ZP_01958240.1| ribosomal protein S10 [Vibrio cholerae MZO-3]
 gi|153827406|ref|ZP_01980073.1| ribosomal protein S10 [Vibrio cholerae MZO-2]
 gi|153831408|ref|ZP_01984075.1| ribosomal protein S10 [Vibrio cholerae 623-39]
 gi|227082714|ref|YP_002811265.1| ribosomal protein S10 [Vibrio cholerae M66-2]
 gi|229507351|ref|ZP_04396856.1| SSU ribosomal protein S10p (S20e) [Vibrio cholerae BX 330286]
 gi|229509726|ref|ZP_04399207.1| SSU ribosomal protein S10p (S20e) [Vibrio cholerae B33]
 gi|229513520|ref|ZP_04402984.1| SSU ribosomal protein S10p (S20e) [Vibrio cholerae TMA 21]
 gi|229516850|ref|ZP_04406296.1| SSU ribosomal protein S10p (S20e) [Vibrio cholerae RC9]
 gi|229521663|ref|ZP_04411081.1| SSU ribosomal protein S10p (S20e) [Vibrio cholerae TM 11079-80]
 gi|229524578|ref|ZP_04413983.1| SSU ribosomal protein S10p (S20e) [Vibrio cholerae bv. albensis
           VL426]
 gi|229527473|ref|ZP_04416865.1| SSU ribosomal protein S10p (S20e) [Vibrio cholerae 12129(1)]
 gi|229606857|ref|YP_002877505.1| 30S ribosomal protein S10 [Vibrio cholerae MJ-1236]
 gi|254292177|ref|ZP_04962947.1| ribosomal protein S10 [Vibrio cholerae AM-19226]
 gi|254851137|ref|ZP_05240487.1| ribosomal protein S10 [Vibrio cholerae MO10]
 gi|255744434|ref|ZP_05418386.1| SSU ribosomal protein S10p (S20e) [Vibrio cholera CIRS 101]
 gi|258620526|ref|ZP_05715564.1| 30S ribosomal protein S10 [Vibrio mimicus VM573]
 gi|258625739|ref|ZP_05720618.1| 30S ribosomal protein S10 [Vibrio mimicus VM603]
 gi|260770912|ref|ZP_05879841.1| SSU ribosomal protein S10p (S20e) [Vibrio furnissii CIP 102972]
 gi|260772095|ref|ZP_05881012.1| SSU ribosomal protein S10p (S20e) [Vibrio metschnikovii CIP 69.14]
 gi|260779504|ref|ZP_05888394.1| SSU ribosomal protein S10p (S20e) [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|261211152|ref|ZP_05925441.1| SSU ribosomal protein S10p (S20e) [Vibrio sp. RC341]
 gi|262166618|ref|ZP_06034355.1| SSU ribosomal protein S10p (S20e) [Vibrio mimicus VM223]
 gi|262170152|ref|ZP_06037841.1| SSU ribosomal protein S10p (S20e) [Vibrio cholerae RC27]
 gi|262170466|ref|ZP_06038144.1| SSU ribosomal protein S10p (S20e) [Vibrio mimicus MB-451]
 gi|262189978|ref|ZP_06048285.1| SSU ribosomal protein S10p (S20e) [Vibrio cholerae CT 5369-93]
 gi|262401884|ref|ZP_06078449.1| SSU ribosomal protein S10p (S20e) [Vibrio sp. RC586]
 gi|298500579|ref|ZP_07010383.1| SSU ribosomal protein S10 [Vibrio cholerae MAK 757]
 gi|17865600|sp|Q9KNY3|RS10_VIBCH RecName: Full=30S ribosomal protein S10
 gi|172047552|sp|A5F550|RS10_VIBC3 RecName: Full=30S ribosomal protein S10
 gi|254765357|sp|C3LRQ9|RS10_VIBCM RecName: Full=30S ribosomal protein S10
 gi|9657184|gb|AAF95738.1| ribosomal protein S10 [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121628710|gb|EAX61178.1| ribosomal protein S10 [Vibrio cholerae V52]
 gi|124115042|gb|EAY33862.1| ribosomal protein S10 [Vibrio cholerae 1587]
 gi|124120813|gb|EAY39556.1| ribosomal protein S10 [Vibrio cholerae MZO-3]
 gi|146317416|gb|ABQ21955.1| ribosomal protein S10 [Vibrio cholerae O395]
 gi|148873109|gb|EDL71244.1| ribosomal protein S10 [Vibrio cholerae 623-39]
 gi|149738679|gb|EDM53021.1| ribosomal protein S10 [Vibrio cholerae MZO-2]
 gi|150421906|gb|EDN13883.1| ribosomal protein S10 [Vibrio cholerae AM-19226]
 gi|227010602|gb|ACP06814.1| ribosomal protein S10 [Vibrio cholerae M66-2]
 gi|227014486|gb|ACP10696.1| ribosomal protein S10 [Vibrio cholerae O395]
 gi|229335105|gb|EEO00590.1| SSU ribosomal protein S10p (S20e) [Vibrio cholerae 12129(1)]
 gi|229338159|gb|EEO03176.1| SSU ribosomal protein S10p (S20e) [Vibrio cholerae bv. albensis
           VL426]
 gi|229341257|gb|EEO06261.1| SSU ribosomal protein S10p (S20e) [Vibrio cholerae TM 11079-80]
 gi|229345913|gb|EEO10885.1| SSU ribosomal protein S10p (S20e) [Vibrio cholerae RC9]
 gi|229349397|gb|EEO14353.1| SSU ribosomal protein S10p (S20e) [Vibrio cholerae TMA 21]
 gi|229353200|gb|EEO18139.1| SSU ribosomal protein S10p (S20e) [Vibrio cholerae B33]
 gi|229354856|gb|EEO19777.1| SSU ribosomal protein S10p (S20e) [Vibrio cholerae BX 330286]
 gi|229369512|gb|ACQ59935.1| SSU ribosomal protein S10p (S20e) [Vibrio cholerae MJ-1236]
 gi|254846842|gb|EET25256.1| ribosomal protein S10 [Vibrio cholerae MO10]
 gi|255737959|gb|EET93352.1| SSU ribosomal protein S10p (S20e) [Vibrio cholera CIRS 101]
 gi|258581977|gb|EEW06847.1| 30S ribosomal protein S10 [Vibrio mimicus VM603]
 gi|258587405|gb|EEW12116.1| 30S ribosomal protein S10 [Vibrio mimicus VM573]
 gi|260604313|gb|EEX30617.1| SSU ribosomal protein S10p (S20e) [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260612962|gb|EEX38164.1| SSU ribosomal protein S10p (S20e) [Vibrio metschnikovii CIP 69.14]
 gi|260614149|gb|EEX39339.1| SSU ribosomal protein S10p (S20e) [Vibrio furnissii CIP 102972]
 gi|260839653|gb|EEX66264.1| SSU ribosomal protein S10p (S20e) [Vibrio sp. RC341]
 gi|261891542|gb|EEY37528.1| SSU ribosomal protein S10p (S20e) [Vibrio mimicus MB-451]
 gi|262021560|gb|EEY40272.1| SSU ribosomal protein S10p (S20e) [Vibrio cholerae RC27]
 gi|262026334|gb|EEY45002.1| SSU ribosomal protein S10p (S20e) [Vibrio mimicus VM223]
 gi|262034135|gb|EEY52568.1| SSU ribosomal protein S10p (S20e) [Vibrio cholerae CT 5369-93]
 gi|262351856|gb|EEZ00987.1| SSU ribosomal protein S10p (S20e) [Vibrio sp. RC586]
 gi|297540748|gb|EFH76805.1| SSU ribosomal protein S10 [Vibrio cholerae MAK 757]
 gi|315178958|gb|ADT85872.1| 30S ribosomal protein S10 [Vibrio furnissii NCTC 11218]
 gi|327485079|gb|AEA79486.1| SSU ribosomal protein S10p (S20e) [Vibrio cholerae LMA3894-4]
          Length = 103

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 78/101 (77%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LKAFD +++D+S  EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +
Sbjct: 2   QNQRIRIRLKAFDYKLIDASTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 62  RDQYEIRTHKRLIDIVEPTDKTVDALMRLDLAAGVDVQISL 102


>gi|291280149|ref|YP_003496984.1| 30S ribosomal protein S10 [Deferribacter desulfuricans SSM1]
 gi|290754851|dbj|BAI81228.1| 30S ribosomal protein S10 [Deferribacter desulfuricans SSM1]
          Length = 102

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 80/100 (80%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LK+FDSRI+D ++++IV T K++G+++VGP+P P     FTV RSPHV+KKSR
Sbjct: 3   NQKIRIKLKSFDSRIIDKAVKDIVNTAKRTGARVVGPVPLPTRKEIFTVIRSPHVNKKSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q E+R +KRL+ I +  PQT+DALMKL+++AGV+V IKL
Sbjct: 63  EQFELRTHKRLIDIYEYNPQTIDALMKLELSAGVDVEIKL 102


>gi|255020764|ref|ZP_05292822.1| SSU ribosomal protein S10p (S20e) [Acidithiobacillus caldus ATCC
           51756]
 gi|254969760|gb|EET27264.1| SSU ribosomal protein S10p (S20e) [Acidithiobacillus caldus ATCC
           51756]
          Length = 103

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 75/98 (76%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D R+LD S  EIV T +++G+++ GPIP P  I RFTV RSPHVDK +RDQ
Sbjct: 6   KIRIRLKSYDYRMLDISAAEIVETARRTGARVCGPIPLPTKIERFTVLRSPHVDKNARDQ 65

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R +KRLL I+ P  +TVDAL+KLD+AAGV+V IKL
Sbjct: 66  FEQRTHKRLLDILDPNDKTVDALIKLDLAAGVDVEIKL 103


>gi|56461025|ref|YP_156306.1| 30S ribosomal protein S10 [Idiomarina loihiensis L2TR]
 gi|81600115|sp|Q5QXY9|RS10_IDILO RecName: Full=30S ribosomal protein S10
 gi|56180035|gb|AAV82757.1| Ribosomal protein S10 [Idiomarina loihiensis L2TR]
          Length = 103

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 75/100 (75%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N RI I LKAFD R++D S  EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +R
Sbjct: 3   NQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDAR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           DQ E+R +KRL+ I+ PT +TVDALM+LD+AAGV+V I L
Sbjct: 63  DQYEIRTHKRLIDIMDPTDKTVDALMRLDLAAGVDVQISL 102


>gi|109896797|ref|YP_660052.1| ribosomal protein S10 [Pseudoalteromonas atlantica T6c]
 gi|123065071|sp|Q15YP0|RS10_PSEA6 RecName: Full=30S ribosomal protein S10
 gi|109699078|gb|ABG38998.1| SSU ribosomal protein S10P [Pseudoalteromonas atlantica T6c]
 gi|332172248|gb|AEE21502.1| ribosomal protein S10 [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 103

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 76/100 (76%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N RI I LKAFD +++D S  EIV T K++G+Q+ GPIP P    R+T+  SPHV+K +R
Sbjct: 3   NQRIRIRLKAFDHKLIDQSTAEIVETAKRTGAQVSGPIPLPTRKERYTILTSPHVNKDAR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           DQ E+R +KRL+ II+PT +TVDALM+LD+AAGV+V I L
Sbjct: 63  DQYEIRTHKRLVDIIEPTDKTVDALMRLDLAAGVDVQISL 102


>gi|285017319|ref|YP_003375030.1| 30s ribosomal protein s10 [Xanthomonas albilineans GPE PC73]
 gi|283472537|emb|CBA15042.1| probable 30s ribosomal protein s10 [Xanthomonas albilineans]
          Length = 103

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 74/98 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD R++D S  EIV T K++G+Q+ GPIP P  I R+T+  SPHVDK +RDQ
Sbjct: 5   KIRIRLKAFDHRLIDRSASEIVETAKRTGAQVRGPIPLPTKIERYTILVSPHVDKDARDQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R +KR+L I+ P  +TVDALMKL++AAGV+V IKL
Sbjct: 65  YETRTHKRVLDIVDPNDKTVDALMKLELAAGVDVQIKL 102


>gi|238650973|ref|YP_002916829.1| 30S ribosomal protein S10 [Rickettsia peacockii str. Rustic]
 gi|259494603|sp|C4K2I0|RS10_RICPU RecName: Full=30S ribosomal protein S10
 gi|238625071|gb|ACR47777.1| 30S ribosomal protein S10 [Rickettsia peacockii str. Rustic]
          Length = 105

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 73/98 (74%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK+FD R LD + +EIV   K++ + I GPIP P+ I RFTVNRSPHV KKSR+Q
Sbjct: 4   KIKIRLKSFDHRSLDQATKEIVSAVKRTFANINGPIPLPKKIGRFTVNRSPHVHKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRLL I  P P  VDAL K+D+AAGV+VVI+L
Sbjct: 64  FEIRTHKRLLVIDDPNPAVVDALSKVDLAAGVDVVIEL 101


>gi|118595832|sp|Q1ISC3|RS10_ACIBL RecName: Full=30S ribosomal protein S10
          Length = 109

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 59/97 (60%), Positives = 74/97 (76%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I LKA+D R+LD S  EIV T +++G+QI GPIP P    ++ V RSPHVDKKSR+ 
Sbjct: 6   RIRIRLKAYDYRVLDQSTGEIVDTARRTGAQIAGPIPLPTVKNKYCVLRSPHVDKKSREA 65

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E+R +KRLL I++PT QTVDALMKLD+ AGV+V IK
Sbjct: 66  FEIRTHKRLLDILEPTQQTVDALMKLDLPAGVDVEIK 102


>gi|238898928|ref|YP_002924610.1| 30S ribosomal subunit protein S10 [Candidatus Hamiltonella defensa
           5AT (Acyrthosiphon pisum)]
 gi|229466688|gb|ACQ68462.1| 30S ribosomal subunit protein S10 [Candidatus Hamiltonella defensa
           5AT (Acyrthosiphon pisum)]
          Length = 106

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 57/104 (54%), Positives = 76/104 (73%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
            T    RI I LKAFD R++D S  EIV T K++G+Q+ GPIP P    RFT+  SPH +
Sbjct: 2   QTQTQQRIRIRLKAFDHRLIDKSTTEIVETAKRTGAQVSGPIPLPTHKERFTILVSPHAN 61

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K +RDQ E+R +KR++ II+PT +TVDALM+LD+AAGV+V I+L
Sbjct: 62  KDARDQYEIRTHKRIVDIIEPTAKTVDALMRLDLAAGVDVHIQL 105


>gi|94968253|ref|YP_590301.1| 30S ribosomal protein S10 [Candidatus Koribacter versatilis
           Ellin345]
 gi|94550303|gb|ABF40227.1| SSU ribosomal protein S10P [Candidatus Koribacter versatilis
           Ellin345]
          Length = 123

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 59/97 (60%), Positives = 74/97 (76%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I LKA+D R+LD S  EIV T +++G+QI GPIP P    ++ V RSPHVDKKSR+ 
Sbjct: 20  RIRIRLKAYDYRVLDQSTGEIVDTARRTGAQIAGPIPLPTVKNKYCVLRSPHVDKKSREA 79

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E+R +KRLL I++PT QTVDALMKLD+ AGV+V IK
Sbjct: 80  FEIRTHKRLLDILEPTQQTVDALMKLDLPAGVDVEIK 116


>gi|299139129|ref|ZP_07032305.1| ribosomal protein S10 [Acidobacterium sp. MP5ACTX8]
 gi|298598809|gb|EFI54971.1| ribosomal protein S10 [Acidobacterium sp. MP5ACTX8]
          Length = 105

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 58/97 (59%), Positives = 74/97 (76%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I LKA+D R+LD S  EIV T K++G+Q+ GPIP P    ++ V RSPHVDKKSR+ 
Sbjct: 5   RIRIRLKAYDYRVLDVSTSEIVETAKRTGAQVAGPIPLPTMKNKYCVLRSPHVDKKSREA 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E+R +KRL+ I++PT QTVDALMKLD+ AGV+V IK
Sbjct: 65  FEIRTHKRLIDILEPTQQTVDALMKLDLPAGVDVEIK 101


>gi|120553651|ref|YP_958002.1| 30S ribosomal protein S10 [Marinobacter aquaeolei VT8]
 gi|149376687|ref|ZP_01894446.1| ribosomal protein S10 [Marinobacter algicola DG893]
 gi|166231283|sp|A1TYJ6|RS10_MARAV RecName: Full=30S ribosomal protein S10
 gi|120323500|gb|ABM17815.1| SSU ribosomal protein S10P [Marinobacter aquaeolei VT8]
 gi|149359060|gb|EDM47525.1| ribosomal protein S10 [Marinobacter algicola DG893]
 gi|311693270|gb|ADP96143.1| ribosomal protein S10, bacterial [marine bacterium HP15]
          Length = 103

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 60/104 (57%), Positives = 79/104 (75%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+ IRI   LKAFD R++D S +EIV T K++G+Q+ GPIP P    ++TV  SPHV+
Sbjct: 1   MQSQKIRIR--LKAFDYRLIDQSTQEIVDTAKRTGAQVRGPIPLPTRKEKYTVLISPHVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K +RDQ E+R +KRLL I++PT +TVDALMKLD+AAGV+V I L
Sbjct: 59  KDARDQYEIRTHKRLLDIVEPTEKTVDALMKLDLAAGVDVQISL 102


>gi|312795773|ref|YP_004028695.1| SSU ribosomal protein S10P [Burkholderia rhizoxinica HKI 454]
 gi|312167548|emb|CBW74551.1| SSU ribosomal protein S10P [Burkholderia rhizoxinica HKI 454]
          Length = 103

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 77/98 (78%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD +++D S R+I  T +++G+ +VGPIP PR I+RF + RSPHV+K SRDQ
Sbjct: 5   KIRIRLKAFDYKLVDQSARQIFETVQRTGAILVGPIPLPRRIQRFDILRSPHVNKTSRDQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           LE+R + RLL I+ PT +TVDALMKLD+ AGV+V IKL
Sbjct: 65  LEIRTHLRLLDIVDPTDKTVDALMKLDLPAGVDVEIKL 102


>gi|88801220|ref|ZP_01116761.1| ribosomal protein S10 [Reinekea sp. MED297]
 gi|88776058|gb|EAR07292.1| ribosomal protein S10 [Reinekea sp. MED297]
          Length = 103

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 78/101 (77%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N +I I LKAFD R++D+S +EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +
Sbjct: 2   QNQKIRIRLKAFDHRLIDASTQEIVDTAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KR+L I++PT +TVDAL KLD+AAGV++ I L
Sbjct: 62  RDQYEIRTHKRMLDIVEPTEKTVDALRKLDLAAGVDIQISL 102


>gi|71278063|ref|YP_267623.1| 30S ribosomal protein S10 [Colwellia psychrerythraea 34H]
 gi|115305616|sp|Q487Z2|RS10_COLP3 RecName: Full=30S ribosomal protein S10
 gi|71143803|gb|AAZ24276.1| ribosomal protein S10 [Colwellia psychrerythraea 34H]
          Length = 103

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 76/100 (76%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N RI I LKAFD R++D S  EIV T K++G+Q+ GPIP P    R+T+  SPHV+K +R
Sbjct: 3   NQRIRIRLKAFDHRLIDQSTAEIVDTAKRTGAQVRGPIPLPTRKERYTILTSPHVNKDAR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           DQ E+R +KR++ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 63  DQYEIRTHKRMIDIVEPTEKTVDALMRLDLAAGVDVQISL 102


>gi|24371828|ref|NP_715870.1| 30S ribosomal protein S10 [Shewanella oneidensis MR-1]
 gi|113968543|ref|YP_732336.1| 30S ribosomal protein S10 [Shewanella sp. MR-4]
 gi|114045706|ref|YP_736256.1| 30S ribosomal protein S10 [Shewanella sp. MR-7]
 gi|117918656|ref|YP_867848.1| 30S ribosomal protein S10 [Shewanella sp. ANA-3]
 gi|127511091|ref|YP_001092288.1| 30S ribosomal protein S10 [Shewanella loihica PV-4]
 gi|44888497|sp|Q8EK69|RS10_SHEON RecName: Full=30S ribosomal protein S10
 gi|122944224|sp|Q0HNT8|RS10_SHESM RecName: Full=30S ribosomal protein S10
 gi|123327001|sp|Q0I0A6|RS10_SHESR RecName: Full=30S ribosomal protein S10
 gi|166231780|sp|A3Q981|RS10_SHELP RecName: Full=30S ribosomal protein S10
 gi|166231782|sp|A0KRM3|RS10_SHESA RecName: Full=30S ribosomal protein S10
 gi|24345641|gb|AAN53315.1|AE015473_2 ribosomal protein S10 [Shewanella oneidensis MR-1]
 gi|113883227|gb|ABI37279.1| SSU ribosomal protein S10P [Shewanella sp. MR-4]
 gi|113887148|gb|ABI41199.1| SSU ribosomal protein S10P [Shewanella sp. MR-7]
 gi|117610988|gb|ABK46442.1| SSU ribosomal protein S10P [Shewanella sp. ANA-3]
 gi|126636386|gb|ABO22029.1| SSU ribosomal protein S10P [Shewanella loihica PV-4]
          Length = 103

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 76/101 (75%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LK FD R++D S  EIV T K++G+Q+ GPIP P    R+TV  SPHV+K +
Sbjct: 2   QNQRIRIRLKGFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERYTVLISPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 62  RDQYELRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISL 102


>gi|297537530|ref|YP_003673299.1| 30S ribosomal protein S10 [Methylotenera sp. 301]
 gi|297256877|gb|ADI28722.1| ribosomal protein S10 [Methylotenera sp. 301]
          Length = 102

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 58/104 (55%), Positives = 79/104 (75%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M+++ IRI   LKAFD R++D S +EIV T K++G+ + GP+P P  I RF + RSPHV+
Sbjct: 1   MSTQKIRIR--LKAFDYRLIDQSAQEIVETAKRTGAVVKGPVPLPTRIERFDILRSPHVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SRDQ E+R ++RL+ I+ PT +TVDALMKLD+ AGV+V IKL
Sbjct: 59  KTSRDQFEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKL 102


>gi|304310015|ref|YP_003809613.1| Ribosomal protein S10 [gamma proteobacterium HdN1]
 gi|301795748|emb|CBL43947.1| Ribosomal protein S10 [gamma proteobacterium HdN1]
          Length = 106

 Score =  117 bits (293), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 77/101 (76%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N +I I LKAFD +++D S  EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +
Sbjct: 5   QNQKIRIRLKAFDHKLIDQSASEIVETAKRTGAQVRGPIPLPTRQERFTVLISPHVNKDA 64

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRL+ I++PT +TVDALMKL++AAGV+V I L
Sbjct: 65  RDQYEIRTHKRLVEIVEPTDKTVDALMKLNLAAGVDVQISL 105


>gi|78046554|ref|YP_362729.1| 30S ribosomal protein S10 [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|289665136|ref|ZP_06486717.1| 30S ribosomal protein S10 [Xanthomonas campestris pv. vasculorum
           NCPPB702]
 gi|289669343|ref|ZP_06490418.1| 30S ribosomal protein S10 [Xanthomonas campestris pv. musacearum
           NCPPB4381]
 gi|325925388|ref|ZP_08186790.1| SSU ribosomal protein S10P [Xanthomonas perforans 91-118]
 gi|118597339|sp|Q3BWY4|RS10_XANC5 RecName: Full=30S ribosomal protein S10
 gi|78034984|emb|CAJ22629.1| 30S ribosomal protein S10 [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|325544266|gb|EGD15647.1| SSU ribosomal protein S10P [Xanthomonas perforans 91-118]
          Length = 111

 Score =  117 bits (293), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 73/98 (74%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD R++D S  EIV T K++G+Q+ GPIP P  I R+T+  SPH DK +RDQ
Sbjct: 13  KIRIRLKAFDHRLIDRSASEIVETAKRTGAQVRGPIPLPTKIERYTILVSPHADKDARDQ 72

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R +KR+L II P  +TVDALMKL++AAGV+V IKL
Sbjct: 73  YETRTHKRVLDIIDPNDKTVDALMKLELAAGVDVQIKL 110


>gi|33519657|ref|NP_878489.1| 30S ribosomal protein S10 [Candidatus Blochmannia floridanus]
 gi|44888428|sp|Q7VQE9|RS10_BLOFL RecName: Full=30S ribosomal protein S10
 gi|33517320|emb|CAD83705.1| 30S ribosomal subunit protein S10 [Candidatus Blochmannia
           floridanus]
          Length = 103

 Score =  117 bits (293), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 76/101 (75%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LKAFD R++D S  +IV T K++G+Q+ GPIP P    RFT+  SPHV+K +
Sbjct: 2   QNQRIRIRLKAFDHRLIDRSTLDIVETAKRTGAQVHGPIPLPTKKERFTILVSPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRL+ I+ PT +TVDALMKLD+AAGV+V I L
Sbjct: 62  RDQYEIRTHKRLIDIVDPTDKTVDALMKLDLAAGVDVQISL 102


>gi|85713372|ref|ZP_01044381.1| 30S ribosomal protein S10 [Idiomarina baltica OS145]
 gi|85692800|gb|EAQ30789.1| 30S ribosomal protein S10 [Idiomarina baltica OS145]
          Length = 103

 Score =  117 bits (293), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 75/100 (75%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N RI I LKAFD R++D S  EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +R
Sbjct: 3   NQRIRIRLKAFDHRLIDQSTAEIVDTAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDAR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           DQ E+R +KRL+ I+ PT +TVDALM+LD+AAGV+V I L
Sbjct: 63  DQYEIRTHKRLIDIMDPTDKTVDALMRLDLAAGVDVQISL 102


>gi|254492320|ref|ZP_05105493.1| ribosomal protein S10 [Methylophaga thiooxidans DMS010]
 gi|224462492|gb|EEF78768.1| ribosomal protein S10 [Methylophaga thiooxydans DMS010]
          Length = 104

 Score =  117 bits (293), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 57/97 (58%), Positives = 76/97 (78%)

Query: 8   ICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQL 67
           I I LK+FD R++D S +EIV T K++G++I GPIP P    RFTV  SPHV+K +R+Q 
Sbjct: 7   IRIRLKSFDHRLIDQSAKEIVETAKRTGARINGPIPLPTKKERFTVLISPHVNKDAREQY 66

Query: 68  EMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           E+R +KRL+ I++PT +TVDALMKLD+AAGV+V IKL
Sbjct: 67  ELRTHKRLMDIVEPTDKTVDALMKLDLAAGVDVQIKL 103


>gi|116515260|ref|YP_802889.1| 30S ribosomal protein S10 [Buchnera aphidicola str. Cc (Cinara
           cedri)]
 gi|122285344|sp|Q057A3|RS10_BUCCC RecName: Full=30S ribosomal protein S10
 gi|58384693|gb|AAW72708.1| 30S ribosomal protein S10 [Buchnera aphidicola (Cinara cedri)]
 gi|116257114|gb|ABJ90796.1| 30S ribosomal protein S10 [Buchnera aphidicola str. Cc (Cinara
           cedri)]
          Length = 103

 Score =  117 bits (293), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 78/101 (77%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LKAFD R++D S  EIV T K++G++++GPIP P    RFT+  SPHV+K +
Sbjct: 2   QNQRIRIRLKAFDYRLIDQSTLEIVNTAKRTGAKVLGPIPLPTRKERFTILVSPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 62  RDQYEIRTHKRLIDIVQPTEKTVDALMRLDLAAGVDVQISL 102


>gi|157826064|ref|YP_001493784.1| 30S ribosomal protein S10 [Rickettsia akari str. Hartford]
 gi|166231770|sp|A8GPF1|RS10_RICAH RecName: Full=30S ribosomal protein S10
 gi|157800022|gb|ABV75276.1| 30S ribosomal protein S10 [Rickettsia akari str. Hartford]
          Length = 105

 Score =  117 bits (293), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 72/98 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK+FD   LD + +EIV   K++ + I GPIP PR I RFTVNRSPHV KKSR+Q
Sbjct: 4   KIKIRLKSFDHHSLDQATKEIVSAVKRTFASINGPIPLPRKIERFTVNRSPHVHKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRLL I  P P  VDAL K+D+AAGV+VVI+L
Sbjct: 64  FEIRKHKRLLVIDDPNPAVVDALSKVDLAAGVDVVIEL 101


>gi|157828861|ref|YP_001495103.1| 30S ribosomal protein S10 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165933588|ref|YP_001650377.1| 30S ribosomal protein S10 [Rickettsia rickettsii str. Iowa]
 gi|166231773|sp|A8GT70|RS10_RICRS RecName: Full=30S ribosomal protein S10
 gi|189040385|sp|B0BUR1|RS10_RICRO RecName: Full=30S ribosomal protein S10
 gi|157801342|gb|ABV76595.1| 30S ribosomal protein S10 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165908675|gb|ABY72971.1| SSU ribosomal protein S10P [Rickettsia rickettsii str. Iowa]
          Length = 105

 Score =  117 bits (293), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 74/98 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK+FD R LD + +EIV   K++ ++I GPIP P+ I RFTVNRSPHV KKSR+Q
Sbjct: 4   KIKIRLKSFDHRSLDQATKEIVSAVKRTFAKINGPIPLPKKIGRFTVNRSPHVHKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRLL I  P P  VDAL K+D+AAGV+VVI+L
Sbjct: 64  FEIRKHKRLLVIGDPNPAVVDALSKVDLAAGVDVVIEL 101


>gi|221133613|ref|ZP_03559918.1| 30S ribosomal protein S10 [Glaciecola sp. HTCC2999]
 gi|239994999|ref|ZP_04715523.1| 30S ribosomal protein S10 [Alteromonas macleodii ATCC 27126]
 gi|332139847|ref|YP_004425585.1| 30S ribosomal protein S10 [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|332139860|ref|YP_004425598.1| 30S ribosomal protein S10 [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|226705393|sp|B4RZN1|RS10_ALTMD RecName: Full=30S ribosomal protein S10
 gi|327549869|gb|AEA96587.1| 30S ribosomal protein S10 [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327549882|gb|AEA96600.1| 30S ribosomal protein S10 [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 103

 Score =  117 bits (293), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 76/100 (76%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N RI I LKAFD +++D S  EIV T K++G+Q+ GPIP P    R+TV  SPHV+K +R
Sbjct: 3   NQRIRIRLKAFDHKLIDQSTAEIVETAKRTGAQVSGPIPLPTRKERYTVLISPHVNKDAR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           DQ E+R +KRL+ II+PT +TVDALM+LD+AAGV+V I L
Sbjct: 63  DQYEIRTHKRLVDIIEPTDKTVDALMRLDLAAGVDVQISL 102


>gi|289623850|ref|ZP_06456804.1| 30S ribosomal protein S10 [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289648943|ref|ZP_06480286.1| 30S ribosomal protein S10 [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|330869432|gb|EGH04141.1| 30S ribosomal protein S10 [Pseudomonas syringae pv. aesculi str.
           0893_23]
          Length = 103

 Score =  117 bits (293), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 76/101 (75%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N +I I L+AFD R++D S +EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +
Sbjct: 2   QNQQIRIRLEAFDHRLIDQSTQEIVETAKRTGAQVRGPIPLPTRKERFTVLVSPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KR+L I++PT +TVDALMKLD+A GV V I L
Sbjct: 62  RDQYEIRTHKRVLDIVQPTEKTVDALMKLDLAVGVEVQISL 102


>gi|119899707|ref|YP_934920.1| 30S ribosomal protein S10 [Azoarcus sp. BH72]
 gi|166231238|sp|A1KB28|RS10_AZOSB RecName: Full=30S ribosomal protein S10
 gi|119672120|emb|CAL96034.1| 30S ribosomal protein S10 [Azoarcus sp. BH72]
          Length = 103

 Score =  117 bits (293), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 77/101 (76%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N +I I LKAFD R++D S  EIV T K++G+ + GP+P P  I RF + RSPHV+K S
Sbjct: 2   QNQKIRIRLKAFDYRLIDQSALEIVDTAKRTGAVVRGPVPLPTRIERFNLLRSPHVNKTS 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ+E+R ++RL+ II PT +TVDALMKLD+ AGV+V IKL
Sbjct: 62  RDQMEIRTHQRLMDIIDPTDKTVDALMKLDLPAGVDVEIKL 102


>gi|237747364|ref|ZP_04577844.1| ribosomal protein S10 [Oxalobacter formigenes HOxBLS]
 gi|237749514|ref|ZP_04579994.1| ribosomal protein S10 [Oxalobacter formigenes OXCC13]
 gi|229378715|gb|EEO28806.1| ribosomal protein S10 [Oxalobacter formigenes HOxBLS]
 gi|229380876|gb|EEO30967.1| ribosomal protein S10 [Oxalobacter formigenes OXCC13]
          Length = 103

 Score =  117 bits (293), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 78/101 (77%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N +I I LKAFD +++D S +EI+ T K++G+ + GP+P P  I+RF + RSPHV+K S
Sbjct: 2   QNQKIRIRLKAFDYKLIDQSAQEIIDTAKRTGAVVKGPVPLPTRIQRFDILRSPHVNKTS 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R ++RL+ II PT +TVDALMKLD+ AGV+V IKL
Sbjct: 62  RDQFEIRTHQRLMDIIDPTDKTVDALMKLDLPAGVDVEIKL 102


>gi|251772489|gb|EES53055.1| Ribosomal protein S10 [Leptospirillum ferrodiazotrophum]
          Length = 100

 Score =  117 bits (292), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 75/98 (76%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK +D RILD S+ +IV T K++G+ I GPIP P  I +FTV RSPH DKKSR+Q
Sbjct: 3   KIRIRLKGYDFRILDQSLVDIVSTAKRTGATIKGPIPLPTRIEKFTVLRSPHADKKSREQ 62

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R +KRL+ II+ TP+T+DALMKL++ AGV+V IKL
Sbjct: 63  FERRTHKRLIDIIESTPETIDALMKLELPAGVDVEIKL 100


>gi|114561335|ref|YP_748848.1| ribosomal protein S10 [Shewanella frigidimarina NCIMB 400]
 gi|122301116|sp|Q089Q5|RS10_SHEFN RecName: Full=30S ribosomal protein S10
 gi|114332628|gb|ABI70010.1| SSU ribosomal protein S10P [Shewanella frigidimarina NCIMB 400]
          Length = 103

 Score =  117 bits (292), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 76/101 (75%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LK FD R++D S  EIV T K++G+Q+ GPIP P    R+TV  SPHV+K +
Sbjct: 2   QNQRIRIRLKGFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERYTVLISPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 62  RDQYEIRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISL 102


>gi|237653997|ref|YP_002890311.1| 30S ribosomal protein S10 [Thauera sp. MZ1T]
 gi|237625244|gb|ACR01934.1| ribosomal protein S10 [Thauera sp. MZ1T]
          Length = 103

 Score =  117 bits (292), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 77/101 (76%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N +I I LKAFD R++D S  EIV T K++G+ + GP+P P  I RF + RSPHV+K S
Sbjct: 2   QNQKIRIRLKAFDYRLIDQSALEIVDTAKRTGAVVRGPVPLPTRIERFDLLRSPHVNKAS 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ+E+R ++RL+ II PT +TVDALMKLD+ AGV+V IKL
Sbjct: 62  RDQMEIRTHQRLMDIIDPTDKTVDALMKLDLPAGVDVEIKL 102


>gi|323144963|ref|ZP_08079523.1| ribosomal protein S10 [Succinatimonas hippei YIT 12066]
 gi|322415242|gb|EFY06016.1| ribosomal protein S10 [Succinatimonas hippei YIT 12066]
          Length = 107

 Score =  117 bits (292), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 77/101 (76%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LKA+D R++D S  EIV T K++G+Q+ GPIP P    R+T+  SPHV+K +
Sbjct: 6   QNQRIRIRLKAYDHRLIDHSTAEIVETAKRTGAQVRGPIPLPTRKERYTILISPHVNKDA 65

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 66  RDQYEIRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISL 106


>gi|145588241|ref|YP_001154838.1| ribosomal protein S10 [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|189040382|sp|A4SUW0|RS10_POLSQ RecName: Full=30S ribosomal protein S10
 gi|145046647|gb|ABP33274.1| SSU ribosomal protein S10P [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
          Length = 103

 Score =  117 bits (292), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 76/101 (75%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N +I I LKAFD R++D S  EIV T K++G+ + GP+P P  I RF + RSPHV+K S
Sbjct: 2   QNQKIRIRLKAFDYRLIDQSAAEIVDTAKRTGAVVKGPVPLPTRIERFDILRSPHVNKTS 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQLE+R + RL+ I+ PT +TVDALMKLD+ AGV+V IKL
Sbjct: 62  RDQLEIRTHLRLMDIVDPTEKTVDALMKLDLPAGVDVEIKL 102


>gi|15892930|ref|NP_360644.1| 30S ribosomal protein S10 [Rickettsia conorii str. Malish 7]
 gi|20140106|sp|Q92GW5|RS10_RICCN RecName: Full=30S ribosomal protein S10
 gi|15620122|gb|AAL03545.1| 30S ribosomal protein S10 [Rickettsia conorii str. Malish 7]
          Length = 105

 Score =  117 bits (292), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 73/98 (74%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK+FD R LD + +EIV   K++ + I GPIP P+ I RFTVNRSPHV KKSR+Q
Sbjct: 4   KIKIRLKSFDHRSLDQATKEIVSAVKRTFANINGPIPLPKKIGRFTVNRSPHVHKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRLL I  P P  VDAL K+D+AAGV+VVI+L
Sbjct: 64  FEIRKHKRLLVIGDPNPAVVDALSKVDLAAGVDVVIEL 101


>gi|21241736|ref|NP_641318.1| 30S ribosomal protein S10 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|294627842|ref|ZP_06706421.1| 30S ribosomal protein S10 [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|325916486|ref|ZP_08178755.1| SSU ribosomal protein S10P [Xanthomonas vesicatoria ATCC 35937]
 gi|23822080|sp|Q8PNS5|RS10_XANAC RecName: Full=30S ribosomal protein S10
 gi|21107107|gb|AAM35854.1| 30S ribosomal protein S10 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|292597756|gb|EFF41914.1| 30S ribosomal protein S10 [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|325537275|gb|EGD09002.1| SSU ribosomal protein S10P [Xanthomonas vesicatoria ATCC 35937]
          Length = 103

 Score =  117 bits (292), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 58/104 (55%), Positives = 76/104 (73%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M+ + IRI   LKAFD R++D S  EIV T K++G+Q+ GPIP P  I R+T+  SPH D
Sbjct: 1   MSEQKIRIR--LKAFDHRLIDRSASEIVETAKRTGAQVRGPIPLPTKIERYTILVSPHAD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K +RDQ E R +KR+L I+ P  +TVDALMKL++AAGV+V IKL
Sbjct: 59  KDARDQYETRTHKRVLDIVDPNDKTVDALMKLELAAGVDVQIKL 102


>gi|34499642|ref|NP_903857.1| 30S ribosomal protein S10 [Chromobacterium violaceum ATCC 12472]
 gi|44888392|sp|Q7NQF1|RS10_CHRVO RecName: Full=30S ribosomal protein S10
 gi|34105492|gb|AAQ61847.1| 30S ribosomal protein S10 [Chromobacterium violaceum ATCC 12472]
          Length = 103

 Score =  117 bits (292), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 60/104 (57%), Positives = 78/104 (75%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M+S+ IRI   LKAFD  ++D S +EIV T K++G+ + GP+P P  I RF V RSPHV+
Sbjct: 1   MSSQKIRIR--LKAFDYNLIDRSAQEIVETAKRTGAVVKGPVPLPTKIERFNVLRSPHVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SRDQLE+R + RL+ I+ PT +TVDALMKLD+ AGV+V IKL
Sbjct: 59  KTSRDQLEIRTHLRLMDIVDPTDKTVDALMKLDLPAGVDVEIKL 102


>gi|120596988|ref|YP_961562.1| 30S ribosomal protein S10 [Shewanella sp. W3-18-1]
 gi|126176356|ref|YP_001052505.1| 30S ribosomal protein S10 [Shewanella baltica OS155]
 gi|146294842|ref|YP_001185266.1| 30S ribosomal protein S10 [Shewanella putrefaciens CN-32]
 gi|152998748|ref|YP_001364429.1| 30S ribosomal protein S10 [Shewanella baltica OS185]
 gi|160873325|ref|YP_001552641.1| 30S ribosomal protein S10 [Shewanella baltica OS195]
 gi|217975202|ref|YP_002359953.1| 30S ribosomal protein S10 [Shewanella baltica OS223]
 gi|304412764|ref|ZP_07394366.1| ribosomal protein S10 [Shewanella baltica OS183]
 gi|307307428|ref|ZP_07587163.1| ribosomal protein S10 [Shewanella baltica BA175]
 gi|166231778|sp|A3DA73|RS10_SHEB5 RecName: Full=30S ribosomal protein S10
 gi|166231779|sp|A6WHS7|RS10_SHEB8 RecName: Full=30S ribosomal protein S10
 gi|166231781|sp|A4YBY4|RS10_SHEPC RecName: Full=30S ribosomal protein S10
 gi|166231783|sp|A1REB3|RS10_SHESW RecName: Full=30S ribosomal protein S10
 gi|189040391|sp|A9KWA1|RS10_SHEB9 RecName: Full=30S ribosomal protein S10
 gi|254809984|sp|B8EBK6|RS10_SHEB2 RecName: Full=30S ribosomal protein S10
 gi|120557081|gb|ABM23008.1| SSU ribosomal protein S10P [Shewanella sp. W3-18-1]
 gi|125999561|gb|ABN63636.1| SSU ribosomal protein S10P [Shewanella baltica OS155]
 gi|145566532|gb|ABP77467.1| SSU ribosomal protein S10P [Shewanella putrefaciens CN-32]
 gi|151363366|gb|ABS06366.1| ribosomal protein S10 [Shewanella baltica OS185]
 gi|160858847|gb|ABX47381.1| ribosomal protein S10 [Shewanella baltica OS195]
 gi|217500337|gb|ACK48530.1| ribosomal protein S10 [Shewanella baltica OS223]
 gi|304348844|gb|EFM13260.1| ribosomal protein S10 [Shewanella baltica OS183]
 gi|306910216|gb|EFN40649.1| ribosomal protein S10 [Shewanella baltica BA175]
 gi|315265552|gb|ADT92405.1| ribosomal protein S10 [Shewanella baltica OS678]
 gi|319424579|gb|ADV52653.1| ribosomal protein S10 [Shewanella putrefaciens 200]
          Length = 103

 Score =  117 bits (292), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 76/101 (75%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LK FD R++D S  EIV T K++G+Q+ GPIP P    R+T+  SPHV+K +
Sbjct: 2   QNQRIRIRLKGFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERYTILISPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 62  RDQYELRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISL 102


>gi|301059236|ref|ZP_07200173.1| ribosomal protein S10 [delta proteobacterium NaphS2]
 gi|300446671|gb|EFK10499.1| ribosomal protein S10 [delta proteobacterium NaphS2]
          Length = 103

 Score =  117 bits (292), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 79/100 (79%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA+D ++LD +  EIV T K++G+++ GPIP P  I ++ V RSPHV+KKSR
Sbjct: 4   NQKIRIRLKAYDYKLLDRAALEIVDTAKETGARVAGPIPLPTVINKYCVLRSPHVNKKSR 63

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q E+R +KR++ I++PT QTVD+LMKLD+AAGV+V IKL
Sbjct: 64  EQFEIRTHKRVMDILEPTQQTVDSLMKLDLAAGVDVEIKL 103


>gi|262158452|ref|ZP_06029567.1| SSU ribosomal protein S10p (S20e) [Vibrio cholerae INDRE 91/1]
 gi|262029613|gb|EEY48262.1| SSU ribosomal protein S10p (S20e) [Vibrio cholerae INDRE 91/1]
          Length = 103

 Score =  117 bits (292), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 77/101 (76%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LKAFD +++D+S  EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +
Sbjct: 2   QNQRIRIRLKAFDYKLIDASTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRL+ I +PT +TVDALM+LD+AAGV+V I L
Sbjct: 62  RDQYEIRTHKRLIDIAEPTDKTVDALMRLDLAAGVDVQISL 102


>gi|261415820|ref|YP_003249503.1| ribosomal protein S10 [Fibrobacter succinogenes subsp. succinogenes
           S85]
 gi|261372276|gb|ACX75021.1| ribosomal protein S10 [Fibrobacter succinogenes subsp. succinogenes
           S85]
 gi|302326181|gb|ADL25382.1| ribosomal protein S10 [Fibrobacter succinogenes subsp. succinogenes
           S85]
          Length = 102

 Score =  116 bits (291), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 75/98 (76%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I LK+FD R++D S ++IV T K +G++I GPIP P  I+++TV RSPH+DK SR+Q
Sbjct: 5   RIRIRLKSFDHRMIDRSAQDIVNTAKNTGARIAGPIPLPTKIQKYTVLRSPHIDKTSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R +KRL+ I+  TPQTVD+LMKLD+ AGV V IK+
Sbjct: 65  FESRTHKRLIDILDATPQTVDSLMKLDLPAGVEVEIKV 102


>gi|289209330|ref|YP_003461396.1| ribosomal protein S10 [Thioalkalivibrio sp. K90mix]
 gi|288944961|gb|ADC72660.1| ribosomal protein S10 [Thioalkalivibrio sp. K90mix]
          Length = 103

 Score =  116 bits (291), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 75/100 (75%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N RI I LKAFD R++D S  EIV T K++G+++ GPIP P     +TV  SPHV+K +R
Sbjct: 3   NQRIRIRLKAFDHRLIDRSAAEIVETAKRTGARVKGPIPLPTKRESYTVLISPHVNKDAR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           DQ E+R +KRL+ I+ PT +TVDALMKLD+AAGVNV I+L
Sbjct: 63  DQYELRTHKRLMDILDPTDKTVDALMKLDLAAGVNVQIRL 102


>gi|224370692|ref|YP_002604856.1| RpsJ [Desulfobacterium autotrophicum HRM2]
 gi|223693409|gb|ACN16692.1| RpsJ [Desulfobacterium autotrophicum HRM2]
          Length = 102

 Score =  116 bits (291), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 78/98 (79%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D ++LD S  +IV T +K+G+++VGPIP P  I +F V RSPHV+KKSR+Q
Sbjct: 5   KIRIRLKAYDHKLLDQSSIDIVDTARKTGAKVVGPIPLPTRINKFCVLRSPHVNKKSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRL+ I++PT QTVDALMKLD++ GV+V IKL
Sbjct: 65  FEIRTHKRLMDILEPTQQTVDALMKLDLSPGVDVEIKL 102


>gi|49075280|gb|AAT49461.1| PA4264 [synthetic construct]
          Length = 104

 Score =  116 bits (291), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 76/101 (75%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N +I I LKAFD R++D S + IV T K++G+Q+ GPIP P    RFTV  SPHV+K +
Sbjct: 2   QNQQIRIRLKAFDHRLIDQSTQGIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KR+L I++PT +TVDALMKLD+AAGV V I L
Sbjct: 62  RDQYEIRTHKRVLDIVQPTDKTVDALMKLDLAAGVEVQISL 102


>gi|171060535|ref|YP_001792884.1| 30S ribosomal protein S10 [Leptothrix cholodnii SP-6]
 gi|226705588|sp|B1Y7H1|RS10_LEPCP RecName: Full=30S ribosomal protein S10
 gi|170777980|gb|ACB36119.1| ribosomal protein S10 [Leptothrix cholodnii SP-6]
          Length = 103

 Score =  116 bits (291), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 76/98 (77%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD +++D S +EIV T K++G+ + GP+P P  ++RF + RSPHV+K SRDQ
Sbjct: 5   KIRIRLKAFDYKLIDQSAQEIVETAKRTGAIVKGPVPLPTRMQRFDILRSPHVNKTSRDQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR ++RL+ I+ PT +TVDALMKLD+ AGV+V IKL
Sbjct: 65  FEMRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKL 102


>gi|206889610|ref|YP_002249246.1| ribosomal protein S10 [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|206741548|gb|ACI20605.1| ribosomal protein S10 [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 101

 Score =  116 bits (291), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 80/98 (81%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I L+A+D+R+LD S++EIV T KK+G++I GP+P P  I ++TV RS + DKKSR+Q
Sbjct: 4   KIRIKLRAYDNRVLDQSVKEIVDTVKKTGARISGPVPLPTKISKYTVLRSTNQDKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R++KRL+ I  PTP+TV+ALMKL+++AGV+V IKL
Sbjct: 64  FEIRVHKRLIDIHDPTPETVEALMKLELSAGVDVEIKL 101


>gi|319787926|ref|YP_004147401.1| ribosomal protein S10 [Pseudoxanthomonas suwonensis 11-1]
 gi|317466438|gb|ADV28170.1| ribosomal protein S10 [Pseudoxanthomonas suwonensis 11-1]
          Length = 103

 Score =  116 bits (291), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 73/98 (74%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD R++D S  EIV T K++G+Q+ GPIP P  I R+T+  SPH DK +RDQ
Sbjct: 5   KIRIRLKAFDHRLIDRSASEIVETAKRTGAQVRGPIPLPTKIERYTILVSPHADKDARDQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R +KR+L I+ P  +TVDALMKL++AAGV+V IKL
Sbjct: 65  YETRTHKRVLDIVDPNDKTVDALMKLELAAGVDVQIKL 102


>gi|225873079|ref|YP_002754538.1| ribosomal protein S10 [Acidobacterium capsulatum ATCC 51196]
 gi|259494581|sp|C1F643|RS10_ACIC5 RecName: Full=30S ribosomal protein S10
 gi|225792235|gb|ACO32325.1| ribosomal protein S10 [Acidobacterium capsulatum ATCC 51196]
          Length = 105

 Score =  116 bits (291), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 57/97 (58%), Positives = 75/97 (77%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I LKA+D R+LD+S  EIV T K++G+Q+ GPIP P    ++ V RSPHVDKKSR+ 
Sbjct: 5   RIRIRLKAYDYRVLDTSTGEIVDTAKRTGAQVAGPIPLPTVKNKYCVLRSPHVDKKSREA 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E+R +KRL+ I++PT QTVDALM+LD+ AGV+V IK
Sbjct: 65  FEIRTHKRLIDILEPTQQTVDALMRLDLPAGVDVEIK 101


>gi|171462878|ref|YP_001796991.1| ribosomal protein S10 [Polynucleobacter necessarius subsp.
           necessarius STIR1]
 gi|226705605|sp|B1XSQ0|RS10_POLNS RecName: Full=30S ribosomal protein S10
 gi|171192416|gb|ACB43377.1| ribosomal protein S10 [Polynucleobacter necessarius subsp.
           necessarius STIR1]
          Length = 103

 Score =  116 bits (291), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 75/101 (74%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N +I I LKAFD R++D S  EIV T K++G+ + GP+P P  I RF + RSPHV+K S
Sbjct: 2   QNQKIRIRLKAFDYRLIDQSAAEIVDTAKRTGAVVKGPVPLPTRIERFDILRSPHVNKTS 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQLE+R + RL+ I+ PT +TVDALMKLD+ AGV V IKL
Sbjct: 62  RDQLEIRTHLRLMDIVDPTEKTVDALMKLDLPAGVGVEIKL 102


>gi|254449096|ref|ZP_05062548.1| ribosomal protein S10 [gamma proteobacterium HTCC5015]
 gi|198261288|gb|EDY85581.1| ribosomal protein S10 [gamma proteobacterium HTCC5015]
          Length = 106

 Score =  116 bits (291), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 57/97 (58%), Positives = 75/97 (77%)

Query: 8   ICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQL 67
           I I LKAFD R++D S  EIV T K++G++++GPIP P    R+TV  SPHV+K +RDQ 
Sbjct: 9   IRIRLKAFDHRLIDKSAGEIVETAKRTGARVLGPIPLPTKRERYTVLISPHVNKDARDQY 68

Query: 68  EMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           E+R +KRL+ I+ PT +TVDALMKLD+AAGV+V IKL
Sbjct: 69  EIRTHKRLMDIVDPTDKTVDALMKLDLAAGVDVQIKL 105


>gi|21230363|ref|NP_636280.1| 30S ribosomal protein S10 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66769643|ref|YP_244405.1| 30S ribosomal protein S10 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|188992855|ref|YP_001904865.1| 30S ribosomal protein S10 [Xanthomonas campestris pv. campestris
           str. B100]
 gi|23822078|sp|Q8PC50|RS10_XANCP RecName: Full=30S ribosomal protein S10
 gi|81304402|sp|Q4URD8|RS10_XANC8 RecName: Full=30S ribosomal protein S10
 gi|226708308|sp|B0RU83|RS10_XANCB RecName: Full=30S ribosomal protein S10
 gi|21111919|gb|AAM40204.1| 30S ribosomal protein S10 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66574975|gb|AAY50385.1| 30S ribosomal protein S10 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|167734615|emb|CAP52825.1| 30S ribosomal protein S10 [Xanthomonas campestris pv. campestris]
          Length = 103

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 73/98 (74%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD R++D S  EIV T K++G+Q+ GPIP P  I R+T+  SPH DK +RDQ
Sbjct: 5   KIRIRLKAFDHRLIDRSASEIVETAKRTGAQVRGPIPLPTKIERYTILVSPHADKDARDQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R +KR+L I+ P  +TVDALMKL++AAGV+V IKL
Sbjct: 65  YETRTHKRVLDIVDPNDKTVDALMKLELAAGVDVQIKL 102


>gi|53720822|ref|YP_109808.1| 30S ribosomal protein S10 [Burkholderia pseudomallei K96243]
 gi|53723855|ref|YP_104167.1| 30S ribosomal protein S10 [Burkholderia mallei ATCC 23344]
 gi|67639133|ref|ZP_00438032.1| 30S ribosomal protein S10 [Burkholderia mallei GB8 horse 4]
 gi|76809572|ref|YP_335141.1| 30S ribosomal protein S10 [Burkholderia pseudomallei 1710b]
 gi|78064923|ref|YP_367692.1| 30S ribosomal protein S10 [Burkholderia sp. 383]
 gi|83718578|ref|YP_443573.1| 30S ribosomal protein S10 [Burkholderia thailandensis E264]
 gi|107024304|ref|YP_622631.1| 30S ribosomal protein S10 [Burkholderia cenocepacia AU 1054]
 gi|115350321|ref|YP_772160.1| 30S ribosomal protein S10 [Burkholderia ambifaria AMMD]
 gi|116688371|ref|YP_833994.1| 30S ribosomal protein S10 [Burkholderia cenocepacia HI2424]
 gi|121599013|ref|YP_994457.1| 30S ribosomal protein S10 [Burkholderia mallei SAVP1]
 gi|124383844|ref|YP_001027894.1| 30S ribosomal protein S10 [Burkholderia mallei NCTC 10229]
 gi|126440037|ref|YP_001060751.1| 30S ribosomal protein S10 [Burkholderia pseudomallei 668]
 gi|126450320|ref|YP_001082989.1| 30S ribosomal protein S10 [Burkholderia mallei NCTC 10247]
 gi|126455037|ref|YP_001068035.1| 30S ribosomal protein S10 [Burkholderia pseudomallei 1106a]
 gi|134283342|ref|ZP_01770043.1| 30S ribosomal protein S10 [Burkholderia pseudomallei 305]
 gi|134294442|ref|YP_001118177.1| 30S ribosomal protein S10 [Burkholderia vietnamiensis G4]
 gi|161523428|ref|YP_001578440.1| 30S ribosomal protein S10 [Burkholderia multivorans ATCC 17616]
 gi|167001700|ref|ZP_02267492.1| 30S ribosomal protein S10 [Burkholderia mallei PRL-20]
 gi|167564418|ref|ZP_02357334.1| 30S ribosomal protein S10 [Burkholderia oklahomensis EO147]
 gi|167571564|ref|ZP_02364438.1| 30S ribosomal protein S10 [Burkholderia oklahomensis C6786]
 gi|167582624|ref|ZP_02375498.1| 30S ribosomal protein S10 [Burkholderia thailandensis TXDOH]
 gi|167587773|ref|ZP_02380161.1| 30S ribosomal protein S10 [Burkholderia ubonensis Bu]
 gi|167620738|ref|ZP_02389369.1| 30S ribosomal protein S10 [Burkholderia thailandensis Bt4]
 gi|167721578|ref|ZP_02404814.1| 30S ribosomal protein S10 [Burkholderia pseudomallei DM98]
 gi|167740552|ref|ZP_02413326.1| 30S ribosomal protein S10 [Burkholderia pseudomallei 14]
 gi|167817757|ref|ZP_02449437.1| 30S ribosomal protein S10 [Burkholderia pseudomallei 91]
 gi|167826154|ref|ZP_02457625.1| 30S ribosomal protein S10 [Burkholderia pseudomallei 9]
 gi|167838213|ref|ZP_02465072.1| 30S ribosomal protein S10 [Burkholderia thailandensis MSMB43]
 gi|167847666|ref|ZP_02473174.1| 30S ribosomal protein S10 [Burkholderia pseudomallei B7210]
 gi|167896238|ref|ZP_02483640.1| 30S ribosomal protein S10 [Burkholderia pseudomallei 7894]
 gi|167904620|ref|ZP_02491825.1| 30S ribosomal protein S10 [Burkholderia pseudomallei NCTC 13177]
 gi|167912885|ref|ZP_02499976.1| 30S ribosomal protein S10 [Burkholderia pseudomallei 112]
 gi|167920845|ref|ZP_02507936.1| 30S ribosomal protein S10 [Burkholderia pseudomallei BCC215]
 gi|170700693|ref|ZP_02891688.1| ribosomal protein S10 [Burkholderia ambifaria IOP40-10]
 gi|170731681|ref|YP_001763628.1| 30S ribosomal protein S10 [Burkholderia cenocepacia MC0-3]
 gi|171318347|ref|ZP_02907505.1| ribosomal protein S10 [Burkholderia ambifaria MEX-5]
 gi|172059340|ref|YP_001806992.1| 30S ribosomal protein S10 [Burkholderia ambifaria MC40-6]
 gi|189351799|ref|YP_001947427.1| 30S ribosomal protein S10 [Burkholderia multivorans ATCC 17616]
 gi|206558640|ref|YP_002229400.1| 30S ribosomal protein S10 [Burkholderia cenocepacia J2315]
 gi|217424823|ref|ZP_03456320.1| 30S ribosomal protein S10 [Burkholderia pseudomallei 576]
 gi|221201564|ref|ZP_03574602.1| 30S ribosomal protein S10 [Burkholderia multivorans CGD2M]
 gi|221207361|ref|ZP_03580371.1| 30S ribosomal protein S10 [Burkholderia multivorans CGD2]
 gi|221213499|ref|ZP_03586474.1| 30S ribosomal protein S10 [Burkholderia multivorans CGD1]
 gi|226198260|ref|ZP_03793831.1| 30S ribosomal protein S10 [Burkholderia pseudomallei Pakistan 9]
 gi|237814146|ref|YP_002898597.1| ribosomal protein S10 [Burkholderia pseudomallei MSHR346]
 gi|242317887|ref|ZP_04816903.1| 30S ribosomal protein S10 [Burkholderia pseudomallei 1106b]
 gi|254246598|ref|ZP_04939919.1| Ribosomal protein S10 [Burkholderia cenocepacia PC184]
 gi|254253518|ref|ZP_04946836.1| Ribosomal protein S10 [Burkholderia dolosa AUO158]
 gi|254259045|ref|ZP_04950099.1| 30S ribosomal protein S10 [Burkholderia pseudomallei 1710a]
 gi|257137644|ref|ZP_05585906.1| 30S ribosomal protein S10 [Burkholderia thailandensis E264]
 gi|81604182|sp|Q62GK4|RS10_BURMA RecName: Full=30S ribosomal protein S10
 gi|81607669|sp|Q63Q10|RS10_BURPS RecName: Full=30S ribosomal protein S10
 gi|115305610|sp|Q3JMR2|RS10_BURP1 RecName: Full=30S ribosomal protein S10
 gi|115305611|sp|Q39KG8|RS10_BURS3 RecName: Full=30S ribosomal protein S10
 gi|115305612|sp|Q2SU26|RS10_BURTA RecName: Full=30S ribosomal protein S10
 gi|118597165|sp|Q1BRU7|RS10_BURCA RecName: Full=30S ribosomal protein S10
 gi|122324267|sp|Q0BJ47|RS10_BURCM RecName: Full=30S ribosomal protein S10
 gi|166231246|sp|A0K3M4|RS10_BURCH RecName: Full=30S ribosomal protein S10
 gi|166231247|sp|A3MRV3|RS10_BURM7 RecName: Full=30S ribosomal protein S10
 gi|166231248|sp|A2S7H5|RS10_BURM9 RecName: Full=30S ribosomal protein S10
 gi|166231249|sp|A1V8A4|RS10_BURMS RecName: Full=30S ribosomal protein S10
 gi|166231250|sp|A3P0B4|RS10_BURP0 RecName: Full=30S ribosomal protein S10
 gi|166231251|sp|A3NEI0|RS10_BURP6 RecName: Full=30S ribosomal protein S10
 gi|166231252|sp|A4JAN9|RS10_BURVG RecName: Full=30S ribosomal protein S10
 gi|226705409|sp|B1YRC9|RS10_BURA4 RecName: Full=30S ribosomal protein S10
 gi|226705410|sp|B1JU21|RS10_BURCC RecName: Full=30S ribosomal protein S10
 gi|226705411|sp|B4E5B9|RS10_BURCJ RecName: Full=30S ribosomal protein S10
 gi|226705412|sp|A9ADJ2|RS10_BURM1 RecName: Full=30S ribosomal protein S10
 gi|52211236|emb|CAH37225.1| 30s ribosomal protein S10 [Burkholderia pseudomallei K96243]
 gi|52427278|gb|AAU47871.1| ribosomal protein S10 [Burkholderia mallei ATCC 23344]
 gi|76579025|gb|ABA48500.1| ribosomal protein S10 [Burkholderia pseudomallei 1710b]
 gi|77965668|gb|ABB07048.1| SSU ribosomal protein S10P [Burkholderia sp. 383]
 gi|83652403|gb|ABC36466.1| ribosomal protein S10 [Burkholderia thailandensis E264]
 gi|105894493|gb|ABF77658.1| SSU ribosomal protein S10P [Burkholderia cenocepacia AU 1054]
 gi|115280309|gb|ABI85826.1| SSU ribosomal protein S10P [Burkholderia ambifaria AMMD]
 gi|116646460|gb|ABK07101.1| SSU ribosomal protein S10P [Burkholderia cenocepacia HI2424]
 gi|121227823|gb|ABM50341.1| 30S ribosomal protein S10 [Burkholderia mallei SAVP1]
 gi|124291864|gb|ABN01133.1| 30S ribosomal protein S10 [Burkholderia mallei NCTC 10229]
 gi|124871374|gb|EAY63090.1| Ribosomal protein S10 [Burkholderia cenocepacia PC184]
 gi|124896127|gb|EAY70007.1| Ribosomal protein S10 [Burkholderia dolosa AUO158]
 gi|126219530|gb|ABN83036.1| 30S ribosomal protein S10 [Burkholderia pseudomallei 668]
 gi|126228679|gb|ABN92219.1| 30S ribosomal protein S10 [Burkholderia pseudomallei 1106a]
 gi|126243190|gb|ABO06283.1| 30S ribosomal protein S10 [Burkholderia mallei NCTC 10247]
 gi|134137599|gb|ABO53342.1| SSU ribosomal protein S10P [Burkholderia vietnamiensis G4]
 gi|134245537|gb|EBA45630.1| 30S ribosomal protein S10 [Burkholderia pseudomallei 305]
 gi|160340857|gb|ABX13943.1| ribosomal protein S10 [Burkholderia multivorans ATCC 17616]
 gi|169814923|gb|ACA89506.1| ribosomal protein S10 [Burkholderia cenocepacia MC0-3]
 gi|170134363|gb|EDT02696.1| ribosomal protein S10 [Burkholderia ambifaria IOP40-10]
 gi|171096425|gb|EDT41324.1| ribosomal protein S10 [Burkholderia ambifaria MEX-5]
 gi|171991857|gb|ACB62776.1| ribosomal protein S10 [Burkholderia ambifaria MC40-6]
 gi|189335821|dbj|BAG44891.1| small subunit ribosomal protein S10 [Burkholderia multivorans ATCC
           17616]
 gi|198034677|emb|CAR50544.1| 30s ribosomal protein S10 [Burkholderia cenocepacia J2315]
 gi|217392279|gb|EEC32304.1| 30S ribosomal protein S10 [Burkholderia pseudomallei 576]
 gi|221166951|gb|EED99422.1| 30S ribosomal protein S10 [Burkholderia multivorans CGD1]
 gi|221172949|gb|EEE05386.1| 30S ribosomal protein S10 [Burkholderia multivorans CGD2]
 gi|221178380|gb|EEE10789.1| 30S ribosomal protein S10 [Burkholderia multivorans CGD2M]
 gi|225929780|gb|EEH25796.1| 30S ribosomal protein S10 [Burkholderia pseudomallei Pakistan 9]
 gi|237506741|gb|ACQ99059.1| ribosomal protein S10 [Burkholderia pseudomallei MSHR346]
 gi|238519677|gb|EEP83146.1| 30S ribosomal protein S10 [Burkholderia mallei GB8 horse 4]
 gi|242141126|gb|EES27528.1| 30S ribosomal protein S10 [Burkholderia pseudomallei 1106b]
 gi|243062597|gb|EES44783.1| 30S ribosomal protein S10 [Burkholderia mallei PRL-20]
 gi|254217734|gb|EET07118.1| 30S ribosomal protein S10 [Burkholderia pseudomallei 1710a]
 gi|325529677|gb|EGD06540.1| 30S ribosomal protein S10 [Burkholderia sp. TJI49]
          Length = 103

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 76/98 (77%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD R++D S  EIV T K++G+ + GP+P P  I+RF + RSPHV+K SRDQ
Sbjct: 5   KIRIRLKAFDYRLIDQSAAEIVDTAKRTGAIVRGPVPLPTRIQRFDILRSPHVNKTSRDQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           LE+R ++RL+ I+ PT +TVDALMKLD+ AGV+V IKL
Sbjct: 65  LEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKL 102


>gi|238025931|ref|YP_002910162.1| 30S ribosomal protein S10 [Burkholderia glumae BGR1]
 gi|330815248|ref|YP_004358953.1| 30S ribosomal protein S10 [Burkholderia gladioli BSR3]
 gi|237875125|gb|ACR27458.1| 30S ribosomal protein S10 [Burkholderia glumae BGR1]
 gi|327367641|gb|AEA58997.1| 30S ribosomal protein S10 [Burkholderia gladioli BSR3]
          Length = 103

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 76/98 (77%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD R++D S  EIV T K++G+ + GP+P P  I+RF + RSPHV+K SRDQ
Sbjct: 5   KIRIRLKAFDYRLIDQSAAEIVDTAKRTGAIVRGPVPLPTRIQRFDILRSPHVNKTSRDQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           LE+R ++RL+ I+ PT +TVDALMKLD+ AGV+V IKL
Sbjct: 65  LEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKL 102


>gi|258513639|ref|YP_003189861.1| 30S ribosomal protein S10 [Desulfotomaculum acetoxidans DSM 771]
 gi|257777344|gb|ACV61238.1| ribosomal protein S10 [Desulfotomaculum acetoxidans DSM 771]
          Length = 102

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 78/101 (77%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N +I I LKA+D  +LD S ++IV T K++G+Q+ GPIP P     +T+ RSPHV+K S
Sbjct: 2   KNQKIRIRLKAYDHFMLDQSAKKIVETAKRTGAQVAGPIPLPTEKNIYTILRSPHVNKDS 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           R+Q EMR +KRL+ I++PTP+TVD+LM+LD+ AGV++ IKL
Sbjct: 62  REQFEMRTHKRLIDILEPTPKTVDSLMRLDLPAGVDIEIKL 102


>gi|330430105|gb|AEC21439.1| 30S ribosomal protein S10 [Pusillimonas sp. T7-7]
          Length = 103

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 76/101 (75%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N +I I LKAFD +++D S  EIV T K++G+ + GP+P P  IRR+ V RSPHV+K S
Sbjct: 2   KNQKIRIRLKAFDYKLIDQSAAEIVETAKRTGAVVRGPVPLPTRIRRYDVLRSPHVNKTS 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ EMR ++RL+ I+ PT +TVDALM+LD+ AGV+V I L
Sbjct: 62  RDQFEMRTHQRLMDIVDPTDKTVDALMRLDLPAGVDVEIAL 102


>gi|325981804|ref|YP_004294206.1| 30S ribosomal protein S10 [Nitrosomonas sp. AL212]
 gi|325531323|gb|ADZ26044.1| ribosomal protein S10 [Nitrosomonas sp. AL212]
          Length = 102

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 75/101 (74%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N +I I LKAFD R++D S  EIV T K++G+ + GPIP P  I RF V RSPHV+K S
Sbjct: 2   QNQKIRIRLKAFDYRLIDKSAIEIVETAKRTGAVVKGPIPLPTKIERFDVLRSPHVNKTS 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R + RL+ II PT +TVDALMKLD+ AGV+V IKL
Sbjct: 62  RDQFEIRTHLRLMDIIDPTDKTVDALMKLDLPAGVDVEIKL 102


>gi|56477593|ref|YP_159182.1| 30S ribosomal protein S10 [Aromatoleum aromaticum EbN1]
 gi|81598744|sp|Q5P333|RS10_AZOSE RecName: Full=30S ribosomal protein S10
 gi|56313636|emb|CAI08281.1| 30S Ribosomal protein S10 [Aromatoleum aromaticum EbN1]
          Length = 103

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 76/101 (75%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N +I I LKAFD R++D S  EIV T K++G+ + GP+P P  I RF + RSPHV+K S
Sbjct: 2   QNQKIRIRLKAFDYRLIDQSALEIVDTAKRTGAVVRGPVPLPTRIERFDLLRSPHVNKAS 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R ++RL+ II PT +TVDALMKLD+ AGV+V IKL
Sbjct: 62  RDQFEIRTHQRLMDIIDPTDKTVDALMKLDLPAGVDVEIKL 102


>gi|54778763|gb|AAV39597.1| ribosomal protein S10 [synthetic construct]
          Length = 130

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 57/102 (55%), Positives = 77/102 (75%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           ++N RI I LKAFD R++D +  EIV T K++G+Q+ GPIP P    RFTV  SPHV+K 
Sbjct: 25  TQNQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKD 84

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +RDQ E+R + RL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 85  ARDQYEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISL 126


>gi|149922211|ref|ZP_01910649.1| ribosomal protein S10 [Plesiocystis pacifica SIR-1]
 gi|149816951|gb|EDM76436.1| ribosomal protein S10 [Plesiocystis pacifica SIR-1]
          Length = 101

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 53/97 (54%), Positives = 75/97 (77%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           ++ I LKA+D ++L+ S  EI  T +++G+Q+VGPIP P  I ++TV R P +DKKSR+Q
Sbjct: 4   KLRITLKAYDHKLLEQSATEISETARRAGAQVVGPIPLPTKINKYTVLRGPFIDKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E+R +KRLL II+P  QT+DALMKLD++AGV+V IK
Sbjct: 64  FEIRTHKRLLDIIEPNQQTLDALMKLDLSAGVDVEIK 100


>gi|149928578|ref|ZP_01916800.1| 30S ribosomal protein S10 [Limnobacter sp. MED105]
 gi|149822703|gb|EDM81968.1| 30S ribosomal protein S10 [Limnobacter sp. MED105]
          Length = 103

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 76/100 (76%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKAFD +++D S  EIV T K++G+ + GP+P P  I+RF + RSPHV+K SR
Sbjct: 3   NQKIRIRLKAFDYKLIDQSALEIVETAKRTGAVVKGPVPLPTRIKRFDILRSPHVNKSSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           DQ E+R ++RL+ I+ PT +TVDALMKLD+ AGV+V IKL
Sbjct: 63  DQFEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKL 102


>gi|262197189|ref|YP_003268398.1| ribosomal protein S10 [Haliangium ochraceum DSM 14365]
 gi|262080536|gb|ACY16505.1| ribosomal protein S10 [Haliangium ochraceum DSM 14365]
          Length = 102

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 55/97 (56%), Positives = 75/97 (77%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I LKA+D  +LD S  EIV T +++G+++ GPIP P  I ++ V RSPH DKKSR+Q
Sbjct: 5   RIRIRLKAYDHGLLDQSASEIVETARRTGAKVAGPIPLPTKINKYCVLRSPHGDKKSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E+R +KRLL I++PT QT+DALMKLD++AGV+V I+
Sbjct: 65  FEIRTHKRLLDILEPTQQTLDALMKLDLSAGVDVEIR 101


>gi|296131835|ref|YP_003639082.1| ribosomal protein S10 [Thermincola sp. JR]
 gi|296030413|gb|ADG81181.1| ribosomal protein S10 [Thermincola potens JR]
          Length = 102

 Score =  115 bits (289), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 56/104 (53%), Positives = 79/104 (75%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M+ + IRI   LKA+D +ILD S  +IV T K++G+ + GP+P P     +T+ RSPHV+
Sbjct: 1   MSKQKIRIR--LKAYDHKILDQSAEKIVDTAKRTGAGVAGPVPLPTEKSIYTILRSPHVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+Q EMRI+KRL+ I++PTP+TVDALM+LD+ AGV++ IKL
Sbjct: 59  KDSREQFEMRIHKRLIDILEPTPKTVDALMRLDLPAGVDIEIKL 102


>gi|332041522|gb|EGI77882.1| 30S ribosomal protein S10 [Hylemonella gracilis ATCC 19624]
          Length = 104

 Score =  115 bits (289), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 76/98 (77%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD +++D S  EIV T K++G+ + GP+P P  ++RF + RSPHV+K SRDQ
Sbjct: 6   KIRIRLKAFDYKLIDQSAAEIVDTAKRTGAIVKGPVPLPTRMKRFDILRSPHVNKTSRDQ 65

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R ++RL+ I+ PT +TVDALMKLD+AAGV+V IKL
Sbjct: 66  FEIRTHQRLMDIVDPTDKTVDALMKLDLAAGVDVEIKL 103


>gi|134096322|ref|YP_001101397.1| 30S ribosomal protein S10 [Herminiimonas arsenicoxydans]
 gi|133740225|emb|CAL63276.1| 30S ribosomal subunit protein S10 [Herminiimonas arsenicoxydans]
          Length = 110

 Score =  115 bits (289), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 75/100 (75%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKAFD R++D S  EIV T K++G+ + GP+P P  I+RF V RSPHV+K SR
Sbjct: 10  NQKIRIRLKAFDYRLIDQSALEIVETAKRTGAVVKGPVPLPTRIQRFDVLRSPHVNKTSR 69

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           DQ E+R + RL+ I+ PT +TVDALMKLD+ AGV+V IKL
Sbjct: 70  DQFEIRTHVRLMDIVDPTDKTVDALMKLDLPAGVDVEIKL 109


>gi|114330573|ref|YP_746795.1| 30S ribosomal protein S10 [Nitrosomonas eutropha C91]
 gi|122314433|sp|Q0AIJ6|RS10_NITEC RecName: Full=30S ribosomal protein S10
 gi|114307587|gb|ABI58830.1| SSU ribosomal protein S10P [Nitrosomonas eutropha C91]
          Length = 102

 Score =  115 bits (289), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 75/101 (74%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N +I I LKAFD R++D S  EIV T K++G+ + GP+P P  I RF V RSPHV+K S
Sbjct: 2   QNQKIRIRLKAFDYRLIDKSAVEIVETAKRTGAVVKGPVPLPTRIERFDVLRSPHVNKTS 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R + RL+ II PT +TVDALMKLD+ AGV+V IKL
Sbjct: 62  RDQFEIRTHLRLMDIIDPTDKTVDALMKLDLPAGVDVEIKL 102


>gi|15803848|ref|NP_289882.1| 30S ribosomal protein S10 [Escherichia coli O157:H7 EDL933]
 gi|15833440|ref|NP_312213.1| 30S ribosomal protein S10 [Escherichia coli O157:H7 str. Sakai]
 gi|16131200|ref|NP_417780.1| 30S ribosomal subunit protein S10 [Escherichia coli str. K-12
           substr. MG1655]
 gi|24114599|ref|NP_709109.1| 30S ribosomal protein S10 [Shigella flexneri 2a str. 301]
 gi|26249916|ref|NP_755956.1| 30S ribosomal protein S10 [Escherichia coli CFT073]
 gi|30065378|ref|NP_839549.1| 30S ribosomal protein S10 [Shigella flexneri 2a str. 2457T]
 gi|74313840|ref|YP_312259.1| 30S ribosomal protein S10 [Shigella sonnei Ss046]
 gi|82545684|ref|YP_409631.1| 30S ribosomal protein S10 [Shigella boydii Sb227]
 gi|82778617|ref|YP_404966.1| 30S ribosomal protein S10 [Shigella dysenteriae Sd197]
 gi|89110689|ref|AP_004469.1| 30S ribosomal subunit protein S10 [Escherichia coli str. K-12
           substr. W3110]
 gi|91212758|ref|YP_542744.1| 30S ribosomal protein S10 [Escherichia coli UTI89]
 gi|110643560|ref|YP_671290.1| 30S ribosomal protein S10 [Escherichia coli 536]
 gi|110807168|ref|YP_690688.1| 30S ribosomal protein S10 [Shigella flexneri 5 str. 8401]
 gi|117625599|ref|YP_858922.1| 30S ribosomal protein S10 [Escherichia coli APEC O1]
 gi|157159214|ref|YP_001464789.1| 30S ribosomal protein S10 [Escherichia coli E24377A]
 gi|157162795|ref|YP_001460113.1| 30S ribosomal protein S10 [Escherichia coli HS]
 gi|168753089|ref|ZP_02778096.1| ribosomal protein S10 [Escherichia coli O157:H7 str. EC4401]
 gi|168765495|ref|ZP_02790502.1| ribosomal protein S10 [Escherichia coli O157:H7 str. EC4501]
 gi|168769187|ref|ZP_02794194.1| ribosomal protein S10 [Escherichia coli O157:H7 str. EC4486]
 gi|168785140|ref|ZP_02810147.1| ribosomal protein S10 [Escherichia coli O157:H7 str. EC869]
 gi|170018443|ref|YP_001723397.1| 30S ribosomal protein S10 [Escherichia coli ATCC 8739]
 gi|170082840|ref|YP_001732160.1| 30S ribosomal subunit protein S10 [Escherichia coli str. K-12
           substr. DH10B]
 gi|170683626|ref|YP_001745583.1| 30S ribosomal protein S10 [Escherichia coli SMS-3-5]
 gi|170769552|ref|ZP_02904005.1| ribosomal protein S10 [Escherichia albertii TW07627]
 gi|187733990|ref|YP_001882005.1| 30S ribosomal protein S10 [Shigella boydii CDC 3083-94]
 gi|188494606|ref|ZP_03001876.1| ribosomal protein S10 [Escherichia coli 53638]
 gi|191171522|ref|ZP_03033070.1| ribosomal protein S10 [Escherichia coli F11]
 gi|194439980|ref|ZP_03072039.1| ribosomal protein S10 [Escherichia coli 101-1]
 gi|195939870|ref|ZP_03085252.1| 30S ribosomal protein S10 [Escherichia coli O157:H7 str. EC4024]
 gi|208806946|ref|ZP_03249283.1| ribosomal protein S10 [Escherichia coli O157:H7 str. EC4206]
 gi|208812581|ref|ZP_03253910.1| ribosomal protein S10 [Escherichia coli O157:H7 str. EC4045]
 gi|208821315|ref|ZP_03261635.1| ribosomal protein S10 [Escherichia coli O157:H7 str. EC4042]
 gi|209399386|ref|YP_002272777.1| ribosomal protein S10 [Escherichia coli O157:H7 str. EC4115]
 gi|209920787|ref|YP_002294871.1| 30S ribosomal protein S10 [Escherichia coli SE11]
 gi|215488621|ref|YP_002331052.1| 30S ribosomal protein S10 [Escherichia coli O127:H6 str. E2348/69]
 gi|217324897|ref|ZP_03440981.1| ribosomal protein S10 [Escherichia coli O157:H7 str. TW14588]
 gi|218555878|ref|YP_002388791.1| 30S ribosomal protein S10 [Escherichia coli IAI1]
 gi|218560382|ref|YP_002393295.1| 30S ribosomal protein S10 [Escherichia coli S88]
 gi|218691607|ref|YP_002399819.1| 30S ribosomal protein S10 [Escherichia coli ED1a]
 gi|218697013|ref|YP_002404680.1| 30S ribosomal protein S10 [Escherichia coli 55989]
 gi|218702083|ref|YP_002409712.1| 30S ribosomal protein S10 [Escherichia coli IAI39]
 gi|218706928|ref|YP_002414447.1| 30S ribosomal protein S10 [Escherichia coli UMN026]
 gi|227883452|ref|ZP_04001257.1| 30S ribosomal protein S10 [Escherichia coli 83972]
 gi|237703051|ref|ZP_04533532.1| ribosomal protein S10 [Escherichia sp. 3_2_53FAA]
 gi|238902412|ref|YP_002928208.1| 30S ribosomal subunit protein S10 [Escherichia coli BW2952]
 gi|253771855|ref|YP_003034686.1| 30S ribosomal protein S10 [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|254038482|ref|ZP_04872538.1| ribosomal protein S10 [Escherichia sp. 1_1_43]
 gi|254163249|ref|YP_003046357.1| 30S ribosomal protein S10 [Escherichia coli B str. REL606]
 gi|254795258|ref|YP_003080095.1| 30S ribosomal protein S10 [Escherichia coli O157:H7 str. TW14359]
 gi|256020680|ref|ZP_05434545.1| 30S ribosomal protein S10 [Shigella sp. D9]
 gi|256025951|ref|ZP_05439816.1| 30S ribosomal protein S10 [Escherichia sp. 4_1_40B]
 gi|260846119|ref|YP_003223897.1| 30S ribosomal subunit protein S10 [Escherichia coli O103:H2 str.
           12009]
 gi|260857442|ref|YP_003231333.1| 30S ribosomal subunit protein S10 [Escherichia coli O26:H11 str.
           11368]
 gi|260870064|ref|YP_003236466.1| 30S ribosomal subunit protein S10 [Escherichia coli O111:H- str.
           11128]
 gi|261224626|ref|ZP_05938907.1| 30S ribosomal subunit protein S10 [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261254480|ref|ZP_05947013.1| 30S ribosomal subunit protein S10 [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291284679|ref|YP_003501497.1| Ribosomal protein S10 [Escherichia coli O55:H7 str. CB9615]
 gi|293406918|ref|ZP_06650842.1| rps10 [Escherichia coli FVEC1412]
 gi|293412740|ref|ZP_06655408.1| 30S ribosomal protein S10 [Escherichia coli B354]
 gi|293416738|ref|ZP_06659375.1| 30S ribosomal protein S10 [Escherichia coli B185]
 gi|293453639|ref|ZP_06664058.1| 30S ribosomal protein S10 [Escherichia coli B088]
 gi|297516595|ref|ZP_06934981.1| 30S ribosomal protein S10 [Escherichia coli OP50]
 gi|298382658|ref|ZP_06992253.1| 30S ribosomal protein S10 [Escherichia coli FVEC1302]
 gi|300815469|ref|ZP_07095694.1| ribosomal protein S10 [Escherichia coli MS 107-1]
 gi|300822876|ref|ZP_07103012.1| ribosomal protein S10 [Escherichia coli MS 119-7]
 gi|300896669|ref|ZP_07115185.1| ribosomal protein S10 [Escherichia coli MS 198-1]
 gi|300903569|ref|ZP_07121491.1| ribosomal protein S10 [Escherichia coli MS 84-1]
 gi|300918294|ref|ZP_07134898.1| ribosomal protein S10 [Escherichia coli MS 115-1]
 gi|300921870|ref|ZP_07138026.1| ribosomal protein S10 [Escherichia coli MS 182-1]
 gi|300932214|ref|ZP_07147493.1| ribosomal protein S10 [Escherichia coli MS 187-1]
 gi|300935319|ref|ZP_07150329.1| ribosomal protein S10 [Escherichia coli MS 21-1]
 gi|300946543|ref|ZP_07160808.1| ribosomal protein S10 [Escherichia coli MS 116-1]
 gi|300954804|ref|ZP_07167231.1| ribosomal protein S10 [Escherichia coli MS 175-1]
 gi|300974000|ref|ZP_07172407.1| ribosomal protein S10 [Escherichia coli MS 200-1]
 gi|300979892|ref|ZP_07174768.1| ribosomal protein S10 [Escherichia coli MS 45-1]
 gi|301018815|ref|ZP_07183059.1| ribosomal protein S10 [Escherichia coli MS 69-1]
 gi|301021129|ref|ZP_07185169.1| ribosomal protein S10 [Escherichia coli MS 196-1]
 gi|301046092|ref|ZP_07193270.1| ribosomal protein S10 [Escherichia coli MS 185-1]
 gi|301305530|ref|ZP_07211622.1| ribosomal protein S10 [Escherichia coli MS 124-1]
 gi|301325112|ref|ZP_07218646.1| ribosomal protein S10 [Escherichia coli MS 78-1]
 gi|301643859|ref|ZP_07243890.1| ribosomal protein S10 [Escherichia coli MS 146-1]
 gi|306816336|ref|ZP_07450474.1| 30S ribosomal protein S10 [Escherichia coli NC101]
 gi|307140004|ref|ZP_07499360.1| 30S ribosomal protein S10 [Escherichia coli H736]
 gi|307315100|ref|ZP_07594683.1| ribosomal protein S10 [Escherichia coli W]
 gi|309785643|ref|ZP_07680274.1| ribosomal protein S10 [Shigella dysenteriae 1617]
 gi|309794596|ref|ZP_07689018.1| ribosomal protein S10 [Escherichia coli MS 145-7]
 gi|312968354|ref|ZP_07782564.1| ribosomal protein S10 [Escherichia coli 2362-75]
 gi|312972418|ref|ZP_07786592.1| ribosomal protein S10 [Escherichia coli 1827-70]
 gi|331644017|ref|ZP_08345146.1| ribosomal protein S10 [Escherichia coli H736]
 gi|331649118|ref|ZP_08350204.1| ribosomal protein S10 [Escherichia coli M605]
 gi|331654914|ref|ZP_08355913.1| ribosomal protein S10 [Escherichia coli M718]
 gi|331659611|ref|ZP_08360549.1| ribosomal protein S10 [Escherichia coli TA206]
 gi|331664934|ref|ZP_08365835.1| ribosomal protein S10 [Escherichia coli TA143]
 gi|331670150|ref|ZP_08370989.1| ribosomal protein S10 [Escherichia coli TA271]
 gi|331674822|ref|ZP_08375579.1| ribosomal protein S10 [Escherichia coli TA280]
 gi|331679390|ref|ZP_08380060.1| ribosomal protein S10 [Escherichia coli H591]
 gi|331684963|ref|ZP_08385549.1| ribosomal protein S10 [Escherichia coli H299]
 gi|67472352|sp|P0A7R5|RS10_ECOLI RecName: Full=30S ribosomal protein S10
 gi|67472353|sp|P0A7R6|RS10_ECOL6 RecName: Full=30S ribosomal protein S10
 gi|67472354|sp|P0A7R7|RS10_ECO57 RecName: Full=30S ribosomal protein S10
 gi|67472357|sp|P0A7R8|RS10_SHIFL RecName: Full=30S ribosomal protein S10
 gi|118597176|sp|Q0TCE0|RS10_ECOL5 RecName: Full=30S ribosomal protein S10
 gi|118597177|sp|Q1R601|RS10_ECOUT RecName: Full=30S ribosomal protein S10
 gi|118597318|sp|Q31VV5|RS10_SHIBS RecName: Full=30S ribosomal protein S10
 gi|118597319|sp|Q32B30|RS10_SHIDS RecName: Full=30S ribosomal protein S10
 gi|118597320|sp|Q3YWT8|RS10_SHISS RecName: Full=30S ribosomal protein S10
 gi|123047857|sp|Q0SZY2|RS10_SHIF8 RecName: Full=30S ribosomal protein S10
 gi|166231268|sp|A1AGK8|RS10_ECOK1 RecName: Full=30S ribosomal protein S10
 gi|166991566|sp|A7ZSL0|RS10_ECO24 RecName: Full=30S ribosomal protein S10
 gi|166991567|sp|A8A5C6|RS10_ECOHS RecName: Full=30S ribosomal protein S10
 gi|189040371|sp|B1IPX8|RS10_ECOLC RecName: Full=30S ribosomal protein S10
 gi|226705436|sp|B7MCT6|RS10_ECO45 RecName: Full=30S ribosomal protein S10
 gi|226705437|sp|B5YTP2|RS10_ECO5E RecName: Full=30S ribosomal protein S10
 gi|226705438|sp|B7NLP0|RS10_ECO7I RecName: Full=30S ribosomal protein S10
 gi|226705439|sp|B7M1N5|RS10_ECO8A RecName: Full=30S ribosomal protein S10
 gi|226705440|sp|B1X6H2|RS10_ECODH RecName: Full=30S ribosomal protein S10
 gi|226705441|sp|B7NDU2|RS10_ECOLU RecName: Full=30S ribosomal protein S10
 gi|226705442|sp|B6I235|RS10_ECOSE RecName: Full=30S ribosomal protein S10
 gi|226705443|sp|B1LHD5|RS10_ECOSM RecName: Full=30S ribosomal protein S10
 gi|226705626|sp|B2U2T9|RS10_SHIB3 RecName: Full=30S ribosomal protein S10
 gi|254809586|sp|B7N1A5|RS10_ECO81 RecName: Full=30S ribosomal protein S10
 gi|254809587|sp|B7L4L0|RS10_ECO55 RecName: Full=30S ribosomal protein S10
 gi|254809588|sp|B7UK45|RS10_ECO27 RecName: Full=30S ribosomal protein S10
 gi|259494589|sp|C4ZUH6|RS10_ECOBW RecName: Full=30S ribosomal protein S10
 gi|33357887|pdb|1P6G|J Chain J, Real Space Refined Coordinates Of The 30s Subunit Fitted
           Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp
           State Of E. Coli 70s Ribosome
 gi|33357964|pdb|1P87|J Chain J, Real Space Refined Coordinates Of The 30s Subunit Fitted
           Into The Low Resolution Cryo-Em Map Of The
           Initiation-Like State Of E. Coli 70s Ribosome
 gi|83754048|pdb|2AVY|J Chain J, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli At 3.5 A Resolution. This File Contains
           The 30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 gi|83754104|pdb|2AW7|J Chain J, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli At 3.5 A Resolution. This File Contains
           The 30s Subunit Of The Second 70s Ribosome. The Entire
           Crystal Structure Contains Two 70s Ribosomes And Is
           Described In Remark 400.
 gi|116666557|pdb|1VS5|J Chain J, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With The Antibiotic
           Kasugamyin At 3.5a Resolution. This File Contains The
           30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 gi|116666609|pdb|1VS7|J Chain J, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With The Antibiotic
           Kasugamyin At 3.5a Resolution. This File Contains The
           30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 gi|118138062|pdb|2I2P|J Chain J, Crystal Structure Of Ribosome With Messenger Rna And The
           Anticodon Stem-Loop Of P-Site Trna. This File Contains
           The 30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 gi|118138133|pdb|2I2U|J Chain J, Crystal Structure Of Ribosome With Messenger Rna And The
           Anticodon Stem-Loop Of P-Site Trna. This File Contains
           The 30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 gi|157836032|pdb|2QOU|J Chain J, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin. This
           File Contains The 30s Subunit Of The First 70s Ribosome,
           With Spectinomycin Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes.
 gi|157836091|pdb|2QOW|J Chain J, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin. This
           File Contains The 30s Subunit Of The Second 70s
           Ribosome, With Spectinomycin Bound. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 gi|157836136|pdb|2QOY|J Chain J, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin And
           Neomycin. This File Contains The 30s Subunit Of The
           First 70s Ribosome, With Spectinomycin And Neomycin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes.
 gi|157836195|pdb|2QP0|J Chain J, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin And
           Neomycin. This File Contains The 30s Subunit Of The
           Second 70s Ribosome, With Spectinomycin And Neomycin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes.
 gi|158429707|pdb|2QAL|J Chain J, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Neomycin. This File
           Contains The 30s Subunit Of The First 70s Ribosome, With
           Neomycin Bound. The Entire Crystal Structure Contains
           Two 70s Ribosomes And Is Described In Remark 400.
 gi|158429759|pdb|2QAN|J Chain J, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Neomycin. This File
           Contains The 30s Subunit Of The Second 70s Ribosome,
           With Neomycin Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 gi|158429817|pdb|2QB9|J Chain J, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin. This File
           Contains The 30s Subunit Of The First 70s Ribosome, With
           Gentamicin Bound. The Entire Crystal Structure Contains
           Two 70s Ribosomes And Is Described In Remark 400.
 gi|158429869|pdb|2QBB|J Chain J, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin. This File
           Contains The 30s Subunit Of The Second 70s Ribosome,
           With Gentamicin Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 gi|158429921|pdb|2QBD|J Chain J, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Ribosome Recycling
           Factor (Rrf). This File Contains The 30s Subunit Of The
           First 70s Ribosome. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 gi|158429973|pdb|2QBF|J Chain J, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Ribosome Recycling
           Factor (Rrf). This File Contains The 30s Subunit Of The
           Second 70s Ribosome. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 gi|158430027|pdb|2QBH|J Chain J, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin And Ribosome
           Recycling Factor (Rrf). This File Contains The 30s
           Subunit Of The First 70s Ribosome, With Gentamicin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 gi|158430080|pdb|2QBJ|J Chain J, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin And Ribosome
           Recycling Factor (Rrf). This File Contains The 30s
           Subunit Of The Second 70s Ribosome, With Gentamicin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 gi|158431380|pdb|2Z4K|J Chain J, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Paromomycin And
           Ribosome Recycling Factor (Rrf). This File Contains The
           30s Subunit Of The First 70s Ribosome, With Paromomycin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 gi|158431433|pdb|2Z4M|J Chain J, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Paromomycin And
           Ribosome Recycling Factor (Rrf). This File Contains The
           30s Subunit Of The Second 70s Ribosome, With Paromomycin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 gi|168988797|pdb|2VHO|J Chain J, Structure Of Pdf Binding Helix In Complex With The
           Ribosome (Part 3 Of 4)
 gi|168988818|pdb|2VHP|J Chain J, Structure Of Pdf Binding Helix In Complex With The
           Ribosome (Part 4 Of 4)
 gi|197107287|pdb|3DF1|J Chain J, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Hygromycin B. This File
           Contains The 30s Subunit Of The First 70s Ribosome, With
           Hygromycin B Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes.
 gi|197107339|pdb|3DF3|J Chain J, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Hygromycin B. This File
           Contains The 30s Subunit Of The Second 70s Ribosome,
           With Hygromycin B Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes.
 gi|256032372|pdb|3E1A|X Chain X, Structure Of The 30s Subunit And The Trnas Of E. Coli
           Ribosome In Pre-Accommodation State
 gi|256032429|pdb|3E1C|X Chain X, Structure Of The 30s Subunit And The Trnas Of E. Coli
           Ribosome In Post-Accommodation State
 gi|257097331|pdb|3I1M|J Chain J, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|257097383|pdb|3I1O|J Chain J, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|257097435|pdb|3I1Q|J Chain J, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|257097489|pdb|3I1S|J Chain J, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|257097543|pdb|3I1Z|J Chain J, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|257097598|pdb|3I21|J Chain J, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|290560316|pdb|3KC4|J Chain J, Ribosome-Secy Complex. This Entry 3kc4 Contains 30s
           Ribosomal Subnit. The 50s Ribosomal Subunit Can Be Found
           In Pdb Entry 3kcr
 gi|308198696|pdb|3OR9|J Chain J, Crystal Structure Of The E. Coli Ribosome Bound To
           Cem-101. This File Contains The 30s Subunit Of The First
           70s Ribosome.
 gi|308198717|pdb|3ORA|J Chain J, Crystal Structure Of The E. Coli Ribosome Bound To
           Cem-101. This File Contains The 30s Subunit Of The
           Second 70s Ribosome.
 gi|326634288|pdb|3IZV|N Chain N, Structural Insights Into Cognate Vs. Near-Cognate
           Discrimination During Decoding. This Entry Contains The
           Small Subunit Of A Ribosome Programmed With A
           Near-Cognate Codon, AT-Site Trna, P-Site Trna, Mrna And
           Ef-Tu
 gi|326634313|pdb|3IZW|N Chain N, Structural Insights Into Cognate Vs. Near-Cognate
           Discrimination During Decoding.This Entry Contains The
           Small Subunit Of A Ribosome Programmed With A Cognate
           Codon, AT-Site Trna, P-Site Trna, Mrna And Ef-Tu
 gi|329666001|pdb|3J00|J Chain J, Structure Of The Ribosome-Secye Complex In The Membrane
           Environment
 gi|12517953|gb|AAG58442.1|AE005557_11 30S ribosomal subunit protein S10 [Escherichia coli O157:H7 str.
           EDL933]
 gi|26110344|gb|AAN82530.1|AE016767_290 30S ribosomal protein S10 [Escherichia coli CFT073]
 gi|42826|emb|CAA26459.1| unnamed protein product [Escherichia coli]
 gi|42857|emb|CAA23633.1| ribosomal protein S10 [Escherichia coli]
 gi|606255|gb|AAA58118.1| 30S ribosomal subunit protein S10 [Escherichia coli str. K-12
           substr. MG1655]
 gi|1789717|gb|AAC76346.1| 30S ribosomal subunit protein S10 [Escherichia coli str. K-12
           substr. MG1655]
 gi|13363659|dbj|BAB37609.1| 30S ribosomal subunit protein S10 [Escherichia coli O157:H7 str.
           Sakai]
 gi|15027053|emb|CAC44765.1| N utilisation substance protein E-S10 [Expression vector
           pNCO113-nusB/nusE]
 gi|24053797|gb|AAN44816.1| 30S ribosomal subunit protein S10 [Shigella flexneri 2a str. 301]
 gi|30043640|gb|AAP19360.1| 30S ribosomal subunit protein S10 [Shigella flexneri 2a str. 2457T]
 gi|73857317|gb|AAZ90024.1| 30S ribosomal subunit protein S10 [Shigella sonnei Ss046]
 gi|81242765|gb|ABB63475.1| 30S ribosomal subunit protein S10 [Shigella dysenteriae Sd197]
 gi|81247095|gb|ABB67803.1| 30S ribosomal subunit protein S10 [Shigella boydii Sb227]
 gi|85676720|dbj|BAE77970.1| 30S ribosomal subunit protein S10 [Escherichia coli str. K12
           substr. W3110]
 gi|91074332|gb|ABE09213.1| 30S ribosomal subunit protein S10 [Escherichia coli UTI89]
 gi|110345152|gb|ABG71389.1| 30S ribosomal protein S10 [Escherichia coli 536]
 gi|110616716|gb|ABF05383.1| 30S ribosomal subunit protein S10 [Shigella flexneri 5 str. 8401]
 gi|115514723|gb|ABJ02798.1| 30S ribosomal subunit protein S10 [Escherichia coli APEC O1]
 gi|157068475|gb|ABV07730.1| ribosomal protein S10 [Escherichia coli HS]
 gi|157081244|gb|ABV20952.1| ribosomal protein S10 [Escherichia coli E24377A]
 gi|169753371|gb|ACA76070.1| ribosomal protein S10 [Escherichia coli ATCC 8739]
 gi|169890675|gb|ACB04382.1| 30S ribosomal subunit protein S10 [Escherichia coli str. K-12
           substr. DH10B]
 gi|170121609|gb|EDS90540.1| ribosomal protein S10 [Escherichia albertii TW07627]
 gi|170521344|gb|ACB19522.1| ribosomal protein S10 [Escherichia coli SMS-3-5]
 gi|187430982|gb|ACD10256.1| ribosomal protein S10 [Shigella boydii CDC 3083-94]
 gi|188489805|gb|EDU64908.1| ribosomal protein S10 [Escherichia coli 53638]
 gi|189358818|gb|EDU77237.1| ribosomal protein S10 [Escherichia coli O157:H7 str. EC4401]
 gi|189361781|gb|EDU80200.1| ribosomal protein S10 [Escherichia coli O157:H7 str. EC4486]
 gi|189364837|gb|EDU83253.1| ribosomal protein S10 [Escherichia coli O157:H7 str. EC4501]
 gi|189374348|gb|EDU92764.1| ribosomal protein S10 [Escherichia coli O157:H7 str. EC869]
 gi|190908149|gb|EDV67740.1| ribosomal protein S10 [Escherichia coli F11]
 gi|194421088|gb|EDX37116.1| ribosomal protein S10 [Escherichia coli 101-1]
 gi|208726747|gb|EDZ76348.1| ribosomal protein S10 [Escherichia coli O157:H7 str. EC4206]
 gi|208733858|gb|EDZ82545.1| ribosomal protein S10 [Escherichia coli O157:H7 str. EC4045]
 gi|208741438|gb|EDZ89120.1| ribosomal protein S10 [Escherichia coli O157:H7 str. EC4042]
 gi|209160786|gb|ACI38219.1| ribosomal protein S10 [Escherichia coli O157:H7 str. EC4115]
 gi|209757028|gb|ACI76826.1| 30S ribosomal subunit protein S10 [Escherichia coli]
 gi|209757030|gb|ACI76827.1| 30S ribosomal subunit protein S10 [Escherichia coli]
 gi|209757032|gb|ACI76828.1| 30S ribosomal subunit protein S10 [Escherichia coli]
 gi|209757034|gb|ACI76829.1| 30S ribosomal subunit protein S10 [Escherichia coli]
 gi|209757036|gb|ACI76830.1| 30S ribosomal subunit protein S10 [Escherichia coli]
 gi|209914046|dbj|BAG79120.1| 30S ribosomal protein S10 [Escherichia coli SE11]
 gi|215266693|emb|CAS11132.1| 30S ribosomal subunit protein S10 [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217321118|gb|EEC29542.1| ribosomal protein S10 [Escherichia coli O157:H7 str. TW14588]
 gi|218353745|emb|CAV00040.1| 30S ribosomal subunit protein S10 [Escherichia coli 55989]
 gi|218362646|emb|CAR00272.1| 30S ribosomal subunit protein S10 [Escherichia coli IAI1]
 gi|218367151|emb|CAR04925.1| 30S ribosomal subunit protein S10 [Escherichia coli S88]
 gi|218372069|emb|CAR19929.1| 30S ribosomal subunit protein S10 [Escherichia coli IAI39]
 gi|218429171|emb|CAR10123.2| 30S ribosomal subunit protein S10 [Escherichia coli ED1a]
 gi|218434025|emb|CAR14942.1| 30S ribosomal subunit protein S10 [Escherichia coli UMN026]
 gi|222035030|emb|CAP77773.1| 30S ribosomal protein S10 [Escherichia coli LF82]
 gi|226838988|gb|EEH71011.1| ribosomal protein S10 [Escherichia sp. 1_1_43]
 gi|226902315|gb|EEH88574.1| ribosomal protein S10 [Escherichia sp. 3_2_53FAA]
 gi|227839596|gb|EEJ50062.1| 30S ribosomal protein S10 [Escherichia coli 83972]
 gi|238859784|gb|ACR61782.1| 30S ribosomal subunit protein S10 [Escherichia coli BW2952]
 gi|242378848|emb|CAQ33640.1| 30S ribosomal subunit protein S10, subunit of 30S ribosomal
           subunit, ribosome and NusB-NusE complex [Escherichia
           coli BL21(DE3)]
 gi|253322899|gb|ACT27501.1| ribosomal protein S10 [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253975150|gb|ACT40821.1| 30S ribosomal protein S10 [Escherichia coli B str. REL606]
 gi|253979306|gb|ACT44976.1| 30S ribosomal protein S10 [Escherichia coli BL21(DE3)]
 gi|254594658|gb|ACT74019.1| 30S ribosomal subunit protein S10 [Escherichia coli O157:H7 str.
           TW14359]
 gi|257756091|dbj|BAI27593.1| 30S ribosomal subunit protein S10 [Escherichia coli O26:H11 str.
           11368]
 gi|257761266|dbj|BAI32763.1| 30S ribosomal subunit protein S10 [Escherichia coli O103:H2 str.
           12009]
 gi|257766420|dbj|BAI37915.1| 30S ribosomal subunit protein S10 [Escherichia coli O111:H- str.
           11128]
 gi|260447660|gb|ACX38082.1| ribosomal protein S10 [Escherichia coli DH1]
 gi|281180356|dbj|BAI56686.1| 30S ribosomal protein S10 [Escherichia coli SE15]
 gi|281602686|gb|ADA75670.1| Ribosomal protein S10 [Shigella flexneri 2002017]
 gi|284923327|emb|CBG36421.1| 30S ribosomal subunit protein S10 [Escherichia coli 042]
 gi|290764552|gb|ADD58513.1| Ribosomal protein S10 [Escherichia coli O55:H7 str. CB9615]
 gi|291321765|gb|EFE61196.1| 30S ribosomal protein S10 [Escherichia coli B088]
 gi|291425729|gb|EFE98763.1| rps10 [Escherichia coli FVEC1412]
 gi|291431314|gb|EFF04299.1| 30S ribosomal protein S10 [Escherichia coli B185]
 gi|291468387|gb|EFF10880.1| 30S ribosomal protein S10 [Escherichia coli B354]
 gi|294489960|gb|ADE88716.1| ribosomal protein S10 [Escherichia coli IHE3034]
 gi|298276494|gb|EFI18012.1| 30S ribosomal protein S10 [Escherichia coli FVEC1302]
 gi|299881659|gb|EFI89870.1| ribosomal protein S10 [Escherichia coli MS 196-1]
 gi|300301918|gb|EFJ58303.1| ribosomal protein S10 [Escherichia coli MS 185-1]
 gi|300309010|gb|EFJ63530.1| ribosomal protein S10 [Escherichia coli MS 200-1]
 gi|300318233|gb|EFJ68017.1| ribosomal protein S10 [Escherichia coli MS 175-1]
 gi|300359500|gb|EFJ75370.1| ribosomal protein S10 [Escherichia coli MS 198-1]
 gi|300399525|gb|EFJ83063.1| ribosomal protein S10 [Escherichia coli MS 69-1]
 gi|300404442|gb|EFJ87980.1| ribosomal protein S10 [Escherichia coli MS 84-1]
 gi|300409403|gb|EFJ92941.1| ribosomal protein S10 [Escherichia coli MS 45-1]
 gi|300414555|gb|EFJ97865.1| ribosomal protein S10 [Escherichia coli MS 115-1]
 gi|300421718|gb|EFK05029.1| ribosomal protein S10 [Escherichia coli MS 182-1]
 gi|300453789|gb|EFK17409.1| ribosomal protein S10 [Escherichia coli MS 116-1]
 gi|300459475|gb|EFK22968.1| ribosomal protein S10 [Escherichia coli MS 21-1]
 gi|300460038|gb|EFK23531.1| ribosomal protein S10 [Escherichia coli MS 187-1]
 gi|300524642|gb|EFK45711.1| ribosomal protein S10 [Escherichia coli MS 119-7]
 gi|300532361|gb|EFK53423.1| ribosomal protein S10 [Escherichia coli MS 107-1]
 gi|300839225|gb|EFK66985.1| ribosomal protein S10 [Escherichia coli MS 124-1]
 gi|300847991|gb|EFK75751.1| ribosomal protein S10 [Escherichia coli MS 78-1]
 gi|301077762|gb|EFK92568.1| ribosomal protein S10 [Escherichia coli MS 146-1]
 gi|305850732|gb|EFM51189.1| 30S ribosomal protein S10 [Escherichia coli NC101]
 gi|306905449|gb|EFN35984.1| ribosomal protein S10 [Escherichia coli W]
 gi|307555408|gb|ADN48183.1| 30S ribosomal subunit protein S10 [Escherichia coli ABU 83972]
 gi|307628356|gb|ADN72660.1| 30S ribosomal protein S10 [Escherichia coli UM146]
 gi|308121646|gb|EFO58908.1| ribosomal protein S10 [Escherichia coli MS 145-7]
 gi|308926763|gb|EFP72239.1| ribosomal protein S10 [Shigella dysenteriae 1617]
 gi|309703733|emb|CBJ03074.1| 30S ribosomal subunit protein S10 [Escherichia coli ETEC H10407]
 gi|310334795|gb|EFQ01000.1| ribosomal protein S10 [Escherichia coli 1827-70]
 gi|312287179|gb|EFR15089.1| ribosomal protein S10 [Escherichia coli 2362-75]
 gi|312947872|gb|ADR28699.1| 30S ribosomal protein S10 [Escherichia coli O83:H1 str. NRG 857C]
 gi|313647369|gb|EFS11821.1| ribosomal protein S10 [Shigella flexneri 2a str. 2457T]
 gi|315062613|gb|ADT76940.1| 30S ribosomal subunit protein S10 [Escherichia coli W]
 gi|315137896|dbj|BAJ45055.1| ribosomal protein S10 [Escherichia coli DH1]
 gi|315255904|gb|EFU35872.1| ribosomal protein S10 [Escherichia coli MS 85-1]
 gi|315284604|gb|EFU44049.1| ribosomal protein S10 [Escherichia coli MS 110-3]
 gi|315292362|gb|EFU51714.1| ribosomal protein S10 [Escherichia coli MS 153-1]
 gi|315298619|gb|EFU57874.1| ribosomal protein S10 [Escherichia coli MS 16-3]
 gi|315616998|gb|EFU97610.1| ribosomal protein S10 [Escherichia coli 3431]
 gi|320173962|gb|EFW49138.1| 30S ribosomal protein S10 [Shigella dysenteriae CDC 74-1112]
 gi|320180155|gb|EFW55094.1| 30S ribosomal protein S10 [Shigella boydii ATCC 9905]
 gi|320187039|gb|EFW61751.1| 30S ribosomal protein S10 [Shigella flexneri CDC 796-83]
 gi|320191648|gb|EFW66298.1| 30S ribosomal protein S10 [Escherichia coli O157:H7 str. EC1212]
 gi|320199505|gb|EFW74095.1| 30S ribosomal protein S10 [Escherichia coli EC4100B]
 gi|320639626|gb|EFX09220.1| 30S ribosomal protein S10 [Escherichia coli O157:H7 str. G5101]
 gi|320645124|gb|EFX14140.1| 30S ribosomal protein S10 [Escherichia coli O157:H- str. 493-89]
 gi|320650435|gb|EFX18901.1| 30S ribosomal protein S10 [Escherichia coli O157:H- str. H 2687]
 gi|320655960|gb|EFX23880.1| 30S ribosomal protein S10 [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
 gi|320661412|gb|EFX28827.1| 30S ribosomal protein S10 [Escherichia coli O55:H7 str. USDA 5905]
 gi|320666434|gb|EFX33417.1| 30S ribosomal protein S10 [Escherichia coli O157:H7 str. LSU-61]
 gi|323154159|gb|EFZ40362.1| ribosomal protein S10 [Escherichia coli EPECa14]
 gi|323163000|gb|EFZ48835.1| ribosomal protein S10 [Escherichia coli E128010]
 gi|323164886|gb|EFZ50677.1| ribosomal protein S10 [Shigella sonnei 53G]
 gi|323173957|gb|EFZ59585.1| ribosomal protein S10 [Escherichia coli LT-68]
 gi|323179143|gb|EFZ64717.1| ribosomal protein S10 [Escherichia coli 1180]
 gi|323182799|gb|EFZ68200.1| ribosomal protein S10 [Escherichia coli 1357]
 gi|323189074|gb|EFZ74358.1| ribosomal protein S10 [Escherichia coli RN587/1]
 gi|323376800|gb|ADX49068.1| ribosomal protein S10 [Escherichia coli KO11]
 gi|323934481|gb|EGB30889.1| ribosomal protein S10 [Escherichia coli E1520]
 gi|323939257|gb|EGB35469.1| ribosomal protein S10 [Escherichia coli E482]
 gi|323944258|gb|EGB40334.1| ribosomal protein S10 [Escherichia coli H120]
 gi|323950235|gb|EGB46117.1| ribosomal protein S10 [Escherichia coli H252]
 gi|323954556|gb|EGB50339.1| ribosomal protein S10 [Escherichia coli H263]
 gi|323959528|gb|EGB55181.1| ribosomal protein S10 [Escherichia coli H489]
 gi|323966283|gb|EGB61718.1| ribosomal protein S10 [Escherichia coli M863]
 gi|323970125|gb|EGB65399.1| ribosomal protein S10 [Escherichia coli TA007]
 gi|323974726|gb|EGB69839.1| ribosomal protein S10 [Escherichia coli TW10509]
 gi|324009012|gb|EGB78231.1| ribosomal protein S10 [Escherichia coli MS 57-2]
 gi|324014937|gb|EGB84156.1| ribosomal protein S10 [Escherichia coli MS 60-1]
 gi|324017861|gb|EGB87080.1| ribosomal protein S10 [Escherichia coli MS 117-3]
 gi|324116289|gb|EGC10209.1| ribosomal protein S10 [Escherichia coli E1167]
 gi|326344553|gb|EGD68302.1| 30S ribosomal protein S10 [Escherichia coli O157:H7 str. 1125]
 gi|327250969|gb|EGE62662.1| ribosomal protein S10 [Escherichia coli STEC_7v]
 gi|330909363|gb|EGH37877.1| SSU ribosomal protein S10p (S20e) [Escherichia coli AA86]
 gi|331036311|gb|EGI08537.1| ribosomal protein S10 [Escherichia coli H736]
 gi|331041616|gb|EGI13760.1| ribosomal protein S10 [Escherichia coli M605]
 gi|331046929|gb|EGI19007.1| ribosomal protein S10 [Escherichia coli M718]
 gi|331052826|gb|EGI24859.1| ribosomal protein S10 [Escherichia coli TA206]
 gi|331057444|gb|EGI29430.1| ribosomal protein S10 [Escherichia coli TA143]
 gi|331062212|gb|EGI34132.1| ribosomal protein S10 [Escherichia coli TA271]
 gi|331067731|gb|EGI39129.1| ribosomal protein S10 [Escherichia coli TA280]
 gi|331072562|gb|EGI43887.1| ribosomal protein S10 [Escherichia coli H591]
 gi|331077334|gb|EGI48546.1| ribosomal protein S10 [Escherichia coli H299]
 gi|332085472|gb|EGI90638.1| ribosomal protein S10 [Shigella boydii 5216-82]
 gi|332085588|gb|EGI90752.1| ribosomal protein S10 [Shigella dysenteriae 155-74]
 gi|332090532|gb|EGI95630.1| ribosomal protein S10 [Shigella boydii 3594-74]
 gi|332104228|gb|EGJ07574.1| 30S ribosomal subunit protein S10 [Shigella sp. D9]
 gi|1096320|prf||2111328B NusE protein
          Length = 103

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 76/101 (75%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LKAFD R++D +  EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +
Sbjct: 2   QNQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R + RL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 62  RDQYEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISL 102


>gi|91774634|ref|YP_544390.1| 30S ribosomal protein S10 [Methylobacillus flagellatus KT]
 gi|118597187|sp|Q1H4N8|RS10_METFK RecName: Full=30S ribosomal protein S10
 gi|91708621|gb|ABE48549.1| SSU ribosomal protein S10P [Methylobacillus flagellatus KT]
          Length = 102

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 58/104 (55%), Positives = 77/104 (74%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M ++ IRI   LKAFD R++D S  EIV T K++G+ + GP+P P  I RF + RSPHV+
Sbjct: 1   MAAQKIRIR--LKAFDYRLIDQSALEIVETAKRTGAVVKGPVPLPTRIERFDILRSPHVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SRDQ E+R ++RL+ I+ PT +TVDALMKLD+ AGV+V IKL
Sbjct: 59  KTSRDQFEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKL 102


>gi|73542865|ref|YP_297385.1| 30S ribosomal protein S10 [Ralstonia eutropha JMP134]
 gi|94312254|ref|YP_585464.1| 30S ribosomal protein S10 [Cupriavidus metallidurans CH34]
 gi|113869437|ref|YP_727926.1| 30S ribosomal protein S10 [Ralstonia eutropha H16]
 gi|194291028|ref|YP_002006935.1| 30S ribosomal protein s10 [Cupriavidus taiwanensis LMG 19424]
 gi|118597192|sp|Q46WE2|RS10_RALEJ RecName: Full=30S ribosomal protein S10
 gi|118597193|sp|Q1LI31|RS10_RALME RecName: Full=30S ribosomal protein S10
 gi|123328827|sp|Q0K613|RS10_RALEH RecName: Full=30S ribosomal protein S10
 gi|226705430|sp|B3R7S9|RS10_CUPTR RecName: Full=30S ribosomal protein S10
 gi|72120278|gb|AAZ62541.1| SSU ribosomal protein S10P [Ralstonia eutropha JMP134]
 gi|93356106|gb|ABF10195.1| 30S ribosomal subunit protein S10 [Cupriavidus metallidurans CH34]
 gi|113528213|emb|CAJ94558.1| SSU ribosomal protein S10 [Ralstonia eutropha H16]
 gi|193224863|emb|CAQ70874.1| 30S ribosomal subunit protein S10 [Cupriavidus taiwanensis LMG
           19424]
          Length = 102

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 77/101 (76%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N +I I LKAFD R++D S  EIV T K++G+ + GP+P P  I+RF + RSPHV+K S
Sbjct: 2   QNQKIRIRLKAFDYRLIDQSAAEIVDTAKRTGAIVKGPVPLPTRIQRFDILRSPHVNKTS 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R ++RL+ I+ PT +TVDALMKLD+ AGV+V IK+
Sbjct: 62  RDQFEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKV 102


>gi|224827016|ref|ZP_03700113.1| ribosomal protein S10 [Lutiella nitroferrum 2002]
 gi|224600682|gb|EEG06868.1| ribosomal protein S10 [Lutiella nitroferrum 2002]
          Length = 103

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 59/104 (56%), Positives = 77/104 (74%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+ IRI   LKAFD  ++D S +EIV T K++G+ + GP+P P  I RF + RSPHV+
Sbjct: 1   MQSQKIRIR--LKAFDYNLIDRSAQEIVETAKRTGAVVKGPVPLPTKIERFNILRSPHVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SRDQLE+R + RL+ I+ PT +TVDALMKLD+ AGV+V IKL
Sbjct: 59  KTSRDQLEIRTHLRLMDIVDPTDKTVDALMKLDLPAGVDVEIKL 102


>gi|71905960|ref|YP_283547.1| 30S ribosomal protein S10 [Dechloromonas aromatica RCB]
 gi|115305617|sp|Q47JA4|RS10_DECAR RecName: Full=30S ribosomal protein S10
 gi|71845581|gb|AAZ45077.1| SSU ribosomal protein S10P [Dechloromonas aromatica RCB]
          Length = 103

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 76/100 (76%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKAFD R++D S +EIV T K++G+ + GP+P P   +RF + RSPHV+K SR
Sbjct: 3   NQKIRIRLKAFDYRLIDQSAQEIVETAKRTGAVVRGPVPLPTRKQRFDILRSPHVNKASR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           DQLE+R + RL+ I+ PT +TVDALMKLD+ AGV+V IKL
Sbjct: 63  DQLEIRTHLRLMDIVDPTDKTVDALMKLDLPAGVDVEIKL 102


>gi|295698650|ref|YP_003603305.1| ribosomal protein S10 [Candidatus Riesia pediculicola USDA]
 gi|291157208|gb|ADD79653.1| ribosomal protein S10 [Candidatus Riesia pediculicola USDA]
          Length = 103

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 74/100 (74%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N RI I LKAFD R++D S  EIV T K++G+Q+ GPIP P    RFT+  SPH +K +R
Sbjct: 3   NQRIRIRLKAFDHRLIDQSTAEIVATAKRTGAQVKGPIPLPTRRERFTILISPHANKDAR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           DQ E+  +KRL+ I+KPT +TVDALMKLD+A+GV+V I L
Sbjct: 63  DQYEILTHKRLVDIVKPTEKTVDALMKLDLASGVDVQISL 102


>gi|300309455|ref|YP_003773547.1| 30S ribosomal protein S10 [Herbaspirillum seropedicae SmR1]
 gi|124483432|emb|CAM32589.1| 30S ribosomal subunit protein S10 [Herbaspirillum seropedicae]
 gi|300072240|gb|ADJ61639.1| 30S ribosomal subunit S10 protein [Herbaspirillum seropedicae SmR1]
          Length = 105

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 58/104 (55%), Positives = 78/104 (75%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M+  + +I I LKAFD R++D S  EIV T K++G+ + GP+P P  I+RF V RSPHV+
Sbjct: 1   MSVPSQKIRIRLKAFDYRLIDQSALEIVDTAKRTGAVVKGPVPLPTRIQRFDVLRSPHVN 60

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SRDQ E+R ++RL+ I+ PT +TVDALMKLD+ AGV+V IKL
Sbjct: 61  KTSRDQFEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKL 104


>gi|152980232|ref|YP_001355102.1| small subunit ribosomal protein S10 [Janthinobacterium sp.
           Marseille]
 gi|151280309|gb|ABR88719.1| small subunit ribosomal protein S10 [Janthinobacterium sp.
           Marseille]
          Length = 110

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 75/100 (75%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKAFD R++D S  EIV T K++G+ + GP+P P  I+RF V RSPHV+K SR
Sbjct: 10  NQKIRIRLKAFDYRLIDQSALEIVDTAKRTGAVVKGPVPLPTRIQRFDVLRSPHVNKTSR 69

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           DQ E+R + RL+ I+ PT +TVDALMKLD+ AGV+V IKL
Sbjct: 70  DQFEIRTHVRLMDIVDPTDKTVDALMKLDLPAGVDVEIKL 109


>gi|313111418|ref|ZP_07797223.1| 30S ribosomal protein S10 [Pseudomonas aeruginosa 39016]
 gi|310883725|gb|EFQ42319.1| 30S ribosomal protein S10 [Pseudomonas aeruginosa 39016]
          Length = 94

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 72/93 (77%)

Query: 12  LKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQLEMRI 71
           +KAFD R++D S +EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +RDQ E+R 
Sbjct: 1   MKAFDHRLIDQSTQEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDARDQYEIRT 60

Query: 72  YKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +KR+L I++PT +TVDALMKLD+AAGV V I L
Sbjct: 61  HKRVLDIVQPTDKTVDALMKLDLAAGVEVQISL 93


>gi|227543624|ref|ZP_03973673.1| ribosomal protein S10 [Lactobacillus reuteri CF48-3A]
 gi|300909347|ref|ZP_07126808.1| 30S ribosomal protein S10 [Lactobacillus reuteri SD2112]
 gi|227186464|gb|EEI66535.1| ribosomal protein S10 [Lactobacillus reuteri CF48-3A]
 gi|300893212|gb|EFK86571.1| 30S ribosomal protein S10 [Lactobacillus reuteri SD2112]
          Length = 102

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 75/98 (76%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA++ RILD S  +IV T K++G+QI GPIP P     +TV RSPH+ KKSR+Q
Sbjct: 5   KIRIRLKAYEHRILDQSADKIVETAKRTGAQISGPIPLPTERTIYTVIRSPHISKKSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTP+TVD+LMKLD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDIVDPTPKTVDSLMKLDLPSGVDIEIKL 102


>gi|30248417|ref|NP_840487.1| 30S ribosomal protein S10 [Nitrosomonas europaea ATCC 19718]
 gi|44888450|sp|Q82X89|RS10_NITEU RecName: Full=30S ribosomal protein S10
 gi|30138303|emb|CAD84311.1| Ribosomal protein S10 [Nitrosomonas europaea ATCC 19718]
          Length = 102

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 75/101 (74%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N +I I LKAFD R++D S  EIV T K++G+ + GP+P P  I RF V RSPHV+K S
Sbjct: 2   QNQKIRIRLKAFDYRLIDKSAIEIVETAKRTGAVVKGPVPLPTRIERFDVLRSPHVNKTS 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R + RL+ II PT +TVDALMKLD+ AGV+V IKL
Sbjct: 62  RDQFEIRTHLRLMDIIDPTDKTVDALMKLDLPAGVDVEIKL 102


>gi|303256448|ref|ZP_07342462.1| ribosomal protein S10 [Burkholderiales bacterium 1_1_47]
 gi|331000640|ref|ZP_08324293.1| ribosomal protein S10 [Parasutterella excrementihominis YIT 11859]
 gi|302859939|gb|EFL83016.1| ribosomal protein S10 [Burkholderiales bacterium 1_1_47]
 gi|329570852|gb|EGG52563.1| ribosomal protein S10 [Parasutterella excrementihominis YIT 11859]
          Length = 103

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 76/98 (77%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I LKAFD +++D S  EIV T K++G+ + GPIP P  I+RF + RSPHV+K SRDQ
Sbjct: 5   RIRIRLKAFDYKLIDQSALEIVDTGKRTGAVVRGPIPLPTRIQRFDILRSPHVNKTSRDQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           LE+R ++RL+ II PT +TVDALMKLD+ AGV+V IK+
Sbjct: 65  LEIRTHQRLMDIIDPTDKTVDALMKLDLPAGVDVEIKV 102


>gi|259502530|ref|ZP_05745432.1| 30S ribosomal protein S10 [Lactobacillus antri DSM 16041]
 gi|259169482|gb|EEW53977.1| 30S ribosomal protein S10 [Lactobacillus antri DSM 16041]
          Length = 102

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 75/100 (75%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA++ RILD S  +IV T K++G+QI GPIP P     +TV RSPH  KKSR
Sbjct: 3   NQKIRIRLKAYEHRILDQSADKIVDTAKRTGAQISGPIPLPTERTLYTVIRSPHKFKKSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KRL+ II PTP+TVDALMKLD+ +GV++ IKL
Sbjct: 63  EQFEMRTHKRLIDIIDPTPKTVDALMKLDLPSGVDIEIKL 102


>gi|83591277|ref|YP_431286.1| 30S ribosomal protein S10 [Moorella thermoacetica ATCC 39073]
 gi|115305630|sp|Q2RFP6|RS10_MOOTA RecName: Full=30S ribosomal protein S10
 gi|83574191|gb|ABC20743.1| SSU ribosomal protein S10P [Moorella thermoacetica ATCC 39073]
          Length = 102

 Score =  115 bits (287), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 76/98 (77%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD R+LD S ++IV T +++G+ + GPIP P     FT+ RSPHV+K SR+Q
Sbjct: 5   KIRIRLKAFDHRVLDQSSQKIVDTARRTGAVVSGPIPLPTEKNIFTILRSPHVNKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I++PTP+TVDALM+LD+ AGV++ IKL
Sbjct: 65  FEMRTHKRLIDILEPTPKTVDALMRLDLPAGVDIEIKL 102


>gi|253998013|ref|YP_003050076.1| 30S ribosomal protein S10 [Methylovorus sp. SIP3-4]
 gi|313200080|ref|YP_004038738.1| 30S ribosomal protein S10 [Methylovorus sp. MP688]
 gi|253984692|gb|ACT49549.1| ribosomal protein S10 [Methylovorus sp. SIP3-4]
 gi|312439396|gb|ADQ83502.1| ribosomal protein S10 [Methylovorus sp. MP688]
          Length = 102

 Score =  115 bits (287), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 58/104 (55%), Positives = 77/104 (74%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M ++ IRI   LKAFD R++D S  EIV T K++G+ + GP+P P  I RF + RSPHV+
Sbjct: 1   MAAQKIRIR--LKAFDYRLIDQSALEIVETAKRTGAVVKGPVPLPTRIERFDLLRSPHVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SRDQ E+R ++RL+ I+ PT +TVDALMKLD+ AGV+V IKL
Sbjct: 59  KTSRDQFEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKL 102


>gi|84625045|ref|YP_452417.1| 30S ribosomal protein S10 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|166710830|ref|ZP_02242037.1| 30S ribosomal protein S10 [Xanthomonas oryzae pv. oryzicola BLS256]
 gi|188575489|ref|YP_001912418.1| 30S ribosomal protein S10 [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|75434346|sp|Q5GWT2|RS10_XANOR RecName: Full=30S ribosomal protein S10
 gi|118597340|sp|Q2NZY4|RS10_XANOM RecName: Full=30S ribosomal protein S10
 gi|226708309|sp|B2SQQ9|RS10_XANOP RecName: Full=30S ribosomal protein S10
 gi|58427802|gb|AAW76839.1| 30S ribosomal protein S10 [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84368985|dbj|BAE70143.1| 30S ribosomal protein S10 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188519941|gb|ACD57886.1| ribosomal protein S10 [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 104

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 56/102 (54%), Positives = 73/102 (71%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           S   +I I LKAFD R++D    EIV T K++G+Q+ GPIP P  I R+T+  SPH DK 
Sbjct: 2   SEKQKIRIRLKAFDHRLIDRWASEIVETAKRTGAQVRGPIPLPTKIERYTILVSPHADKD 61

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +RDQ E R +KR+L I+ P  +TVDALMKL++AAGV+V IKL
Sbjct: 62  ARDQYETRTHKRVLDIVDPNDKTVDALMKLELAAGVDVQIKL 103


>gi|307718205|ref|YP_003873737.1| 30S ribosomal protein S10 [Spirochaeta thermophila DSM 6192]
 gi|306531930|gb|ADN01464.1| 30S ribosomal protein S10 [Spirochaeta thermophila DSM 6192]
 gi|315186332|gb|EFU20093.1| SSU ribosomal protein S10P [Spirochaeta thermophila DSM 6578]
          Length = 102

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 51/97 (52%), Positives = 75/97 (77%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + LK FD+ ++D S + IV   +K+G+++ GP+P P  IR++TV RSPHV+K+SR+Q
Sbjct: 5   KIRVRLKGFDTELVDQSAQAIVQAAQKAGAKVSGPVPLPTHIRKYTVLRSPHVNKESREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            EMRI+KRL+ I+ PTP  +DALMKL++ AGV+V IK
Sbjct: 65  FEMRIHKRLVDILNPTPAVMDALMKLELPAGVDVEIK 101


>gi|148982482|ref|ZP_01816778.1| 30S ribosomal protein S10 [Vibrionales bacterium SWAT-3]
 gi|145960447|gb|EDK25826.1| 30S ribosomal protein S10 [Vibrionales bacterium SWAT-3]
          Length = 98

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 55/95 (57%), Positives = 74/95 (77%)

Query: 10  ICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQLEM 69
           I LKAFD +++D+S  EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +RDQ E+
Sbjct: 3   IRLKAFDYKLIDASTAEIVETAKRTGAQVRGPIPLPTRKERFTVLTSPHVNKDARDQYEI 62

Query: 70  RIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           R +KRL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 63  RTHKRLIDIVEPTDKTVDALMRLDLAAGVDVQISL 97


>gi|91786166|ref|YP_547118.1| 30S ribosomal protein S10 [Polaromonas sp. JS666]
 gi|121603119|ref|YP_980448.1| 30S ribosomal protein S10 [Polaromonas naphthalenivorans CJ2]
 gi|239817876|ref|YP_002946786.1| 30S ribosomal protein S10 [Variovorax paradoxus S110]
 gi|319796220|ref|YP_004157860.1| ribosomal protein s10 [Variovorax paradoxus EPS]
 gi|118597190|sp|Q12GX2|RS10_POLSJ RecName: Full=30S ribosomal protein S10
 gi|166231307|sp|A1VIP9|RS10_POLNA RecName: Full=30S ribosomal protein S10
 gi|259494613|sp|C5CP56|RS10_VARPS RecName: Full=30S ribosomal protein S10
 gi|91695391|gb|ABE42220.1| SSU ribosomal protein S10P [Polaromonas sp. JS666]
 gi|120592088|gb|ABM35527.1| SSU ribosomal protein S10P [Polaromonas naphthalenivorans CJ2]
 gi|239804453|gb|ACS21520.1| ribosomal protein S10 [Variovorax paradoxus S110]
 gi|315598683|gb|ADU39749.1| ribosomal protein S10 [Variovorax paradoxus EPS]
          Length = 104

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 76/98 (77%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD +++D S  EIV T K++G+ + GP+P P  ++RF + RSPHV+K SRDQ
Sbjct: 6   KIRIRLKAFDYKLIDQSAAEIVDTAKRTGAIVKGPVPLPTRMKRFDILRSPHVNKTSRDQ 65

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           LE+R ++RL+ I+ PT +TVDALMKLD+ AGV+V IKL
Sbjct: 66  LEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKL 103


>gi|218710750|ref|YP_002418371.1| 30S ribosomal protein S10 [Vibrio splendidus LGP32]
 gi|218323769|emb|CAV20126.1| 30S ribosomal protein S10 [Vibrio splendidus LGP32]
          Length = 108

 Score =  114 bits (286), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 76/101 (75%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LKAFD +++D+S  EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +
Sbjct: 7   QNQRIRIRLKAFDYKLIDASTAEIVETAKRTGAQVRGPIPLPTRKERFTVLTSPHVNKDA 66

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRL+ I++PT +TVDALM+LD+ A +NV I L
Sbjct: 67  RDQYEIRTHKRLIDIVEPTDKTVDALMRLDLQAALNVQISL 107


>gi|312870501|ref|ZP_07730620.1| ribosomal protein S10 [Lactobacillus oris PB013-T2-3]
 gi|311093963|gb|EFQ52288.1| ribosomal protein S10 [Lactobacillus oris PB013-T2-3]
          Length = 102

 Score =  114 bits (286), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 75/100 (75%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA++ RILD S  +IV T K++G+QI GPIP P     +TV RSPH  KKSR
Sbjct: 3   NQKIRIRLKAYEHRILDQSADKIVDTAKRTGAQISGPIPLPTERTIYTVIRSPHKFKKSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KRL+ II PTP+TVDALMKLD+ +GV++ IKL
Sbjct: 63  EQFEMRTHKRLIDIIDPTPKTVDALMKLDLPSGVDIEIKL 102


>gi|319778752|ref|YP_004129665.1| SSU ribosomal protein S10p (S20e) [Taylorella equigenitalis MCE9]
 gi|317108776|gb|ADU91522.1| SSU ribosomal protein S10p (S20e) [Taylorella equigenitalis MCE9]
          Length = 103

 Score =  114 bits (286), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 76/101 (75%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N +I I LKAFD +++D S  EIV T K++G+ + GP+P P  I+R+ V RSPHV+K S
Sbjct: 2   KNQKIRIRLKAFDYKLIDQSAAEIVDTAKRTGAVVHGPVPLPTRIKRYDVLRSPHVNKTS 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R ++RL+ I+ PT +TVDALM+LD+ AGVNV I L
Sbjct: 62  RDQFEIRTHQRLMDIVDPTDKTVDALMRLDLPAGVNVEIAL 102


>gi|121608242|ref|YP_996049.1| 30S ribosomal protein S10 [Verminephrobacter eiseniae EF01-2]
 gi|241765216|ref|ZP_04763199.1| ribosomal protein S10 [Acidovorax delafieldii 2AN]
 gi|319761137|ref|YP_004125074.1| ribosomal protein s10 [Alicycliphilus denitrificans BC]
 gi|330822995|ref|YP_004386298.1| 30S ribosomal protein S10 [Alicycliphilus denitrificans K601]
 gi|166231794|sp|A1WHC4|RS10_VEREI RecName: Full=30S ribosomal protein S10
 gi|121552882|gb|ABM57031.1| SSU ribosomal protein S10P [Verminephrobacter eiseniae EF01-2]
 gi|241365096|gb|EER59975.1| ribosomal protein S10 [Acidovorax delafieldii 2AN]
 gi|317115698|gb|ADU98186.1| ribosomal protein S10 [Alicycliphilus denitrificans BC]
 gi|329308367|gb|AEB82782.1| 30S ribosomal protein S10 [Alicycliphilus denitrificans K601]
          Length = 103

 Score =  114 bits (286), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 57/104 (54%), Positives = 79/104 (75%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M+ + IRI   LKAFD +++D S  EIV T K++G+ + GP+P P  ++RF + RSPHV+
Sbjct: 1   MSKQKIRIR--LKAFDYKLIDQSAAEIVDTAKRTGAIVKGPVPLPTRMKRFDILRSPHVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SRDQLE+R ++RL+ I+ PT +TVDALMKLD+ AGV+V IKL
Sbjct: 59  KTSRDQLEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKL 102


>gi|167629466|ref|YP_001679965.1| 30S ribosomal protein s10 [Heliobacterium modesticaldum Ice1]
 gi|226705453|sp|B0TC55|RS10_HELMI RecName: Full=30S ribosomal protein S10
 gi|167592206|gb|ABZ83954.1| 30S ribosomal protein s10 [Heliobacterium modesticaldum Ice1]
          Length = 102

 Score =  114 bits (286), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 74/98 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD RILD S  +IV T K++G+ + GPIP P     +T+ RSPHV+K SR+Q
Sbjct: 5   KIRIRLKAFDHRILDQSSEKIVETAKRTGAAVSGPIPLPTEKSIYTILRSPHVNKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I++P P+TVDALM+LD+ AGV++ IKL
Sbjct: 65  FEMRTHKRLIDILEPNPKTVDALMRLDLPAGVDIEIKL 102


>gi|226939185|ref|YP_002794256.1| rpsJ, nusE [Laribacter hongkongensis HLHK9]
 gi|254809583|sp|C1DAR6|RS10_LARHH RecName: Full=30S ribosomal protein S10
 gi|226714109|gb|ACO73247.1| rpsJ, nusE [Laribacter hongkongensis HLHK9]
          Length = 103

 Score =  114 bits (286), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 75/101 (74%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N +I I LKAFD  ++D S +EIV T K++G+ + GP+P P  I RF + RSPHV+K S
Sbjct: 2   QNQKIRIRLKAFDYHLIDRSAQEIVDTAKRTGAVVKGPVPLPTKIERFDILRSPHVNKTS 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R + RL+ II PT +TVDALMKLD+ AGV+V IKL
Sbjct: 62  RDQFEIRTHLRLMDIIDPTDKTVDALMKLDLPAGVDVEIKL 102


>gi|296137307|ref|YP_003644549.1| ribosomal protein S10 [Thiomonas intermedia K12]
 gi|294341611|emb|CAZ90028.1| 30S ribosomal protein S10 [Thiomonas sp. 3As]
 gi|295797429|gb|ADG32219.1| ribosomal protein S10 [Thiomonas intermedia K12]
          Length = 103

 Score =  114 bits (285), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 77/101 (76%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N +I I LKAFD +++D S  EIV T K++G+ + GP+P P  ++RF + RSPHV+K S
Sbjct: 2   QNQKIRIRLKAFDYKLIDQSAMEIVDTAKRTGAIVKGPVPLPTRLQRFDILRSPHVNKTS 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQLE+R + RL+ I+ PT +TVDALMKLD+ AGV+V IKL
Sbjct: 62  RDQLEIRTHLRLMDIVDPTDKTVDALMKLDLPAGVDVEIKL 102


>gi|256830539|ref|YP_003159267.1| ribosomal protein S10 [Desulfomicrobium baculatum DSM 4028]
 gi|256579715|gb|ACU90851.1| ribosomal protein S10 [Desulfomicrobium baculatum DSM 4028]
          Length = 102

 Score =  114 bits (285), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 59/104 (56%), Positives = 77/104 (74%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S  IRI   L+A+D RILD ++ EIV + + +G+ I GPIP P  I + TV +S HVD
Sbjct: 1   MNSDKIRIK--LRAYDYRILDKAVAEIVDSARNTGASIAGPIPLPTRIHKQTVQKSVHVD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q EMR++KRLL I++PT QTVDAL KL++ AGV+V IKL
Sbjct: 59  KKSREQFEMRVHKRLLDILEPTQQTVDALGKLNLPAGVDVEIKL 102


>gi|319944804|ref|ZP_08019068.1| 30S ribosomal protein S10 [Lautropia mirabilis ATCC 51599]
 gi|319742053|gb|EFV94476.1| 30S ribosomal protein S10 [Lautropia mirabilis ATCC 51599]
          Length = 103

 Score =  114 bits (285), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 74/100 (74%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKAFD +++D S  EIV T K++G+ + GP+P P  I  F V RSPHV+K SR
Sbjct: 3   NQKIRIRLKAFDYKLIDQSAAEIVDTAKRTGAVVHGPVPLPTRIEHFDVLRSPHVNKTSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           DQLE+R + RL+ I+ PT +TVDALMKLD+ AGV+V IKL
Sbjct: 63  DQLEIRTHLRLMDIVDPTDKTVDALMKLDLPAGVDVEIKL 102


>gi|82701899|ref|YP_411465.1| 30S ribosomal protein S10 [Nitrosospira multiformis ATCC 25196]
 gi|115305636|sp|Q2YAZ8|RS10_NITMU RecName: Full=30S ribosomal protein S10
 gi|82409964|gb|ABB74073.1| SSU ribosomal protein S10P [Nitrosospira multiformis ATCC 25196]
          Length = 102

 Score =  114 bits (285), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 60/104 (57%), Positives = 76/104 (73%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+ IRI   LKAFD R++D S  EIV T K++G+ + GP+P P  I RF V RSPHV+
Sbjct: 1   MQSQKIRIR--LKAFDYRLIDKSALEIVETAKRTGAVVKGPVPLPTRIERFDVLRSPHVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SRDQ E+R + RL+ I+ PT +TVDALMKLD+ AGV+V IKL
Sbjct: 59  KTSRDQFEIRTHLRLMDIMDPTDKTVDALMKLDLPAGVDVEIKL 102


>gi|317153959|ref|YP_004122007.1| 30S ribosomal protein S10 [Desulfovibrio aespoeensis Aspo-2]
 gi|316944210|gb|ADU63261.1| ribosomal protein S10 [Desulfovibrio aespoeensis Aspo-2]
          Length = 106

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 74/98 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I L+++D RILD ++ EIV T + +G+ I GP+P P  + R TV +S HVDKKSR+Q
Sbjct: 9   RIRIKLRSYDYRILDKAVNEIVDTARNTGAAIAGPVPLPTDMHRTTVQKSVHVDKKSREQ 68

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+RI+KRLL I++PT QTVDAL KL + AGV+V IKL
Sbjct: 69  FEIRIHKRLLDILEPTQQTVDALGKLSLPAGVDVEIKL 106


>gi|163859274|ref|YP_001633572.1| 30S ribosomal protein S10 [Bordetella petrii DSM 12804]
 gi|226705406|sp|A9IJ03|RS10_BORPD RecName: Full=30S ribosomal protein S10
 gi|163263002|emb|CAP45305.1| 30S ribosomal protein S10 [Bordetella petrii]
          Length = 103

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 76/101 (75%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N +I I LKAFD +++D S  EIV T K++G+ + GP+P P  IRR+ V RSPHV+K S
Sbjct: 2   KNQKIRIRLKAFDYKLIDQSAAEIVDTAKRTGAVVRGPVPLPTRIRRYDVLRSPHVNKSS 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R ++RL+ I+ PT +TVDALM+LD+ AGV+V I L
Sbjct: 62  RDQFEIRTHQRLMDIVDPTDKTVDALMRLDLPAGVDVEIAL 102


>gi|90417568|ref|ZP_01225486.1| ribosomal protein S10 [marine gamma proteobacterium HTCC2207]
 gi|90330589|gb|EAS45885.1| ribosomal protein S10 [marine gamma proteobacterium HTCC2207]
          Length = 103

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 77/101 (76%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N  I I LKAFD +++D+S +EIV T +++G+QI GPIP P    +FT+  SPHV+K +
Sbjct: 2   QNQSIRIRLKAFDHKLIDTSTQEIVETARRTGAQIRGPIPLPTRKEKFTILISPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R +KRL+ I++PT +TVDALMKL++AAGV V I L
Sbjct: 62  RDQYEIRTHKRLIDIVEPTEKTVDALMKLNLAAGVEVQISL 102


>gi|223936429|ref|ZP_03628341.1| ribosomal protein S10 [bacterium Ellin514]
 gi|223894947|gb|EEF61396.1| ribosomal protein S10 [bacterium Ellin514]
          Length = 102

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 73/98 (74%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I LKAFD R++D S R+I  T K++G+++ GPIP P  + RFTV RSPH DKKS++ 
Sbjct: 5   RIRIRLKAFDHRVIDQSARDIADTVKRTGARVAGPIPLPTRVERFTVLRSPHSDKKSQET 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R +KRLL II+PT +TVD L KL++ AGV++ IK+
Sbjct: 65  FEQRTHKRLLDIIEPTAKTVDELKKLNLPAGVDITIKI 102


>gi|91205878|ref|YP_538233.1| 30S ribosomal protein S10 [Rickettsia bellii RML369-C]
 gi|157826763|ref|YP_001495827.1| 30S ribosomal protein S10 [Rickettsia bellii OSU 85-389]
 gi|118597201|sp|Q1RHM0|RS10_RICBR RecName: Full=30S ribosomal protein S10
 gi|166231771|sp|A8GVB3|RS10_RICB8 RecName: Full=30S ribosomal protein S10
 gi|91069422|gb|ABE05144.1| 30S ribosomal protein S10 [Rickettsia bellii RML369-C]
 gi|157802067|gb|ABV78790.1| 30S ribosomal protein S10 [Rickettsia bellii OSU 85-389]
          Length = 105

 Score =  114 bits (284), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 72/98 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK+FD R LD + +EIV   K++ + I GPIP PR I+RFTVNRSPHV  KSR+Q
Sbjct: 4   KIKIRLKSFDHRSLDQATKEIVSAVKRTFANISGPIPLPRKIQRFTVNRSPHVHIKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R  KRLL I  P P  VDAL K+D+AAGV+VVI+L
Sbjct: 64  YEIRTQKRLLVIDDPNPVVVDALSKVDLAAGVDVVIEL 101


>gi|220930964|ref|YP_002507872.1| ribosomal protein S10 [Halothermothrix orenii H 168]
 gi|219992274|gb|ACL68877.1| ribosomal protein S10 [Halothermothrix orenii H 168]
          Length = 103

 Score =  114 bits (284), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 53/102 (51%), Positives = 76/102 (74%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           +++ +I I LKA++  +LD S ++IV T K++G+++ GPIP P     +TV RSPHV K 
Sbjct: 2   AKHEKIRIRLKAYEHELLDQSAQKIVATAKRTGAEVSGPIPLPTEKEVYTVLRSPHVHKD 61

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           SR+Q EMR +KRL+ I+ PT +TVDALM+LD+ AGVN+ IKL
Sbjct: 62  SREQFEMRTHKRLIDIVDPTSKTVDALMRLDLPAGVNIEIKL 103


>gi|325921480|ref|ZP_08183335.1| SSU ribosomal protein S10P [Xanthomonas gardneri ATCC 19865]
 gi|325548027|gb|EGD19026.1| SSU ribosomal protein S10P [Xanthomonas gardneri ATCC 19865]
          Length = 94

 Score =  114 bits (284), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 53/93 (56%), Positives = 70/93 (75%)

Query: 12  LKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQLEMRI 71
           +KAFD R++D S  EIV T K++G+Q+ GPIP P  I R+T+  SPH DK +RDQ E R 
Sbjct: 1   MKAFDHRLIDRSASEIVETAKRTGAQVRGPIPLPTKIERYTILVSPHADKDARDQYETRT 60

Query: 72  YKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +KR+L I+ P  +TVDALMKL++AAGV+V IKL
Sbjct: 61  HKRVLDIVDPNDKTVDALMKLELAAGVDVQIKL 93


>gi|33594478|ref|NP_882122.1| 30S ribosomal protein S10 [Bordetella pertussis Tohama I]
 gi|33599021|ref|NP_886581.1| 30S ribosomal protein S10 [Bordetella bronchiseptica RB50]
 gi|187476538|ref|YP_784562.1| 30S ribosomal protein S10 [Bordetella avium 197N]
 gi|293602636|ref|ZP_06685079.1| 30S ribosomal protein S10 [Achromobacter piechaudii ATCC 43553]
 gi|311109613|ref|YP_003982466.1| 30S ribosomal protein S10 [Achromobacter xylosoxidans A8]
 gi|44888429|sp|Q7VTD4|RS10_BORPE RecName: Full=30S ribosomal protein S10
 gi|44888440|sp|Q7WRC6|RS10_BORBR RecName: Full=30S ribosomal protein S10
 gi|110825779|sp|Q2L2G3|RS10_BORA1 RecName: Full=30S ribosomal protein S10
 gi|33564554|emb|CAE43870.1| 30S ribosomal protein S10 [Bordetella pertussis Tohama I]
 gi|33575067|emb|CAE30530.1| 30S ribosomal protein S10 [Bordetella bronchiseptica RB50]
 gi|115421124|emb|CAJ47608.1| 30S ribosomal protein S10 [Bordetella avium 197N]
 gi|292819008|gb|EFF78046.1| 30S ribosomal protein S10 [Achromobacter piechaudii ATCC 43553]
 gi|310764302|gb|ADP19751.1| ribosomal protein S10 [Achromobacter xylosoxidans A8]
 gi|317401536|gb|EFV82165.1| 30S ribosomal protein S10 [Achromobacter xylosoxidans C54]
          Length = 103

 Score =  114 bits (284), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 76/101 (75%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N +I I LKAFD +++D S  EIV T K++G+ + GP+P P  IRR+ V RSPHV+K S
Sbjct: 2   KNQKIRIRLKAFDYKLIDQSAAEIVDTAKRTGAVVRGPVPLPTRIRRYDVLRSPHVNKTS 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+R ++RL+ I+ PT +TVDALM+LD+ AGV+V I L
Sbjct: 62  RDQFEIRTHQRLMDIVDPTDKTVDALMRLDLPAGVDVEIAL 102


>gi|184155992|ref|YP_001844332.1| 30S ribosomal protein S10 [Lactobacillus fermentum IFO 3956]
 gi|260662751|ref|ZP_05863645.1| 30S ribosomal protein S10 [Lactobacillus fermentum 28-3-CHN]
 gi|226705584|sp|B2GDX0|RS10_LACF3 RecName: Full=30S ribosomal protein S10
 gi|183227336|dbj|BAG27852.1| 30S ribosomal protein S10 [Lactobacillus fermentum IFO 3956]
 gi|260552832|gb|EEX25831.1| 30S ribosomal protein S10 [Lactobacillus fermentum 28-3-CHN]
          Length = 102

 Score =  114 bits (284), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 75/100 (75%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA++ R+LD S  +IV + K++G+Q+ GPIP P     +TV RSPH  KKSR
Sbjct: 3   NQKIRIRLKAYEHRVLDESADKIVESAKRTGAQVSGPIPLPTERTLYTVIRSPHKFKKSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KRL+ II PTP+TVDALMKLD+ +GV++ IKL
Sbjct: 63  EQFEMRTHKRLIDIIDPTPKTVDALMKLDLPSGVDIEIKL 102


>gi|145596435|ref|YP_001160732.1| 30S ribosomal protein S10 [Salinispora tropica CNB-440]
 gi|159039835|ref|YP_001539088.1| 30S ribosomal protein S10 [Salinispora arenicola CNS-205]
 gi|238061122|ref|ZP_04605831.1| 30S ribosomal protein S10 [Micromonospora sp. ATCC 39149]
 gi|302869973|ref|YP_003838610.1| 30S ribosomal protein S10 [Micromonospora aurantiaca ATCC 27029]
 gi|315501434|ref|YP_004080321.1| ribosomal protein s10 [Micromonospora sp. L5]
 gi|330470174|ref|YP_004407917.1| 30S ribosomal protein S10 [Verrucosispora maris AB-18-032]
 gi|189040387|sp|A8M530|RS10_SALAI RecName: Full=30S ribosomal protein S10
 gi|189040390|sp|A4XBP7|RS10_SALTO RecName: Full=30S ribosomal protein S10
 gi|57547706|gb|AAW52545.1| RpsJ [Micromonospora sp. ATCC 39149]
 gi|145305772|gb|ABP56354.1| SSU ribosomal protein S10P [Salinispora tropica CNB-440]
 gi|157918670|gb|ABW00098.1| ribosomal protein S10 [Salinispora arenicola CNS-205]
 gi|237882933|gb|EEP71761.1| 30S ribosomal protein S10 [Micromonospora sp. ATCC 39149]
 gi|302572832|gb|ADL49034.1| ribosomal protein S10 [Micromonospora aurantiaca ATCC 27029]
 gi|315408053|gb|ADU06170.1| ribosomal protein S10 [Micromonospora sp. L5]
 gi|328813145|gb|AEB47317.1| 30S ribosomal protein S10 [Verrucosispora maris AB-18-032]
          Length = 102

 Score =  114 bits (284), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 56/104 (53%), Positives = 75/104 (72%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LKA+D  ++DSS R+IV T  ++G+Q+ GP+P P  I RF V RSPH  
Sbjct: 1   MAGQKIRIR--LKAYDHEVVDSSARKIVETVTRTGAQVAGPVPLPTEINRFCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+  EMR +KRL+ II PTP+TVD+LM+LD+ AGV++ IKL
Sbjct: 59  KDSREHFEMRTHKRLIDIIDPTPKTVDSLMRLDLPAGVDIEIKL 102


>gi|313673468|ref|YP_004051579.1| SSU ribosomal protein s10p [Calditerrivibrio nitroreducens DSM
           19672]
 gi|312940224|gb|ADR19416.1| SSU ribosomal protein S10P [Calditerrivibrio nitroreducens DSM
           19672]
          Length = 102

 Score =  114 bits (284), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 55/104 (52%), Positives = 80/104 (76%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           MT + IRI   LK+FD +ILD S+++IV T K +G+++VGP+P P  I +++V RSPHV+
Sbjct: 1   MTGQKIRIK--LKSFDHKILDKSVKDIVRTAKMTGARVVGPVPLPTKIEKYSVLRSPHVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K S +Q E+R +KRL+ I +  PQT+DALMKL+++AGV+V IKL
Sbjct: 59  KTSFEQFEIRTHKRLVDIYEHNPQTIDALMKLELSAGVDVEIKL 102


>gi|224510711|pdb|3FIH|J Chain J, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry
           Consists Of The 30s Subunit, Trnas And The Ternary
           Complex.
 gi|294662226|pdb|2WWL|J Chain J, E.Coli 70s Ribosome Stalled During Translation Of Tnac
           Leader Peptide. This File Contains The 30s, The P-Site
           Trna And The Tnac Leader Peptide (Part 1 Of 2).
 gi|308387974|pdb|3OFO|J Chain J, Crystal Structure Of The E. Coli Ribosome Bound To
           Erythromycin. This File Contains The 30s Subunit Of The
           First 70s Ribosome.
 gi|308387995|pdb|3OFP|J Chain J, Crystal Structure Of The E. Coli Ribosome Bound To
           Erythromycin. This File Contains The 30s Subunit Of The
           Second 70s Ribosome.
 gi|309320032|pdb|3OFA|J Chain J, Crystal Structure Of The E. Coli Ribosome Bound To
           Chloramphenicol. This File Contains The 30s Subunit Of
           The First 70s Ribosome.
 gi|309320053|pdb|3OFB|J Chain J, Crystal Structure Of The E. Coli Ribosome Bound To
           Chloramphenicol. This File Contains The 30s Subunit Of
           The Second 70s Ribosome.
 gi|309320136|pdb|3OFX|J Chain J, Crystal Structure Of The E. Coli Ribosome Bound To
           Clindamycin. This File Contains The 30s Subunit Of The
           First 70s Ribosome.
 gi|309320157|pdb|3OFY|J Chain J, Crystal Structure Of The E. Coli Ribosome Bound To
           Clindamycin. This File Contains The 30s Subunit Of The
           Second 70s Ribosome
 gi|315113621|pdb|3OAQ|J Chain J, Crystal Structure Of The E. Coli Ribosome Bound To
           Telithromycin. This File Contains The 30s Subunit Of The
           First 70s Ribosome.
 gi|315113642|pdb|3OAR|J Chain J, Crystal Structure Of The E. Coli Ribosome Bound To
           Telithromycin. This File Contains The 30s Subunit Of The
           Second 70s Ribosome
          Length = 98

 Score =  114 bits (284), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 74/98 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I LKAFD R++D +  EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +RDQ
Sbjct: 1   RIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDARDQ 60

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R + RL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 61  YEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISL 98


>gi|254468873|ref|ZP_05082279.1| ribosomal protein S10 [beta proteobacterium KB13]
 gi|207087683|gb|EDZ64966.1| ribosomal protein S10 [beta proteobacterium KB13]
          Length = 101

 Score =  113 bits (283), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 76/100 (76%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKAFD +++D S +EIV T K++G+ + GPIP P    R+ + RSPHV+KKSR
Sbjct: 2   NQKIRIRLKAFDYKLIDQSAQEIVDTAKRTGAIVKGPIPLPTKKERYDLLRSPHVNKKSR 61

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           DQ E+R + RL+ I+ PT +TVDALMKL++AAGV+V IKL
Sbjct: 62  DQFEIRTHLRLMDILDPTDKTVDALMKLELAAGVDVEIKL 101


>gi|327399524|ref|YP_004340393.1| 30S ribosomal protein S10 [Hippea maritima DSM 10411]
 gi|327182153|gb|AEA34334.1| 30S ribosomal protein S10 [Hippea maritima DSM 10411]
          Length = 103

 Score =  113 bits (283), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 80/98 (81%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + LK+F+S +LDSS+++I+   KK+G+++ GPIP P  I R+TV RSPHV+KKSR+Q
Sbjct: 5   KIRLKLKSFESDLLDSSVKDIIDMVKKTGAKVKGPIPLPTRISRYTVLRSPHVNKKSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R++KRLL I++ + QTVDALMK+++ AGV++ +KL
Sbjct: 65  FEIRVHKRLLDIVQASQQTVDALMKVNLPAGVDIEVKL 102


>gi|212213251|ref|YP_002304187.1| 30S ribosomal protein S10 [Coxiella burnetii CbuG_Q212]
 gi|212218073|ref|YP_002304860.1| 30S ribosomal protein S10 [Coxiella burnetii CbuK_Q154]
 gi|215918921|ref|NP_819281.2| 30S ribosomal protein S10 [Coxiella burnetii RSA 493]
 gi|206583806|gb|AAO89795.2| SSU ribosomal protein S10P [Coxiella burnetii RSA 493]
 gi|212011661|gb|ACJ19042.1| SSU ribosomal protein S10P [Coxiella burnetii CbuG_Q212]
 gi|212012335|gb|ACJ19715.1| SSU ribosomal protein S10P [Coxiella burnetii CbuK_Q154]
          Length = 113

 Score =  113 bits (283), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 59/102 (57%), Positives = 77/102 (75%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           S N RI I LKAFD R++D S REIV T +++G+ I GPI  P  I R+TV  SP++DK 
Sbjct: 5   SDNQRIRIRLKAFDHRLIDRSTREIVETARRTGAIIRGPILLPTKIERYTVLISPNIDKD 64

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +RDQ E+R +KRL+ I +PT +TVDALMKLD+AAGV+V I+L
Sbjct: 65  ARDQYEIRTHKRLVDISEPTDKTVDALMKLDLAAGVDVQIEL 106


>gi|153210325|ref|ZP_01947605.1| ribosomal protein S10 [Coxiella burnetii 'MSU Goat Q177']
 gi|161830951|ref|YP_001596184.1| 30S ribosomal protein S10 [Coxiella burnetii RSA 331]
 gi|44888461|sp|Q83ES5|RS10_COXBU RecName: Full=30S ribosomal protein S10
 gi|189040368|sp|A9KD32|RS10_COXBN RecName: Full=30S ribosomal protein S10
 gi|189040369|sp|A9NAM3|RS10_COXBR RecName: Full=30S ribosomal protein S10
 gi|120575147|gb|EAX31771.1| ribosomal protein S10 [Coxiella burnetii 'MSU Goat Q177']
 gi|161762818|gb|ABX78460.1| ribosomal protein S10 [Coxiella burnetii RSA 331]
          Length = 110

 Score =  113 bits (283), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 59/102 (57%), Positives = 77/102 (75%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           S N RI I LKAFD R++D S REIV T +++G+ I GPI  P  I R+TV  SP++DK 
Sbjct: 2   SDNQRIRIRLKAFDHRLIDRSTREIVETARRTGAIIRGPILLPTKIERYTVLISPNIDKD 61

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +RDQ E+R +KRL+ I +PT +TVDALMKLD+AAGV+V I+L
Sbjct: 62  ARDQYEIRTHKRLVDISEPTDKTVDALMKLDLAAGVDVQIEL 103


>gi|209364190|ref|YP_001425183.2| 30S ribosomal protein S10 [Coxiella burnetii Dugway 5J108-111]
 gi|207082123|gb|ABS77673.2| SSU ribosomal protein S10P [Coxiella burnetii Dugway 5J108-111]
          Length = 115

 Score =  113 bits (283), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 59/102 (57%), Positives = 77/102 (75%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           S N RI I LKAFD R++D S REIV T +++G+ I GPI  P  I R+TV  SP++DK 
Sbjct: 7   SDNQRIRIRLKAFDHRLIDRSTREIVETARRTGAIIRGPILLPTKIERYTVLISPNIDKD 66

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +RDQ E+R +KRL+ I +PT +TVDALMKLD+AAGV+V I+L
Sbjct: 67  ARDQYEIRTHKRLVDISEPTDKTVDALMKLDLAAGVDVQIEL 108


>gi|227515486|ref|ZP_03945535.1| ribosomal protein S10 [Lactobacillus fermentum ATCC 14931]
 gi|227086099|gb|EEI21411.1| ribosomal protein S10 [Lactobacillus fermentum ATCC 14931]
          Length = 208

 Score =  113 bits (283), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 76/103 (73%)

Query: 2   TSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDK 61
           T  N +I I LKA++ R+LD S  +IV + K++G+Q+ GPIP P     +TV RSPH  K
Sbjct: 106 TMANQKIRIRLKAYEHRVLDESADKIVESAKRTGAQVSGPIPLPTERTLYTVIRSPHKFK 165

Query: 62  KSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KSR+Q EMR +KRL+ II PTP+TVDALMKLD+ +GV++ IKL
Sbjct: 166 KSREQFEMRTHKRLIDIIDPTPKTVDALMKLDLPSGVDIEIKL 208


>gi|319942172|ref|ZP_08016488.1| 30S ribosomal protein S10 [Sutterella wadsworthensis 3_1_45B]
 gi|319804225|gb|EFW01117.1| 30S ribosomal protein S10 [Sutterella wadsworthensis 3_1_45B]
          Length = 103

 Score =  113 bits (283), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 76/98 (77%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I LKA+D +++D S  EIV T K++G+ + GP+P P  I+RF + RSPHV+K SRDQ
Sbjct: 5   RIRIRLKAYDYKLIDQSALEIVDTAKRTGAVVRGPVPLPTRIQRFDILRSPHVNKTSRDQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           LE+R ++RL+ I+ PT +TVDALMKLD+ AGV+V IK+
Sbjct: 65  LEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVKIKV 102


>gi|171913927|ref|ZP_02929397.1| 30S ribosomal protein S10 [Verrucomicrobium spinosum DSM 4136]
          Length = 102

 Score =  113 bits (283), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 73/98 (74%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I L+A+D R+LD S  EIV T K++G+++ GPIP P  I +F VNRSPHVDKKS + 
Sbjct: 5   RIRIRLRAYDYRVLDKSTAEIVETAKRTGAKVAGPIPLPTRIEKFNVNRSPHVDKKSSEH 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRLL I+ PT +TVD L KL++ +GV++ I++
Sbjct: 65  FEIRTHKRLLDIVDPTARTVDELKKLNLPSGVDITIRI 102


>gi|302877800|ref|YP_003846364.1| 30S ribosomal protein S10 [Gallionella capsiferriformans ES-2]
 gi|302580589|gb|ADL54600.1| ribosomal protein S10 [Gallionella capsiferriformans ES-2]
          Length = 103

 Score =  113 bits (283), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 59/104 (56%), Positives = 75/104 (72%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+ IRI   LKAFD R++D S   IV T K++G+ + GP+P P  I RF V RSPHV+
Sbjct: 1   MQSQKIRIR--LKAFDYRLIDQSAARIVETAKRTGAVVNGPVPLPTKIERFDVLRSPHVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SRDQ E+R + RL+ I+ PT +TVDALMKLD+ AGV+V IKL
Sbjct: 59  KTSRDQFEIRTHLRLMDIVDPTDKTVDALMKLDLPAGVDVEIKL 102


>gi|120609040|ref|YP_968718.1| 30S ribosomal protein S10 [Acidovorax citrulli AAC00-1]
 gi|121592711|ref|YP_984607.1| 30S ribosomal protein S10 [Acidovorax sp. JS42]
 gi|160895839|ref|YP_001561421.1| 30S ribosomal protein S10 [Delftia acidovorans SPH-1]
 gi|221069451|ref|ZP_03545556.1| ribosomal protein S10 [Comamonas testosteroni KF-1]
 gi|222109492|ref|YP_002551756.1| 30S ribosomal protein s10 [Acidovorax ebreus TPSY]
 gi|264676441|ref|YP_003276347.1| ribosomal protein S10 [Comamonas testosteroni CNB-2]
 gi|299531237|ref|ZP_07044648.1| 30S ribosomal protein S10 [Comamonas testosteroni S44]
 gi|326315223|ref|YP_004232895.1| 30S ribosomal protein S10 [Acidovorax avenae subsp. avenae ATCC
           19860]
 gi|166231229|sp|A1TJ06|RS10_ACIAC RecName: Full=30S ribosomal protein S10
 gi|166231233|sp|A1W2Q6|RS10_ACISJ RecName: Full=30S ribosomal protein S10
 gi|226705432|sp|A9BPR7|RS10_DELAS RecName: Full=30S ribosomal protein S10
 gi|254809589|sp|B9MB72|RS10_DIAST RecName: Full=30S ribosomal protein S10
 gi|120587504|gb|ABM30944.1| SSU ribosomal protein S10P [Acidovorax citrulli AAC00-1]
 gi|120604791|gb|ABM40531.1| SSU ribosomal protein S10P [Acidovorax sp. JS42]
 gi|160361423|gb|ABX33036.1| ribosomal protein S10 [Delftia acidovorans SPH-1]
 gi|220714474|gb|EED69842.1| ribosomal protein S10 [Comamonas testosteroni KF-1]
 gi|221728936|gb|ACM31756.1| ribosomal protein S10 [Acidovorax ebreus TPSY]
 gi|222839155|gb|EEE77506.1| predicted protein [Populus trichocarpa]
 gi|262206953|gb|ACY31051.1| ribosomal protein S10 [Comamonas testosteroni CNB-2]
 gi|298720820|gb|EFI61766.1| 30S ribosomal protein S10 [Comamonas testosteroni S44]
 gi|323372059|gb|ADX44328.1| 30S ribosomal protein S10 [Acidovorax avenae subsp. avenae ATCC
           19860]
          Length = 103

 Score =  113 bits (283), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 56/104 (53%), Positives = 78/104 (75%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M+ + IRI   LKAFD +++D S  EIV T K++G+ + GP+P P  ++RF + RSPHV+
Sbjct: 1   MSKQKIRIR--LKAFDYKLIDQSAAEIVDTAKRTGAIVKGPVPLPTRMKRFDILRSPHVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SRDQ E+R ++RL+ I+ PT +TVDALMKLD+ AGV+V IKL
Sbjct: 59  KTSRDQFEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKL 102


>gi|269215706|ref|ZP_06159560.1| ribosomal protein S10 [Slackia exigua ATCC 700122]
 gi|269131193|gb|EEZ62268.1| ribosomal protein S10 [Slackia exigua ATCC 700122]
          Length = 102

 Score =  113 bits (282), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 73/100 (73%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LK +D  I+D S + IV T +K+G+++ GPIP P     FTV R PHVDK SR
Sbjct: 3   NQKIRIRLKGYDHEIVDQSTKLIVDTAQKTGAKVSGPIPLPTERNLFTVVRGPHVDKDSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KRL+ I++PTP TVD+LM+LD+ AGV++ IKL
Sbjct: 63  EQFEMRTHKRLIDILEPTPNTVDSLMRLDLPAGVDIEIKL 102


>gi|15837753|ref|NP_298441.1| 30S ribosomal protein S10 [Xylella fastidiosa 9a5c]
 gi|28198352|ref|NP_778666.1| 30S ribosomal protein S10 [Xylella fastidiosa Temecula1]
 gi|182680993|ref|YP_001829153.1| 30S ribosomal protein S10 [Xylella fastidiosa M23]
 gi|54039329|sp|P66349|RS10_XYLFT RecName: Full=30S ribosomal protein S10
 gi|54042106|sp|P66348|RS10_XYLFA RecName: Full=30S ribosomal protein S10
 gi|226708311|sp|B2I8G8|RS10_XYLF2 RecName: Full=30S ribosomal protein S10
 gi|9106115|gb|AAF83961.1|AE003950_11 30S ribosomal protein S10 [Xylella fastidiosa 9a5c]
 gi|28056422|gb|AAO28315.1| 30S ribosomal protein S10 [Xylella fastidiosa Temecula1]
 gi|182631103|gb|ACB91879.1| ribosomal protein S10 [Xylella fastidiosa M23]
 gi|307579462|gb|ADN63431.1| 30S ribosomal protein S10 [Xylella fastidiosa subsp. fastidiosa
           GB514]
          Length = 103

 Score =  113 bits (282), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD R++D S  EIV T K++G+ + GPIP P  I R T+  SPH DK +RDQ
Sbjct: 5   KIQIRLKAFDCRLIDRSAGEIVETAKRTGAHVRGPIPLPTKIERCTILVSPHADKDARDQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E   YKR+LYI+ P  +TVDALMKL++AAGV+V IKL
Sbjct: 65  YETCTYKRVLYIVDPNDKTVDALMKLELAAGVDVQIKL 102


>gi|89893216|ref|YP_516703.1| 30S ribosomal protein S10 [Desulfitobacterium hafniense Y51]
 gi|219666489|ref|YP_002456924.1| 30S ribosomal protein S10 [Desulfitobacterium hafniense DCB-2]
 gi|118597175|sp|Q250N3|RS10_DESHY RecName: Full=30S ribosomal protein S10
 gi|254809590|sp|B8G1W5|RS10_DESHD RecName: Full=30S ribosomal protein S10
 gi|89332664|dbj|BAE82259.1| 30S ribosomal protein S10 [Desulfitobacterium hafniense Y51]
 gi|219536749|gb|ACL18488.1| ribosomal protein S10 [Desulfitobacterium hafniense DCB-2]
          Length = 102

 Score =  113 bits (282), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 56/104 (53%), Positives = 78/104 (75%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M+S+ IRI   LKAFD + LD S  +IV T K++G+++ GPIP P     +T+ RSPHV+
Sbjct: 1   MSSQKIRIR--LKAFDHKTLDQSAEKIVETAKRTGARVSGPIPLPTEKSIYTILRSPHVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+Q EMR +KRL+ I++PT +TVDALM+LD+ AGV++ IKL
Sbjct: 59  KDSREQFEMRTHKRLIDILEPTSKTVDALMRLDLPAGVDIEIKL 102


>gi|149198921|ref|ZP_01875962.1| 30S ribosomal protein S10 [Lentisphaera araneosa HTCC2155]
 gi|149137916|gb|EDM26328.1| 30S ribosomal protein S10 [Lentisphaera araneosa HTCC2155]
          Length = 102

 Score =  113 bits (282), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 78/104 (75%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   L+++D  +LD+S  +IV T K++G+++ GPIP P  + RFTVNRSPHV+
Sbjct: 1   MAKQTIRIR--LQSYDHAVLDTSASDIVKTVKRAGARVAGPIPLPTRVERFTVNRSPHVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KK+ DQ E+R +KRLL I++PTP+ VD L KL++ AGV++ +K+
Sbjct: 59  KKAMDQFEIRTHKRLLDIVEPTPKCVDELKKLNLPAGVDIAVKI 102


>gi|94677037|ref|YP_588775.1| ribosomal protein S10 [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
 gi|118595834|sp|Q1LTD9|RS10_BAUCH RecName: Full=30S ribosomal protein S10
 gi|94220187|gb|ABF14346.1| ribosomal protein S10 [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
          Length = 103

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 75/101 (74%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N RI I LKAFD R++D S  EIV T K++G+Q+ GPIP P     FT+  SPHV+K +
Sbjct: 2   QNQRIRIRLKAFDHRLIDQSTAEIVDTAKRTGAQVHGPIPLPTRKEHFTILISPHVNKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ  +R +KRL+ I+KPT +TVDALM+L++AAGV+V I L
Sbjct: 62  RDQYVIRTHKRLVDIVKPTEKTVDALMRLELAAGVDVQISL 102


>gi|89902556|ref|YP_525027.1| 30S ribosomal protein S10 [Rhodoferax ferrireducens T118]
 gi|118597196|sp|Q21RV7|RS10_RHOFD RecName: Full=30S ribosomal protein S10
 gi|89347293|gb|ABD71496.1| SSU ribosomal protein S10P [Rhodoferax ferrireducens T118]
          Length = 104

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 74/98 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD +++D S  EIV T K++G+ + GP+P P   +RF + RSPHV+K SRDQ
Sbjct: 6   KIRIRLKAFDYKLIDQSAAEIVDTAKRTGAIVKGPVPLPTRFKRFDILRSPHVNKTSRDQ 65

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R ++RL+ I+ PT +TVDALMKLD+ AGV+V IKL
Sbjct: 66  FEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKL 103


>gi|147676654|ref|YP_001210869.1| ribosomal protein S10 [Pelotomaculum thermopropionicum SI]
 gi|189040381|sp|A5D5I9|RS10_PELTS RecName: Full=30S ribosomal protein S10
 gi|146272751|dbj|BAF58500.1| ribosomal protein S10 [Pelotomaculum thermopropionicum SI]
          Length = 102

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 54/104 (51%), Positives = 77/104 (74%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+ IRI   LKAFD  +LD S ++IV T +++G+ + GP+P P     +T+ RSPHV+
Sbjct: 1   MKSQKIRIR--LKAFDHHMLDQSAQKIVETARRTGASVAGPVPLPTEKSIYTILRSPHVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+Q EMR +KRL+ I++P P+TVDALM+LD+ AGV++ IKL
Sbjct: 59  KDSREQFEMRTHKRLIDILEPNPKTVDALMRLDLPAGVDIEIKL 102


>gi|332107865|gb|EGJ09089.1| 30S ribosomal protein S10 [Rubrivivax benzoatilyticus JA2]
          Length = 104

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 75/98 (76%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD +++D S  EIV T K++G+ + GP+P P  ++RF + RSPHV+K SRDQ
Sbjct: 6   KIRIRLKAFDYKLIDQSALEIVDTAKRTGAIVKGPVPLPTRLQRFDILRSPHVNKTSRDQ 65

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R ++RL+ I+ PT +TVDALMKLD+ AGV+V IKL
Sbjct: 66  FEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKL 103


>gi|261854949|ref|YP_003262232.1| ribosomal protein S10 [Halothiobacillus neapolitanus c2]
 gi|261835418|gb|ACX95185.1| ribosomal protein S10 [Halothiobacillus neapolitanus c2]
          Length = 103

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 58/104 (55%), Positives = 78/104 (75%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+ IRI   LK+FD R++D S  EIV T ++SG+++ GPIP P    RFTV  SPHV+
Sbjct: 1   MASQTIRIR--LKSFDHRLIDRSAAEIVDTARRSGARVKGPIPLPSRKERFTVLVSPHVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K +RDQ E+R +KR+L II+PT +TVD LM+LD+AAGV+V I+L
Sbjct: 59  KDARDQYELRTHKRVLDIIEPTDRTVDLLMQLDLAAGVDVQIRL 102


>gi|71902233|ref|ZP_00684240.1| Ribosomal protein S10, bacterial form [Xylella fastidiosa Ann-1]
 gi|71728007|gb|EAO30221.1| Ribosomal protein S10, bacterial form [Xylella fastidiosa Ann-1]
          Length = 103

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD R++D S  EIV T K++G+ + GPIP P  I R T+  SPH DK +RDQ
Sbjct: 5   KIQIRLKAFDCRLIDRSAGEIVDTAKRTGAHVRGPIPLPTKIERCTILVSPHADKDARDQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E   YKR+LYI+ P  +TVDALMKL++AAGV+V IKL
Sbjct: 65  YETCTYKRVLYIVDPNDKTVDALMKLELAAGVDVQIKL 102


>gi|124268628|ref|YP_001022632.1| 30S ribosomal protein S10 [Methylibium petroleiphilum PM1]
 gi|166231290|sp|A2SLF8|RS10_METPP RecName: Full=30S ribosomal protein S10
 gi|124261403|gb|ABM96397.1| SSU ribosomal protein S10P [Methylibium petroleiphilum PM1]
          Length = 103

 Score =  112 bits (280), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 75/98 (76%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD +++D S  EIV T K++G+ + GP+P P  ++RF + RSPHV+K SRDQ
Sbjct: 5   KIRIRLKAFDYKLIDQSALEIVDTAKRTGAIVKGPVPLPTRMQRFDILRSPHVNKSSRDQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R ++RL+ I+ PT +TVDALMKLD+ AGV+V IKL
Sbjct: 65  FEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKL 102


>gi|146329668|ref|YP_001210152.1| 30S ribosomal protein S10 [Dichelobacter nodosus VCS1703A]
 gi|226705435|sp|A5EX83|RS10_DICNV RecName: Full=30S ribosomal protein S10
 gi|146233138|gb|ABQ14116.1| 30S ribosomal protein S10 [Dichelobacter nodosus VCS1703A]
          Length = 104

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 76/98 (77%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D R++D+S ++IV T K++G+Q+ GPIP P     +TV  SPHV+K +RDQ
Sbjct: 6   KIRIRLKSYDHRLIDASAKQIVETAKRAGAQVKGPIPLPVKKEIYTVLISPHVNKDARDQ 65

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KR++ II PT +TVDALMKLD+AAGV+V I+L
Sbjct: 66  YEMRTHKRIMDIIDPTDKTVDALMKLDLAAGVDVKIEL 103


>gi|323340373|ref|ZP_08080630.1| 30S ribosomal protein S10 [Lactobacillus ruminis ATCC 25644]
 gi|323092149|gb|EFZ34764.1| 30S ribosomal protein S10 [Lactobacillus ruminis ATCC 25644]
          Length = 102

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 73/98 (74%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA++ RILD S  +IV T K++G+QI GPIP P     +TV RSPH  K SR+Q
Sbjct: 5   KIRIRLKAYEHRILDQSADKIVETAKRTGAQISGPIPLPTERTLYTVIRSPHKHKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTP+TVD+LMKLD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDIVNPTPKTVDSLMKLDLPSGVDIEIKL 102


>gi|118595336|ref|ZP_01552683.1| 30S ribosomal protein S10 [Methylophilales bacterium HTCC2181]
 gi|118441114|gb|EAV47741.1| 30S ribosomal protein S10 [Methylophilales bacterium HTCC2181]
          Length = 102

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 57/104 (54%), Positives = 77/104 (74%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+ IRI   LKAFD +++D S +EIV T K++G+ + GP+P P  I RF +  SPHV 
Sbjct: 1   MVSQKIRIR--LKAFDYKLIDQSAQEIVDTAKRTGAVVKGPVPLPTRIERFDLLSSPHVY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KK+RDQ E+R ++RL+ I+ PT +TVDALMKLD+ AGV+V IKL
Sbjct: 59  KKARDQFEIRTHQRLMDILDPTDKTVDALMKLDLPAGVDVEIKL 102


>gi|227530204|ref|ZP_03960253.1| ribosomal protein S10 [Lactobacillus vaginalis ATCC 49540]
 gi|227349879|gb|EEJ40170.1| ribosomal protein S10 [Lactobacillus vaginalis ATCC 49540]
          Length = 102

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 74/98 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA++ RILD S  +IV T K++G+QI GPIP P     +TV RSPH  KKSR+Q
Sbjct: 5   KIRIRLKAYEHRILDQSADKIVETAKRTGAQISGPIPLPTERTIYTVLRSPHKFKKSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTP+TVD+LMKLD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDIVDPTPKTVDSLMKLDLPSGVDIEIKL 102


>gi|116667419|pdb|2GY9|J Chain J, Structure Of The 30s Subunit Of A Pre-Translocational E.
           Coli Ribosome Obtained By Fitting Atomic Models For Rna
           And Protein Components Into Cryo-Em Map Emd-1056
 gi|116667471|pdb|2GYB|J Chain J, Structure Of The 30s Subunit Of A Secm-Stalled E. Coli
           Ribosome Complex Obtained By Fitting Atomic Models For
           Rna And Protein Components Into Cryo-Em Map Emd-1143
          Length = 96

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 73/96 (76%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I LKAFD R++D +  EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +RDQ
Sbjct: 1   RIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDARDQ 60

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVI 102
            E+R + RL+ I++PT +TVDALM+LD+AAGV+V I
Sbjct: 61  YEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQI 96


>gi|294101627|ref|YP_003553485.1| ribosomal protein S10 [Aminobacterium colombiense DSM 12261]
 gi|293616607|gb|ADE56761.1| ribosomal protein S10 [Aminobacterium colombiense DSM 12261]
          Length = 101

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 75/98 (76%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD R+LDSS  +I  T ++SG+++ GPIP P  I ++T+ +SPH DK +R+Q
Sbjct: 4   KIRIRLKAFDHRVLDSSASQIAETAERSGAKVSGPIPLPTEINKYTILKSPHKDKDAREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PT +T+DALM+L++ +GV++ IKL
Sbjct: 64  FEMRTHKRLIDIVNPTQKTMDALMQLNLPSGVDIQIKL 101


>gi|33594750|ref|NP_882393.1| 30S ribosomal protein S10 [Bordetella parapertussis 12822]
 gi|44888433|sp|Q7W2F7|RS10_BORPA RecName: Full=30S ribosomal protein S10
 gi|33564826|emb|CAE39769.1| 30S ribosomal protein S10 [Bordetella parapertussis]
          Length = 103

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 75/101 (74%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N +I I LKAFD +++D S  EIV T K++G+ + GP+P P  IRR+ V RSPHV+K S
Sbjct: 2   KNQKIRIRLKAFDYKLIDQSAAEIVDTAKRTGAVVRGPVPLPTRIRRYDVLRSPHVNKTS 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+  ++RL+ I+ PT +TVDALM+LD+ AGV+V I L
Sbjct: 62  RDQFEIHTHQRLMDIVDPTDKTVDALMRLDLPAGVDVEIAL 102


>gi|148544697|ref|YP_001272067.1| 30S ribosomal protein S10 [Lactobacillus reuteri DSM 20016]
 gi|184154050|ref|YP_001842391.1| 30S ribosomal protein S10 [Lactobacillus reuteri JCM 1112]
 gi|194466954|ref|ZP_03072941.1| ribosomal protein S10 [Lactobacillus reuteri 100-23]
 gi|227363820|ref|ZP_03847927.1| ribosomal protein S10 [Lactobacillus reuteri MM2-3]
 gi|325683031|ref|ZP_08162547.1| 30S ribosomal protein S10 [Lactobacillus reuteri MM4-1A]
 gi|166991569|sp|A5VLK6|RS10_LACRD RecName: Full=30S ribosomal protein S10
 gi|226705585|sp|B2G8X9|RS10_LACRJ RecName: Full=30S ribosomal protein S10
 gi|148531731|gb|ABQ83730.1| SSU ribosomal protein S10P [Lactobacillus reuteri DSM 20016]
 gi|183225394|dbj|BAG25911.1| 30S ribosomal protein S10 [Lactobacillus reuteri JCM 1112]
 gi|194453990|gb|EDX42887.1| ribosomal protein S10 [Lactobacillus reuteri 100-23]
 gi|227071177|gb|EEI09493.1| ribosomal protein S10 [Lactobacillus reuteri MM2-3]
 gi|324977381|gb|EGC14332.1| 30S ribosomal protein S10 [Lactobacillus reuteri MM4-1A]
          Length = 102

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 74/98 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA++ RILD S  +IV T K++G+QI GPIP P     +TV RSPH  KKSR+Q
Sbjct: 5   KIRIRLKAYEHRILDQSADKIVETAKRTGAQISGPIPLPTERTIYTVIRSPHKFKKSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTP+TVD+LMKLD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDIVDPTPKTVDSLMKLDLPSGVDIEIKL 102


>gi|170729699|ref|YP_001775132.1| 30S ribosomal protein S10 [Xylella fastidiosa M12]
 gi|226708312|sp|B0U5A6|RS10_XYLFM RecName: Full=30S ribosomal protein S10
 gi|167964492|gb|ACA11502.1| 30S ribosomal protein S10 [Xylella fastidiosa M12]
          Length = 103

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD R++D S  EIV T K++G+ + GPIP P  I R T+  SPH DK +RDQ
Sbjct: 5   KIQIRLKAFDCRLIDRSAGEIVETAKRTGAHVRGPIPLPTKIERCTILVSPHADKDARDQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E   YKR+LYI+ P  +TVDALM+L++AAGV+V IKL
Sbjct: 65  YETCTYKRVLYIVDPNDKTVDALMRLELAAGVDVQIKL 102


>gi|297205090|ref|ZP_06922486.1| 30S ribosomal protein S10 [Lactobacillus jensenii JV-V16]
 gi|297149668|gb|EFH29965.1| 30S ribosomal protein S10 [Lactobacillus jensenii JV-V16]
          Length = 144

 Score =  111 bits (278), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 55/104 (52%), Positives = 76/104 (73%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+ IRI   LK+++  ILD S  +IV T K++G++I GP+P P     FTV RSPH +
Sbjct: 43  MASQQIRIR--LKSYEHGILDESAAKIVATAKRTGAEISGPVPLPTERTLFTVLRSPHTN 100

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+Q EMR +KRL+ I+ PTP+TVD+LMKLD+ +GV++ IKL
Sbjct: 101 KDSREQFEMRTHKRLIDILNPTPKTVDSLMKLDLPSGVDIEIKL 144


>gi|260664852|ref|ZP_05865703.1| ribosomal protein S10 [Lactobacillus jensenii SJ-7A-US]
 gi|260561335|gb|EEX27308.1| ribosomal protein S10 [Lactobacillus jensenii SJ-7A-US]
          Length = 102

 Score =  111 bits (278), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 55/104 (52%), Positives = 77/104 (74%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+ IRI   LK+++  ILD S  +IV T K++G++I GP+P P     FTV RSPH++
Sbjct: 1   MASQQIRIR--LKSYEHGILDESAAKIVATAKRTGAEISGPVPLPTERTLFTVLRSPHMN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+Q EMR +KRL+ I+ PTP+TVD+LMKLD+ +GV++ IKL
Sbjct: 59  KDSREQFEMRTHKRLIDILNPTPKTVDSLMKLDLPSGVDIEIKL 102


>gi|78044733|ref|YP_361119.1| 30S ribosomal protein S10 [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|115305613|sp|Q3A9R5|RS10_CARHZ RecName: Full=30S ribosomal protein S10
 gi|77996848|gb|ABB15747.1| ribosomal protein S10 [Carboxydothermus hydrogenoformans Z-2901]
          Length = 102

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 74/98 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAF+  ILD S  +IV T K++G+ + GPIP P     +TV RSPH+DK SR+Q
Sbjct: 5   KIRIKLKAFEHTILDQSAAKIVETAKRTGASVSGPIPLPTERSLYTVLRSPHIDKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E++++KRL+ II PTP+T+DALM++D+ AGV++ IKL
Sbjct: 65  FELKVHKRLIDIIDPTPKTIDALMRIDLPAGVDIEIKL 102


>gi|323141355|ref|ZP_08076246.1| ribosomal protein S10 [Phascolarctobacterium sp. YIT 12067]
 gi|322414104|gb|EFY04932.1| ribosomal protein S10 [Phascolarctobacterium sp. YIT 12067]
          Length = 118

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 78/104 (75%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           + +++ +I I LKA+D + LD S  +IV T K++G+Q+ GPIP P     +T+ RSPH++
Sbjct: 15  LMAKSQKIRIRLKAYDHKALDQSASKIVETAKRTGAQVSGPIPLPTEKNIYTILRSPHIN 74

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+Q EMR +KRL+ I++PT +TVDALM+LD+ AGV++ IKL
Sbjct: 75  KDSREQFEMRTHKRLVDILEPTGKTVDALMRLDLPAGVDIEIKL 118


>gi|182412052|ref|YP_001817118.1| ribosomal protein S10 [Opitutus terrae PB90-1]
 gi|254809978|sp|B1ZNE9|RS10_OPITP RecName: Full=30S ribosomal protein S10
 gi|177839266|gb|ACB73518.1| ribosomal protein S10 [Opitutus terrae PB90-1]
          Length = 102

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 72/98 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I L+ FD R++D S  EIV T K+SG+++ GPIP P  + + +VNRSPHVDKKS +Q
Sbjct: 5   RIRIKLQGFDYRVIDQSALEIVETAKRSGARVSGPIPLPTRVEKLSVNRSPHVDKKSMEQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R +KRL+ II+PT QTVD L KL++ +GV++ I +
Sbjct: 65  FETRTHKRLIDIIEPTAQTVDELKKLNLPSGVDITINV 102


>gi|325956002|ref|YP_004286612.1| 30S ribosomal protein S10 [Lactobacillus acidophilus 30SC]
 gi|325332567|gb|ADZ06475.1| 30S ribosomal protein S10 [Lactobacillus acidophilus 30SC]
          Length = 102

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 55/104 (52%), Positives = 77/104 (74%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+ IRI   LK+++  ILD S  +IV T K++G++I GP+P P     FTV RSPH++
Sbjct: 1   MASQTIRIR--LKSYEHGILDESAAKIVATAKRTGAEISGPVPLPTERTLFTVLRSPHMN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+Q EMR +KRL+ I+ PTP+TVD+LMKLD+ +GV++ IKL
Sbjct: 59  KDSREQFEMRTHKRLIDILNPTPKTVDSLMKLDLPSGVDIEIKL 102


>gi|169830435|ref|YP_001716417.1| ribosomal protein S10 [Candidatus Desulforudis audaxviator MP104C]
 gi|226705433|sp|B1I1I7|RS10_DESAP RecName: Full=30S ribosomal protein S10
 gi|169637279|gb|ACA58785.1| ribosomal protein S10 [Candidatus Desulforudis audaxviator MP104C]
          Length = 102

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 74/98 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD  +LD S ++IV T +++G+ + GP+P P     +T+ RSPH DK SR+Q
Sbjct: 5   KIRIRLKAFDHHMLDQSAQKIVETVRRTGADVAGPVPLPTEKEIYTILRSPHKDKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRL+ I++PTP+TVDALM+LD+ AGV++ IKL
Sbjct: 65  FEIRTHKRLIDILEPTPKTVDALMRLDLPAGVDIEIKL 102


>gi|258543820|ref|ZP_05704054.1| 30S ribosomal protein S10 [Cardiobacterium hominis ATCC 15826]
 gi|258520909|gb|EEV89768.1| 30S ribosomal protein S10 [Cardiobacterium hominis ATCC 15826]
          Length = 104

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 76/98 (77%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D R++D+S ++IV T K++G+Q+ GP+P P     +TV  SPHV+K +RDQ
Sbjct: 6   KIRIRLKSYDHRLIDASAKQIVETAKRAGAQVKGPVPLPVKKEIYTVLISPHVNKDARDQ 65

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KR++ I+ PT +TVDALMKLD+AAGV+V I+L
Sbjct: 66  YEMRTHKRIMDIVDPTDKTVDALMKLDLAAGVDVKIEL 103


>gi|317050527|ref|YP_004111643.1| 30S ribosomal protein S10 [Desulfurispirillum indicum S5]
 gi|316945611|gb|ADU65087.1| ribosomal protein S10 [Desulfurispirillum indicum S5]
          Length = 104

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 76/104 (73%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           MT+ N +I I L+A+D +ILD++ +EIV T  ++ +++ GP+P P  I +F V RSPHV+
Sbjct: 1   MTAANQKIRIKLRAYDHKILDAAAKEIVETAGRTDAKVAGPVPLPTKIEKFCVIRSPHVN 60

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+Q EMR + RL+ I+ PT +T DALMKL++ +GV V IKL
Sbjct: 61  KNSREQFEMRTHVRLIDILDPTSKTTDALMKLNLPSGVEVEIKL 104


>gi|189485084|ref|YP_001956025.1| 30S ribosomal protein S10 [uncultured Termite group 1 bacterium
           phylotype Rs-D17]
 gi|170287043|dbj|BAG13564.1| 30S ribosomal protein S10 [uncultured Termite group 1 bacterium
           phylotype Rs-D17]
          Length = 108

 Score =  111 bits (277), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 77/98 (78%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           R+ I L+++D +ILD S+ +IV T +++G+ I GP+  P +I+++TVNRS H DKKSR+Q
Sbjct: 11  RLRIKLRSYDHKILDDSLAKIVETARRTGAAITGPVLLPTNIKKYTVNRSVHTDKKSREQ 70

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMRI+KRL+ I +P+ +TVD LMKLD+ AGV++ IK+
Sbjct: 71  FEMRIHKRLVDICEPSSKTVDELMKLDLPAGVDIEIKV 108


>gi|81429378|ref|YP_396379.1| 30S ribosomal protein S10 [Lactobacillus sakei subsp. sakei 23K]
 gi|115305624|sp|Q38UR1|RS10_LACSS RecName: Full=30S ribosomal protein S10
 gi|78611021|emb|CAI56073.1| 30S ribosomal protein S10 [Lactobacillus sakei subsp. sakei 23K]
          Length = 102

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 72/98 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAF+ RILD S  +IV T K++G+ I GPIP P     +TV RSPH  K SR+Q
Sbjct: 5   KIRIRLKAFEHRILDQSADKIVETAKRTGASISGPIPLPTERTLYTVLRSPHKHKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTP+TVD+LMKLD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDIVNPTPKTVDSLMKLDLPSGVDIEIKL 102


>gi|302337476|ref|YP_003802682.1| ribosomal protein S10 [Spirochaeta smaragdinae DSM 11293]
 gi|301634661|gb|ADK80088.1| ribosomal protein S10 [Spirochaeta smaragdinae DSM 11293]
          Length = 102

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 52/97 (53%), Positives = 72/97 (74%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI + L+ FD  ++D S R IV T  K+G+++ GP+P P  I +FTV RSPHV+KKSR+Q
Sbjct: 5   RIRVRLRGFDVELIDQSSRAIVQTVAKAGAKVAGPVPLPTRINKFTVLRSPHVNKKSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            EMR +KRL+ I+ PT + +DALMKL++ AGV+V IK
Sbjct: 65  FEMRTHKRLIDILDPTSKVMDALMKLELPAGVDVEIK 101


>gi|325288577|ref|YP_004264758.1| SSU ribosomal protein S10P [Syntrophobotulus glycolicus DSM 8271]
 gi|324963978|gb|ADY54757.1| SSU ribosomal protein S10P [Syntrophobotulus glycolicus DSM 8271]
          Length = 101

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 72/100 (72%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKAFD + LD S   IV T K++G+ + GPIP P     +T+ RSPHV+K SR
Sbjct: 2   NQKIRIRLKAFDHKTLDQSAERIVETAKRTGASVSGPIPLPTEKSVYTILRSPHVNKDSR 61

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KRL+ II PT +TVDALM+LD+ +GV++ IKL
Sbjct: 62  EQFEMRTHKRLIDIIDPTSKTVDALMRLDLPSGVDIEIKL 101


>gi|225158914|ref|ZP_03725228.1| ribosomal protein S10 [Opitutaceae bacterium TAV2]
 gi|224802532|gb|EEG20790.1| ribosomal protein S10 [Opitutaceae bacterium TAV2]
          Length = 102

 Score =  110 bits (276), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 72/98 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I L+ FD R++D S  EIV T K+SG+++ GP+P P  I + +VNRSPHVDKKS +Q
Sbjct: 5   RIRIKLQGFDYRVIDQSASEIVETAKRSGARVSGPVPLPVRIDKLSVNRSPHVDKKSMEQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R +KRL+ II+PT QTVD L KL++ +GV++ I +
Sbjct: 65  FETRTHKRLIDIIEPTAQTVDELKKLNLPSGVDITINV 102


>gi|302390957|ref|YP_003826777.1| 30S ribosomal protein S10P [Acetohalobium arabaticum DSM 5501]
 gi|302203034|gb|ADL11712.1| SSU ribosomal protein S10P [Acetohalobium arabaticum DSM 5501]
          Length = 105

 Score =  110 bits (276), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 75/98 (76%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA++ ++LD S  +IV T K++G+++ GP+P P     FTV RSPHV KK+R+Q
Sbjct: 8   KIRIRLKAYEHQVLDKSATKIVETAKRTGAEVSGPVPLPTKKEVFTVLRSPHVHKKAREQ 67

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I++PT +TVD+LM+LD+ AGV++ IKL
Sbjct: 68  FEMRTHKRLIDILEPTSKTVDSLMRLDLPAGVDIEIKL 105


>gi|238855067|ref|ZP_04645395.1| 30S ribosomal protein S10 [Lactobacillus jensenii 269-3]
 gi|282934050|ref|ZP_06339332.1| ribosomal protein S10 [Lactobacillus jensenii 208-1]
 gi|238832311|gb|EEQ24620.1| 30S ribosomal protein S10 [Lactobacillus jensenii 269-3]
 gi|281301882|gb|EFA94144.1| ribosomal protein S10 [Lactobacillus jensenii 208-1]
          Length = 176

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 55/104 (52%), Positives = 76/104 (73%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+ IRI   LK+++  ILD S  +IV T K++G++I GP+P P     FTV RSPH +
Sbjct: 75  MASQQIRIR--LKSYEHGILDESAAKIVATAKRTGAEISGPVPLPTERTLFTVLRSPHKN 132

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+Q EMR +KRL+ I+ PTP+TVD+LMKLD+ +GV++ IKL
Sbjct: 133 KDSREQFEMRTHKRLIDILNPTPKTVDSLMKLDLPSGVDIEIKL 176


>gi|295694836|ref|YP_003588074.1| ribosomal protein S10 [Bacillus tusciae DSM 2912]
 gi|295410438|gb|ADG04930.1| ribosomal protein S10 [Bacillus tusciae DSM 2912]
          Length = 102

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD RILD S  +IV T K+SG+ + GP+P P      T+ R+PH  K SR+Q
Sbjct: 5   KIRIRLKAFDHRILDQSAEKIVETAKRSGAGVSGPVPLPTERSVITILRAPHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTPQTVDALM+LD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDIVNPTPQTVDALMRLDLPSGVDIEIKL 102


>gi|256847762|ref|ZP_05553207.1| ribosomal protein S10 [Lactobacillus coleohominis 101-4-CHN]
 gi|256715451|gb|EEU30427.1| ribosomal protein S10 [Lactobacillus coleohominis 101-4-CHN]
          Length = 102

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 74/98 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA++ ++LD S  +IV T K++G+QI GPIP P     +TV RSPH  KKSR+Q
Sbjct: 5   KIRIRLKAYEHQVLDQSADKIVETAKRTGAQISGPIPLPTERTLYTVLRSPHKFKKSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTP+TVD+LMKLD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDIVDPTPKTVDSLMKLDLPSGVDIEIKL 102


>gi|297618385|ref|YP_003703544.1| ribosomal protein S10 [Syntrophothermus lipocalidus DSM 12680]
 gi|297146222|gb|ADI02979.1| ribosomal protein S10 [Syntrophothermus lipocalidus DSM 12680]
          Length = 103

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 73/98 (74%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           ++ I LKAFD ++LD S  +IV T KK+G+++ GPIP P     +T+ RSPHV+K SR+Q
Sbjct: 6   KVRIRLKAFDHKLLDQSASKIVETAKKNGAKVSGPIPLPTEKSIYTILRSPHVNKDSREQ 65

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ P P+T+DALM LD+ +GV++ IKL
Sbjct: 66  FEMRTHKRLIDILDPNPKTIDALMHLDLPSGVDIEIKL 103


>gi|260893373|ref|YP_003239470.1| ribosomal protein S10 [Ammonifex degensii KC4]
 gi|260865514|gb|ACX52620.1| ribosomal protein S10 [Ammonifex degensii KC4]
          Length = 102

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 74/98 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD  +LD S ++IV T K++G+Q+ GP+P P     +T+ RSPH DK SR+Q
Sbjct: 5   KIRIRLKAFDHYLLDQSAQKIVETAKRTGAQVAGPVPLPTDRSVYTILRSPHKDKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRL+ I+ PTP+T++ALM+LD+ AGV++ IKL
Sbjct: 65  FEIRTHKRLIDILDPTPKTIEALMRLDLPAGVDIEIKL 102


>gi|268680588|ref|YP_003305019.1| ribosomal protein S10 [Sulfurospirillum deleyianum DSM 6946]
 gi|268618619|gb|ACZ12984.1| ribosomal protein S10 [Sulfurospirillum deleyianum DSM 6946]
          Length = 103

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 52/97 (53%), Positives = 73/97 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + LKA+D R+LD S+  IV   K++G++IVGPIP P  I+R+TV RSPHV+K SR+Q
Sbjct: 3   KIRLKLKAYDHRVLDRSVAAIVEAVKRTGAEIVGPIPMPTKIKRYTVLRSPHVNKTSREQ 62

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            EMRI+ R++ I+  T  TVD+LMKLD+A  VNV ++
Sbjct: 63  FEMRIHARMIDIVSATTDTVDSLMKLDLAPEVNVEVR 99


>gi|309389934|gb|ADO77814.1| SSU ribosomal protein S10P [Halanaerobium praevalens DSM 2228]
          Length = 103

 Score =  110 bits (275), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 74/102 (72%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           +++ +I I LKAF+  +LD S  +IV T +++G+ + GP+P P     FTV RSPHV K 
Sbjct: 2   AKHEKIRIRLKAFEHELLDQSAEKIVATAERTGADVSGPVPLPTEKEVFTVLRSPHVHKD 61

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +R+Q EMR +KRL+ I+ PT +TVD+LM+LD+ AGVN+ IKL
Sbjct: 62  AREQFEMRTHKRLIDILDPTSKTVDSLMRLDLPAGVNIEIKL 103


>gi|256852035|ref|ZP_05557422.1| ribosomal protein S10 [Lactobacillus jensenii 27-2-CHN]
 gi|260661396|ref|ZP_05862309.1| ribosomal protein S10 [Lactobacillus jensenii 115-3-CHN]
 gi|282933635|ref|ZP_06339000.1| ribosomal protein S10 [Lactobacillus jensenii 208-1]
 gi|313472596|ref|ZP_07813085.1| ribosomal protein S10 [Lactobacillus jensenii 1153]
 gi|256615447|gb|EEU20637.1| ribosomal protein S10 [Lactobacillus jensenii 27-2-CHN]
 gi|260547851|gb|EEX23828.1| ribosomal protein S10 [Lactobacillus jensenii 115-3-CHN]
 gi|281302240|gb|EFA94477.1| ribosomal protein S10 [Lactobacillus jensenii 208-1]
 gi|313448953|gb|EFR61271.1| ribosomal protein S10 [Lactobacillus jensenii 1153]
          Length = 102

 Score =  110 bits (275), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 55/104 (52%), Positives = 76/104 (73%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+ IRI   LK+++  ILD S  +IV T K++G++I GP+P P     FTV RSPH +
Sbjct: 1   MASQQIRIR--LKSYEHGILDESAAKIVATAKRTGAEISGPVPLPTERTLFTVLRSPHKN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+Q EMR +KRL+ I+ PTP+TVD+LMKLD+ +GV++ IKL
Sbjct: 59  KDSREQFEMRTHKRLIDILNPTPKTVDSLMKLDLPSGVDIEIKL 102


>gi|58336629|ref|YP_193214.1| 30S ribosomal protein S10 [Lactobacillus acidophilus NCFM]
 gi|161506872|ref|YP_001576826.1| 30S ribosomal protein S10 [Lactobacillus helveticus DPC 4571]
 gi|227879242|ref|ZP_03997112.1| 30S ribosomal protein S10 [Lactobacillus crispatus JV-V01]
 gi|227894519|ref|ZP_04012324.1| 30S ribosomal protein S10 [Lactobacillus ultunensis DSM 16047]
 gi|227903186|ref|ZP_04020991.1| 30S ribosomal protein S10 [Lactobacillus acidophilus ATCC 4796]
 gi|256844428|ref|ZP_05549914.1| 30S ribosomal protein S10 [Lactobacillus crispatus 125-2-CHN]
 gi|256849184|ref|ZP_05554617.1| 30S ribosomal protein S10 [Lactobacillus crispatus MV-1A-US]
 gi|260102354|ref|ZP_05752591.1| 30S ribosomal protein S10 [Lactobacillus helveticus DSM 20075]
 gi|262047200|ref|ZP_06020158.1| 30S ribosomal protein S10 [Lactobacillus crispatus MV-3A-US]
 gi|293380376|ref|ZP_06626447.1| 30S ribosomal protein S10 [Lactobacillus crispatus 214-1]
 gi|295692159|ref|YP_003600769.1| 30S ribosomal protein s10 [Lactobacillus crispatus ST1]
 gi|315037529|ref|YP_004031097.1| 30S ribosomal protein S10 [Lactobacillus amylovorus GRL 1112]
 gi|75433040|sp|Q5FM91|RS10_LACAC RecName: Full=30S ribosomal protein S10
 gi|172048366|sp|A8YXK4|RS10_LACH4 RecName: Full=30S ribosomal protein S10
 gi|58253946|gb|AAV42183.1| 30S ribosomal protein S10 [Lactobacillus acidophilus NCFM]
 gi|160347861|gb|ABX26535.1| 30S ribosomal protein S10 [Lactobacillus helveticus DPC 4571]
 gi|227861136|gb|EEJ68785.1| 30S ribosomal protein S10 [Lactobacillus crispatus JV-V01]
 gi|227863678|gb|EEJ71099.1| 30S ribosomal protein S10 [Lactobacillus ultunensis DSM 16047]
 gi|227868991|gb|EEJ76412.1| 30S ribosomal protein S10 [Lactobacillus acidophilus ATCC 4796]
 gi|256613506|gb|EEU18709.1| 30S ribosomal protein S10 [Lactobacillus crispatus 125-2-CHN]
 gi|256713960|gb|EEU28948.1| 30S ribosomal protein S10 [Lactobacillus crispatus MV-1A-US]
 gi|260083798|gb|EEW67918.1| 30S ribosomal protein S10 [Lactobacillus helveticus DSM 20075]
 gi|260572445|gb|EEX29007.1| 30S ribosomal protein S10 [Lactobacillus crispatus MV-3A-US]
 gi|290923059|gb|EFD99990.1| 30S ribosomal protein S10 [Lactobacillus crispatus 214-1]
 gi|295030265|emb|CBL49744.1| 30S ribosomal protein S10 [Lactobacillus crispatus ST1]
 gi|312275662|gb|ADQ58302.1| 30S ribosomal protein S10 [Lactobacillus amylovorus GRL 1112]
 gi|323465823|gb|ADX69510.1| 30S ribosomal protein S10 [Lactobacillus helveticus H10]
 gi|327182825|gb|AEA31272.1| 30S ribosomal protein S10 [Lactobacillus amylovorus GRL 1118]
 gi|328463363|gb|EGF35036.1| 30S ribosomal protein S10 [Lactobacillus helveticus MTCC 5463]
          Length = 102

 Score =  110 bits (275), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 55/104 (52%), Positives = 76/104 (73%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+ IRI   LK+++  ILD S  +IV T K++G++I GP+P P     FTV RSPH +
Sbjct: 1   MASQTIRIR--LKSYEHGILDESAAKIVATAKRTGAEISGPVPLPTERTLFTVLRSPHKN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+Q EMR +KRL+ I+ PTP+TVD+LMKLD+ +GV++ IKL
Sbjct: 59  KDSREQFEMRTHKRLIDILNPTPKTVDSLMKLDLPSGVDIEIKL 102


>gi|291613235|ref|YP_003523392.1| ribosomal protein S10 [Sideroxydans lithotrophicus ES-1]
 gi|291583347|gb|ADE11005.1| ribosomal protein S10 [Sideroxydans lithotrophicus ES-1]
          Length = 103

 Score =  110 bits (275), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 58/104 (55%), Positives = 75/104 (72%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+ IRI   LKAFD R++D S  +IV T K++G+ + GP+P P  I R  V RSPHV+
Sbjct: 1   MQSQKIRIR--LKAFDYRLIDQSALQIVDTAKRTGAVVKGPVPLPTKIERIDVLRSPHVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SRDQ E+R + RL+ I+ PT +TVDALMKLD+ AGV+V IKL
Sbjct: 59  KTSRDQFEIRTHLRLMDIMDPTDKTVDALMKLDLPAGVDVEIKL 102


>gi|300812365|ref|ZP_07092800.1| ribosomal protein S10 [Lactobacillus delbrueckii subsp. bulgaricus
           PB2003/044-T3-4]
 gi|300496670|gb|EFK31757.1| ribosomal protein S10 [Lactobacillus delbrueckii subsp. bulgaricus
           PB2003/044-T3-4]
          Length = 102

 Score =  110 bits (274), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 74/100 (74%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LK+++  ILD S  +IV T K++G++I GP+P P     FTV RSPH +K SR
Sbjct: 3   NEKIRIRLKSYEHSILDESAAKIVDTAKRTGAEISGPVPLPSERTLFTVLRSPHKNKDSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KRL+ I+ PTP+TVD+LMKLD+ +GV++ IKL
Sbjct: 63  EQFEMRTHKRLIDILNPTPKTVDSLMKLDLPSGVDIEIKL 102


>gi|309808477|ref|ZP_07702376.1| ribosomal protein S10 [Lactobacillus iners LactinV 01V1-a]
 gi|312874089|ref|ZP_07734124.1| ribosomal protein S10 [Lactobacillus iners LEAF 2052A-d]
 gi|308168305|gb|EFO70424.1| ribosomal protein S10 [Lactobacillus iners LactinV 01V1-a]
 gi|311090429|gb|EFQ48838.1| ribosomal protein S10 [Lactobacillus iners LEAF 2052A-d]
          Length = 102

 Score =  110 bits (274), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 54/104 (51%), Positives = 76/104 (73%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+ IRI   LK+++  ILD S  +IV T +++G++I GP+P P     FTV RSPH D
Sbjct: 1   MASQQIRIR--LKSYEHSILDESAAKIVATAQRTGAEISGPVPLPTERTLFTVLRSPHKD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+Q E+R +KRL+ I+ PTP+TVD+LMKLD+ +GV++ IKL
Sbjct: 59  KDSREQFEIRTHKRLIDIVNPTPKTVDSLMKLDLPSGVDIEIKL 102


>gi|313123110|ref|YP_004033369.1| orn/lys/arg decarboxylase, major region [Lactobacillus delbrueckii
           subsp. bulgaricus ND02]
 gi|312279673|gb|ADQ60392.1| Orn/Lys/Arg decarboxylase, major region [Lactobacillus delbrueckii
           subsp. bulgaricus ND02]
 gi|325684719|gb|EGD26873.1| 30S ribosomal protein S10 [Lactobacillus delbrueckii subsp. lactis
           DSM 20072]
          Length = 102

 Score =  110 bits (274), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 74/100 (74%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LK+++  ILD S  +IV T K++G++I GP+P P     FTV RSPH +K SR
Sbjct: 3   NEKIRIRLKSYEHSILDESAAKIVDTAKRTGAEISGPVPLPTERTLFTVLRSPHKNKDSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KRL+ I+ PTP+TVD+LMKLD+ +GV++ IKL
Sbjct: 63  EQFEMRTHKRLIDILSPTPKTVDSLMKLDLPSGVDIEIKL 102


>gi|121534758|ref|ZP_01666579.1| ribosomal protein S10 [Thermosinus carboxydivorans Nor1]
 gi|121306778|gb|EAX47699.1| ribosomal protein S10 [Thermosinus carboxydivorans Nor1]
          Length = 103

 Score =  110 bits (274), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 54/102 (52%), Positives = 74/102 (72%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           ++  +I I LKA+D + LD S   IV T K++GS + GPIP P     FT+ RSPHV+K 
Sbjct: 2   AKQQKIRIRLKAYDHKALDQSAARIVETAKRTGSIVSGPIPLPTEKNIFTILRSPHVNKD 61

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           SR+Q EMR +KRL+ I++PT +TVDALM+LD+ AGV++ IKL
Sbjct: 62  SREQFEMRTHKRLIDILEPTSKTVDALMRLDLPAGVDIEIKL 103


>gi|227888854|ref|ZP_04006659.1| 30S ribosomal protein S10 [Lactobacillus johnsonii ATCC 33200]
 gi|227850691|gb|EEJ60777.1| 30S ribosomal protein S10 [Lactobacillus johnsonii ATCC 33200]
 gi|329666691|gb|AEB92639.1| 30S ribosomal protein S10 [Lactobacillus johnsonii DPC 6026]
          Length = 102

 Score =  110 bits (274), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 54/104 (51%), Positives = 77/104 (74%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+ IRI   LK+++  ILD S  +IV T +++G+QI GP+P P     FTV RSPH++
Sbjct: 1   MASQQIRIR--LKSYEHGILDESAAKIVATAERTGAQISGPVPLPTERTLFTVLRSPHMN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+Q E+R +KRL+ I+ PTP+TVD+LMKLD+ +GV++ IKL
Sbjct: 59  KDSREQFEIRTHKRLIDILNPTPKTVDSLMKLDLPSGVDIEIKL 102


>gi|116495948|ref|YP_807682.1| 30S ribosomal protein S10 [Lactobacillus casei ATCC 334]
 gi|191639429|ref|YP_001988595.1| 30S ribosomal protein S10 [Lactobacillus casei BL23]
 gi|227533959|ref|ZP_03964008.1| 30S ribosomal protein S10 [Lactobacillus paracasei subsp. paracasei
           ATCC 25302]
 gi|239630352|ref|ZP_04673383.1| 30S ribosomal protein S10 [Lactobacillus paracasei subsp. paracasei
           8700:2]
 gi|301067504|ref|YP_003789527.1| 30S ribosomal protein L10 [Lactobacillus casei str. Zhang]
 gi|122262652|sp|Q034Y2|RS10_LACC3 RecName: Full=30S ribosomal protein S10
 gi|226705583|sp|B3WAL8|RS10_LACCB RecName: Full=30S ribosomal protein S10
 gi|116106098|gb|ABJ71240.1| SSU ribosomal protein S10P [Lactobacillus casei ATCC 334]
 gi|190713731|emb|CAQ67737.1| 30S ribosomal protein S10 [Lactobacillus casei BL23]
 gi|227188336|gb|EEI68403.1| 30S ribosomal protein S10 [Lactobacillus paracasei subsp. paracasei
           ATCC 25302]
 gi|239527964|gb|EEQ66965.1| 30S ribosomal protein S10 [Lactobacillus paracasei subsp. paracasei
           8700:2]
 gi|300439911|gb|ADK19677.1| Ribosomal protein S10 [Lactobacillus casei str. Zhang]
 gi|327383518|gb|AEA54994.1| 30S ribosomal protein S10 [Lactobacillus casei LC2W]
 gi|327386711|gb|AEA58185.1| 30S ribosomal protein S10 [Lactobacillus casei BD-II]
          Length = 102

 Score =  110 bits (274), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 72/98 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA++ RILD S  +IV T K++G+ I GPIP P     +TV RSPH  K SR+Q
Sbjct: 5   KIRIRLKAYEHRILDQSADKIVETAKRTGATISGPIPLPTERTLYTVLRSPHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTP+TVDALMKLD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDIVNPTPKTVDALMKLDLPSGVDIEIKL 102


>gi|114567842|ref|YP_754996.1| 30S ribosomal protein S10 [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
 gi|114338777|gb|ABI69625.1| SSU ribosomal protein S10P [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
          Length = 103

 Score =  109 bits (273), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 73/98 (74%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           ++ I LKAFD ++LD S ++IV T +K+GS + GPIP P     +T+ RSPHV+K SR+Q
Sbjct: 6   KVRIRLKAFDHKLLDQSSQKIVETARKNGSGVSGPIPLPTEKSIYTILRSPHVNKDSREQ 65

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ P P+T+DALM LD+ +GV++ IKL
Sbjct: 66  FEMRTHKRLIDILDPNPRTIDALMHLDLPSGVDIEIKL 103


>gi|308185072|ref|YP_003929205.1| 30S ribosomal protein S10 [Helicobacter pylori SJM180]
 gi|308060992|gb|ADO02888.1| 30S ribosomal protein S10 [Helicobacter pylori SJM180]
          Length = 104

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 72/96 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + LKA+D R+LD S+  IV   K+SGS+I GPIP P   +R+TV RSPHV+K SR+Q
Sbjct: 3   KIRLKLKAYDHRVLDRSVVAIVEAVKRSGSEIRGPIPLPTKNKRYTVLRSPHVNKNSREQ 62

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVI 102
            E+R+Y RL+ II  TP+TVD+LMKLD+A  V+V +
Sbjct: 63  FEIRVYSRLIDIISATPETVDSLMKLDLAPEVDVEV 98


>gi|260881640|ref|ZP_05404911.2| ribosomal protein S10 [Mitsuokella multacida DSM 20544]
 gi|260848054|gb|EEX68061.1| ribosomal protein S10 [Mitsuokella multacida DSM 20544]
          Length = 117

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 54/102 (52%), Positives = 75/102 (73%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           S+  +I I LKA+D + LD S  +IV T KK+G+ + GPIP P     +T+ RSPHV+K 
Sbjct: 16  SKQQKIRIRLKAYDHKALDQSAVKIVDTAKKTGAMVSGPIPLPTEKNIYTILRSPHVNKD 75

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           SR+Q EMR +KRL+ I++PT +TVDALM+LD+ AGV++ IKL
Sbjct: 76  SREQFEMRTHKRLIDILQPTNKTVDALMRLDLPAGVDIEIKL 117


>gi|187251823|ref|YP_001876305.1| 30S ribosomal protein S10 [Elusimicrobium minutum Pei191]
 gi|186971983|gb|ACC98968.1| Ribosomal protein S10 [Elusimicrobium minutum Pei191]
          Length = 117

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 53/97 (54%), Positives = 73/97 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I L+++D R+LD S+  IV T KK+G+ + GP+  P  I+++T+ RSPH DKKSR+Q
Sbjct: 19  RIRIKLRSYDHRMLDQSVSRIVDTAKKTGAIVSGPVLLPVRIKKYTLLRSPHTDKKSREQ 78

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            EMRI+KRL+ +  PT +TVD LMKLD+ AGV+V IK
Sbjct: 79  FEMRIHKRLIDLKSPTAKTVDELMKLDLPAGVDVAIK 115


>gi|317181042|dbj|BAJ58828.1| 30S ribosomal protein S10 [Helicobacter pylori F32]
          Length = 104

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 72/96 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + LKA+D R+LD S+  IV   K+SGS+I GPIP P   +R+TV RSPHV+K SR+Q
Sbjct: 3   KIRLKLKAYDHRVLDRSVVSIVEAVKRSGSEIRGPIPLPTKNKRYTVLRSPHVNKDSREQ 62

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVI 102
            E+R+Y RL+ II  TP+TVD+LMKLD+A  V+V +
Sbjct: 63  FEIRVYSRLIDIISATPETVDSLMKLDLAPEVDVEV 98


>gi|261838639|gb|ACX98405.1| ribosomal protein S10 [Helicobacter pylori 51]
          Length = 106

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 72/96 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + LKA+D R+LD S+  IV   K+SGS+I GPIP P   +R+TV RSPHV+K SR+Q
Sbjct: 3   KIRLKLKAYDHRVLDRSVVAIVEAVKRSGSEIRGPIPLPTKNKRYTVLRSPHVNKDSREQ 62

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVI 102
            E+R+Y RL+ II  TP+TVD+LMKLD+A  V+V +
Sbjct: 63  FEIRVYSRLIDIISATPETVDSLMKLDLAPEVDVEV 98


>gi|299541931|ref|ZP_07052254.1| 30S ribosomal protein S10 [Lysinibacillus fusiformis ZC1]
 gi|298725669|gb|EFI66310.1| 30S ribosomal protein S10 [Lysinibacillus fusiformis ZC1]
          Length = 102

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D RILD S  +IV T K+SG+ + GPIP P     +T+ R+ H  K SR+Q
Sbjct: 5   KIRIRLKAYDHRILDQSAEKIVETAKRSGASVSGPIPLPTEKSVYTILRAVHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTPQTVDALMKLD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDIVNPTPQTVDALMKLDLPSGVDIEIKL 102


>gi|104773541|ref|YP_618521.1| 30S ribosomal protein S10 [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC 11842]
 gi|116513538|ref|YP_812444.1| 30S ribosomal protein S10 [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC BAA-365]
 gi|118597182|sp|Q1GBL9|RS10_LACDA RecName: Full=30S ribosomal protein S10
 gi|122275692|sp|Q04C16|RS10_LACDB RecName: Full=30S ribosomal protein S10
 gi|103422622|emb|CAI97230.1| 30S ribosomal protein S10 [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC 11842]
 gi|116092853|gb|ABJ58006.1| SSU ribosomal protein S10P [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC BAA-365]
 gi|325125174|gb|ADY84504.1| 30S ribosomal protein S10 [Lactobacillus delbrueckii subsp.
           bulgaricus 2038]
          Length = 102

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 74/100 (74%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LK+++  ILD S  +IV T K++G++I GP+P P     FTV RSPH +K SR
Sbjct: 3   NEKIRIRLKSYEHSILDESGAKIVDTAKRTGAEISGPVPLPTERTLFTVLRSPHKNKDSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KRL+ I+ PTP+TVD+LMKLD+ +GV++ IKL
Sbjct: 63  EQFEMRTHKRLIDILNPTPKTVDSLMKLDLPSGVDIEIKL 102


>gi|15612305|ref|NP_223958.1| 30S ribosomal protein S10 [Helicobacter pylori J99]
 gi|15645933|ref|NP_208112.1| 30S ribosomal protein S10 [Helicobacter pylori 26695]
 gi|108563690|ref|YP_628006.1| 30S ribosomal protein S10 [Helicobacter pylori HPAG1]
 gi|109946758|ref|YP_663986.1| 30S ribosomal protein S10 [Helicobacter acinonychis str. Sheeba]
 gi|188528108|ref|YP_001910795.1| 30S ribosomal protein S10 [Helicobacter pylori Shi470]
 gi|207091948|ref|ZP_03239735.1| 30S ribosomal protein S10 [Helicobacter pylori HPKX_438_AG0C1]
 gi|208435217|ref|YP_002266883.1| ribosomal protein S10 [Helicobacter pylori G27]
 gi|217032073|ref|ZP_03437573.1| hypothetical protein HPB128_16g33 [Helicobacter pylori B128]
 gi|217033637|ref|ZP_03439065.1| hypothetical protein HP9810_899g73 [Helicobacter pylori 98-10]
 gi|298735655|ref|YP_003728180.1| 30S ribosomal protein S10 [Helicobacter pylori B8]
 gi|308183430|ref|YP_003927557.1| 30S ribosomal protein S10 [Helicobacter pylori PeCan4]
 gi|54039317|sp|P66329|RS10_HELPJ RecName: Full=30S ribosomal protein S10
 gi|54042098|sp|P66328|RS10_HELPY RecName: Full=30S ribosomal protein S10
 gi|118597180|sp|Q1CRU0|RS10_HELPH RecName: Full=30S ribosomal protein S10
 gi|122973453|sp|Q17ZD9|RS10_HELAH RecName: Full=30S ribosomal protein S10
 gi|226705577|sp|B5Z8W8|RS10_HELPG RecName: Full=30S ribosomal protein S10
 gi|226705578|sp|B2UV83|RS10_HELPS RecName: Full=30S ribosomal protein S10
 gi|2314482|gb|AAD08359.1| ribosomal protein S10 (rps10) [Helicobacter pylori 26695]
 gi|4155817|gb|AAD06791.1| 30S RIBOSOMAL PROTEIN S10 [Helicobacter pylori J99]
 gi|107837463|gb|ABF85332.1| ribosomal protein S10 [Helicobacter pylori HPAG1]
 gi|109713979|emb|CAJ98987.1| 30S ribosomal protein S10 [Helicobacter acinonychis str. Sheeba]
 gi|188144348|gb|ACD48765.1| 30S ribosomal protein S10 [Helicobacter pylori Shi470]
 gi|208433146|gb|ACI28017.1| ribosomal protein S10 [Helicobacter pylori G27]
 gi|216943983|gb|EEC23417.1| hypothetical protein HP9810_899g73 [Helicobacter pylori 98-10]
 gi|216946221|gb|EEC24829.1| hypothetical protein HPB128_16g33 [Helicobacter pylori B128]
 gi|261840035|gb|ACX99800.1| 30S ribosomal protein S10 [Helicobacter pylori 52]
 gi|297380501|gb|ADI35388.1| ribosomal protein S10 [Helicobacter pylori v225d]
 gi|298354844|emb|CBI65716.1| small subunit ribosomal protein S10 [Helicobacter pylori B8]
 gi|307637991|gb|ADN80441.1| SSU ribosomal protein S10p:S20e [Helicobacter pylori 908]
 gi|308062605|gb|ADO04493.1| 30S ribosomal protein S10 [Helicobacter pylori Cuz20]
 gi|308064097|gb|ADO05984.1| 30S ribosomal protein S10 [Helicobacter pylori Sat464]
 gi|308065615|gb|ADO07507.1| 30S ribosomal protein S10 [Helicobacter pylori PeCan4]
 gi|317010003|gb|ADU80583.1| 30S ribosomal protein S10 [Helicobacter pylori India7]
 gi|317011520|gb|ADU85267.1| 30S ribosomal protein S10 [Helicobacter pylori SouthAfrica7]
 gi|317013107|gb|ADU83715.1| 30S ribosomal protein S10 [Helicobacter pylori Lithuania75]
 gi|317014711|gb|ADU82147.1| 30S ribosomal protein S10 [Helicobacter pylori Gambia94/24]
 gi|317178059|dbj|BAJ55848.1| 30S ribosomal protein S10 [Helicobacter pylori F16]
 gi|317178389|dbj|BAJ56177.1| 30S ribosomal protein S10 [Helicobacter pylori F30]
 gi|317182566|dbj|BAJ60350.1| 30S ribosomal protein S10 [Helicobacter pylori F57]
 gi|325996596|gb|ADZ52001.1| 30S ribosomal protein S10 [Helicobacter pylori 2018]
 gi|325998186|gb|ADZ50394.1| 30S ribosomal protein S10 [Helicobacter pylori 2017]
          Length = 104

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 72/96 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + LKA+D R+LD S+  IV   K+SGS+I GPIP P   +R+TV RSPHV+K SR+Q
Sbjct: 3   KIRLKLKAYDHRVLDRSVVAIVEAVKRSGSEIRGPIPLPTKNKRYTVLRSPHVNKDSREQ 62

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVI 102
            E+R+Y RL+ II  TP+TVD+LMKLD+A  V+V +
Sbjct: 63  FEIRVYSRLIDIISATPETVDSLMKLDLAPEVDVEV 98


>gi|291298709|ref|YP_003509987.1| 30S ribosomal protein S10 [Stackebrandtia nassauensis DSM 44728]
 gi|290567929|gb|ADD40894.1| ribosomal protein S10 [Stackebrandtia nassauensis DSM 44728]
          Length = 102

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 54/104 (51%), Positives = 74/104 (71%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LKA+D  ++DSS R+IV T  ++G+ I GP+P P  + RF V RSPH  
Sbjct: 1   MAGQKIRIR--LKAYDHDVVDSSARKIVETVTRTGANIAGPVPLPTELNRFCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+  EMR +KRL+ I+ PTP+TVD+LM+LD+ AGV++ IKL
Sbjct: 59  KDSREHFEMRTHKRLIDILDPTPKTVDSLMRLDLPAGVDIEIKL 102


>gi|315587209|gb|ADU41590.1| 30S ribosomal protein S10 [Helicobacter pylori 35A]
          Length = 113

 Score =  109 bits (272), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 72/96 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + LKA+D R+LD S+  IV   K+SGS+I GPIP P   +R+TV RSPHV+K SR+Q
Sbjct: 12  KIRLKLKAYDHRVLDRSVVAIVEAVKRSGSEIRGPIPLPTKNKRYTVLRSPHVNKDSREQ 71

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVI 102
            E+R+Y RL+ II  TP+TVD+LMKLD+A  V+V +
Sbjct: 72  FEIRVYSRLIDIISATPETVDSLMKLDLAPEVDVEV 107


>gi|303240972|ref|ZP_07327483.1| ribosomal protein S10 [Acetivibrio cellulolyticus CD2]
 gi|302591558|gb|EFL61295.1| ribosomal protein S10 [Acetivibrio cellulolyticus CD2]
          Length = 103

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 72/98 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD ++LD S  +IV T K++G+Q+ GP+P P      T+ R+PH  K SR+Q
Sbjct: 6   KIRIRLKAFDHQVLDQSAEKIVETAKRTGAQVSGPVPLPTEKEIITILRAPHKYKDSREQ 65

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTP+TVDALM+LD+ AGV++ IKL
Sbjct: 66  FEMRTHKRLIDILLPTPKTVDALMRLDLPAGVDIEIKL 103


>gi|304438361|ref|ZP_07398302.1| 30S ribosomal protein S10 [Selenomonas sp. oral taxon 149 str.
           67H29BP]
 gi|313895016|ref|ZP_07828573.1| ribosomal protein S10 [Selenomonas sp. oral taxon 137 str. F0430]
 gi|320529795|ref|ZP_08030872.1| ribosomal protein S10 [Selenomonas artemidis F0399]
 gi|304368727|gb|EFM22411.1| 30S ribosomal protein S10 [Selenomonas sp. oral taxon 149 str.
           67H29BP]
 gi|312975911|gb|EFR41369.1| ribosomal protein S10 [Selenomonas sp. oral taxon 137 str. F0430]
 gi|320137813|gb|EFW29718.1| ribosomal protein S10 [Selenomonas artemidis F0399]
          Length = 103

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 52/102 (50%), Positives = 75/102 (73%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           ++  +I I LKA+D + LD S  +IV T KK+G+ + GPIP P     +T+ RSPHV+K 
Sbjct: 2   AKQQKIRIRLKAYDHKALDQSAAKIVDTAKKTGAMVSGPIPLPTEKNVYTILRSPHVNKD 61

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           SR+Q EMR +KRL+ I++PT +TVD+LM+LD+ AGV++ IKL
Sbjct: 62  SREQFEMRTHKRLIDILQPTNKTVDSLMRLDLPAGVDIEIKL 103


>gi|295425653|ref|ZP_06818340.1| 30S ribosomal protein S10 [Lactobacillus amylolyticus DSM 11664]
 gi|295064669|gb|EFG55590.1| 30S ribosomal protein S10 [Lactobacillus amylolyticus DSM 11664]
          Length = 102

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 54/104 (51%), Positives = 76/104 (73%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+ IRI   LK+++  ILD S  +IV + K++G++I GP+P P     FTV RSPH +
Sbjct: 1   MASQTIRIR--LKSYEHGILDESAAKIVASAKRTGAEISGPVPLPTERTLFTVLRSPHKN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+Q EMR +KRL+ I+ PTP+TVD+LMKLD+ +GV++ IKL
Sbjct: 59  KDSREQFEMRTHKRLIDILNPTPKTVDSLMKLDLPSGVDIEIKL 102


>gi|312144248|ref|YP_003995694.1| ribosomal protein S10 [Halanaerobium sp. 'sapolanicus']
 gi|311904899|gb|ADQ15340.1| ribosomal protein S10 [Halanaerobium sp. 'sapolanicus']
          Length = 103

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 74/102 (72%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           +++ +I I LKA++  +LD S  +IV T +++G+ + GP+P P     FTV RSPHV K 
Sbjct: 2   AKHEKIRIRLKAYEHELLDQSAEKIVETAERTGADVSGPVPLPTEKEVFTVLRSPHVHKD 61

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +R+Q EMR +KRL+ I+ PT +TVD+LM+LD+ AGVN+ IKL
Sbjct: 62  AREQFEMRTHKRLIDILDPTSKTVDSLMRLDLPAGVNIEIKL 103


>gi|254779862|ref|YP_003057968.1| 30S ribosomal protein S10 [Helicobacter pylori B38]
 gi|254001774|emb|CAX30005.1| 30S ribosomal subunit protein S10 [Helicobacter pylori B38]
          Length = 104

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 71/96 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + LKA+D R+LD S+  IV   K+SGS+I GPIP P   +R+TV RSPHV+K SR+Q
Sbjct: 3   KIRLKLKAYDHRVLDRSVVAIVEAVKRSGSEIRGPIPLPTKNKRYTVLRSPHVNKDSREQ 62

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVI 102
            E+R+Y RL+ II  TP+TVD+LMKLD+A  V V +
Sbjct: 63  FEIRVYSRLIDIISATPETVDSLMKLDLAPEVGVEV 98


>gi|227499196|ref|ZP_03929331.1| 30S ribosomal protein S10 [Acidaminococcus sp. D21]
 gi|226904643|gb|EEH90561.1| 30S ribosomal protein S10 [Acidaminococcus sp. D21]
          Length = 103

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 75/101 (74%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           ++  +I I LKA+D + LD S  +IV T K++G+Q+ GPIP P     +T+ RSPHV+K 
Sbjct: 2   AKTQKIRIRLKAYDYKALDLSASKIVETAKRTGAQVSGPIPLPTEKNIYTILRSPHVNKD 61

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           SR+Q EMR +KRL+ I++PTP+T+DAL +LD+ AGV++ IK
Sbjct: 62  SREQFEMRTHKRLVDILEPTPKTIDALTRLDLPAGVDIEIK 102


>gi|199598831|ref|ZP_03212242.1| 30S ribosomal protein S10 [Lactobacillus rhamnosus HN001]
 gi|229552707|ref|ZP_04441432.1| ribosomal protein S10 [Lactobacillus rhamnosus LMS2-1]
 gi|258509483|ref|YP_003172234.1| 30S ribosomal protein S10 [Lactobacillus rhamnosus GG]
 gi|258540680|ref|YP_003175179.1| 30S ribosomal protein S10 [Lactobacillus rhamnosus Lc 705]
 gi|199590243|gb|EDY98338.1| 30S ribosomal protein S10 [Lactobacillus rhamnosus HN001]
 gi|229313913|gb|EEN79886.1| ribosomal protein S10 [Lactobacillus rhamnosus LMS2-1]
 gi|257149410|emb|CAR88383.1| SSU/30S ribosomal protein S10P [Lactobacillus rhamnosus GG]
 gi|257152356|emb|CAR91328.1| SSU/30S ribosomal protein S10P [Lactobacillus rhamnosus Lc 705]
 gi|259650762|dbj|BAI42924.1| 30S ribosomal protein S10 [Lactobacillus rhamnosus GG]
 gi|328478149|gb|EGF47997.1| 30S ribosomal protein S10 [Lactobacillus rhamnosus MTCC 5462]
          Length = 102

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 72/98 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA++ RILD S  +IV T K++G+ I GPIP P     +TV RSPH  K SR+Q
Sbjct: 5   KIRIRLKAYEHRILDQSADKIVDTAKRTGATISGPIPLPTERTIYTVLRSPHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTP+TVDALMKLD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDIVNPTPKTVDALMKLDLPSGVDIEIKL 102


>gi|327438277|dbj|BAK14642.1| ribosomal protein S10 [Solibacillus silvestris StLB046]
          Length = 102

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D RILD S  +IV T K+SG+ + GPIP P     +T+ R+ H  K SR+Q
Sbjct: 5   KIRIRLKAYDHRILDQSAEKIVETAKRSGAGVSGPIPLPTERSVYTILRAVHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTPQTVDALMKLD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDIVNPTPQTVDALMKLDLPSGVDIEIKL 102


>gi|317126860|ref|YP_004093142.1| ribosomal protein S10 [Bacillus cellulosilyticus DSM 2522]
 gi|315471808|gb|ADU28411.1| ribosomal protein S10 [Bacillus cellulosilyticus DSM 2522]
          Length = 102

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D RILD S  +IV T K+SG+ + GPIP P     +T+ R+ H  K SR+Q
Sbjct: 5   KIRIRLKAYDHRILDQSAEKIVETAKRSGASVAGPIPLPTEKSIYTILRAVHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTPQTVDALM+LD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDIVNPTPQTVDALMRLDLPSGVDIEIKL 102


>gi|293375388|ref|ZP_06621669.1| ribosomal protein S10 [Turicibacter sanguinis PC909]
 gi|325844447|ref|ZP_08168174.1| ribosomal protein S10 [Turicibacter sp. HGF1]
 gi|292645941|gb|EFF63970.1| ribosomal protein S10 [Turicibacter sanguinis PC909]
 gi|325489121|gb|EGC91505.1| ribosomal protein S10 [Turicibacter sp. HGF1]
          Length = 102

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 74/98 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D RILD S  +IV + KK+G+++ GPIP P   + +T+ R+ H  K SR+Q
Sbjct: 5   KIRIRLKAYDHRILDQSAEKIVESAKKTGAKVAGPIPLPTEKQVYTILRAVHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I++PTPQTVD+LM+LD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDIVEPTPQTVDSLMRLDLPSGVDIEIKL 102


>gi|42518428|ref|NP_964358.1| 30S ribosomal protein S10 [Lactobacillus johnsonii NCC 533]
 gi|116628962|ref|YP_814134.1| 30S ribosomal protein S10 [Lactobacillus gasseri ATCC 33323]
 gi|238853484|ref|ZP_04643862.1| ribosomal protein S10 [Lactobacillus gasseri 202-4]
 gi|268318850|ref|YP_003292506.1| ribosomal protein S10 [Lactobacillus johnsonii FI9785]
 gi|282852648|ref|ZP_06261990.1| ribosomal protein S10 [Lactobacillus gasseri 224-1]
 gi|300362390|ref|ZP_07058566.1| 30S ribosomal protein S10 [Lactobacillus gasseri JV-V03]
 gi|311111237|ref|ZP_07712634.1| ribosomal protein S10 [Lactobacillus gasseri MV-22]
 gi|54036389|sp|Q74L89|RS10_LACJO RecName: Full=30S ribosomal protein S10
 gi|122274040|sp|Q046C6|RS10_LACGA RecName: Full=30S ribosomal protein S10
 gi|41582713|gb|AAS08324.1| 30S ribosomal protein S10 [Lactobacillus johnsonii NCC 533]
 gi|116094544|gb|ABJ59696.1| SSU ribosomal protein S10P [Lactobacillus gasseri ATCC 33323]
 gi|238833924|gb|EEQ26183.1| ribosomal protein S10 [Lactobacillus gasseri 202-4]
 gi|262397225|emb|CAX66239.1| ribosomal protein S10 [Lactobacillus johnsonii FI9785]
 gi|282556390|gb|EFB62010.1| ribosomal protein S10 [Lactobacillus gasseri 224-1]
 gi|300353381|gb|EFJ69253.1| 30S ribosomal protein S10 [Lactobacillus gasseri JV-V03]
 gi|311066391|gb|EFQ46731.1| ribosomal protein S10 [Lactobacillus gasseri MV-22]
          Length = 102

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 54/104 (51%), Positives = 76/104 (73%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+ IRI   LK+++  ILD S  +IV T +++G+QI GP+P P     FTV RSPH +
Sbjct: 1   MASQQIRIR--LKSYEHGILDESAAKIVATAERTGAQISGPVPLPTERTLFTVLRSPHKN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+Q E+R +KRL+ I+ PTP+TVD+LMKLD+ +GV++ IKL
Sbjct: 59  KDSREQFEIRTHKRLIDILNPTPKTVDSLMKLDLPSGVDIEIKL 102


>gi|237802863|ref|YP_002888057.1| 30S ribosomal protein S10 [Chlamydia trachomatis B/Jali20/OT]
 gi|231274097|emb|CAX10891.1| SSU ribosomal protein S10P [Chlamydia trachomatis B/Jali20/OT]
          Length = 108

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 71/103 (68%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +  RI ICLK FD   LD S   IV T K++G+++VGPIP P     +TV RSPHVD
Sbjct: 1   MKQQKQRIRICLKGFDQGQLDQSTANIVETAKRTGARVVGPIPLPTKREVYTVLRSPHVD 60

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           KKSR+Q E+R +KRL+ I+ PT +T+DAL  L + AGV++ IK
Sbjct: 61  KKSREQFEIRTHKRLIDILDPTGKTIDALKMLSLPAGVDIKIK 103


>gi|90962407|ref|YP_536323.1| 30S ribosomal protein S10 [Lactobacillus salivarius UCC118]
 gi|301300227|ref|ZP_07206439.1| ribosomal protein S10 [Lactobacillus salivarius ACS-116-V-Col5a]
 gi|118597183|sp|Q1WS89|RS10_LACS1 RecName: Full=30S ribosomal protein S10
 gi|90821601|gb|ABE00240.1| SSU ribosomal protein S10P [Lactobacillus salivarius UCC118]
 gi|300852168|gb|EFK79840.1| ribosomal protein S10 [Lactobacillus salivarius ACS-116-V-Col5a]
          Length = 102

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 72/98 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA++ RILD S  +IV T K++G+ I GPIP P     +TV RSPH  K SR+Q
Sbjct: 5   KIRIRLKAYEHRILDQSADKIVETAKRTGATISGPIPLPTERTLYTVIRSPHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTP+TVD+LMKLD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDIVNPTPKTVDSLMKLDLPSGVDIEIKL 102


>gi|121634015|ref|YP_974260.1| 30S ribosomal protein S10 [Neisseria meningitidis FAM18]
 gi|166231300|sp|A1KRH2|RS10_NEIMF RecName: Full=30S ribosomal protein S10
 gi|120865721|emb|CAM09448.1| 30S ribosomal protein S10 [Neisseria meningitidis FAM18]
 gi|325133051|gb|EGC55723.1| ribosomal protein S10 [Neisseria meningitidis M6190]
 gi|325139030|gb|EGC61576.1| ribosomal protein S10 [Neisseria meningitidis ES14902]
 gi|325143230|gb|EGC65569.1| ribosomal protein S10 [Neisseria meningitidis 961-5945]
 gi|325197426|gb|ADY92882.1| ribosomal protein S10 [Neisseria meningitidis G2136]
          Length = 103

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 74/100 (74%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA+D  ++D S +EIV T K++G+ + GPIP P  I RF + RSPHV+K SR
Sbjct: 3   NQKIRIRLKAYDYALIDRSAQEIVETAKRTGAVVKGPIPLPTKIERFNILRSPHVNKTSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +QLE+R + RL+ I+  T +T DALMKLD++AGV+V IK+
Sbjct: 63  EQLEIRTHLRLMDIVDWTDKTTDALMKLDLSAGVDVEIKV 102


>gi|117927514|ref|YP_872065.1| 30S ribosomal protein S10 [Acidothermus cellulolyticus 11B]
 gi|166231231|sp|A0LRL9|RS10_ACIC1 RecName: Full=30S ribosomal protein S10
 gi|117647977|gb|ABK52079.1| SSU ribosomal protein S10P [Acidothermus cellulolyticus 11B]
          Length = 102

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 53/104 (50%), Positives = 74/104 (71%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LKA+D  ++DSS R+IV T  ++G+++ GP+P P     + V RSPH D
Sbjct: 1   MAGQKIRIR--LKAYDHEVIDSSARKIVETVTRTGARVAGPVPLPTEKNVYCVIRSPHKD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+  EMR +KRL+ II PTP+TVD+LM+LD+ AGV++ IKL
Sbjct: 59  KDSREHFEMRTHKRLIDIIDPTPRTVDSLMRLDLPAGVDIEIKL 102


>gi|210135477|ref|YP_002301916.1| 30S ribosomal protein S10 [Helicobacter pylori P12]
 gi|226705454|sp|B6JNF8|RS10_HELP2 RecName: Full=30S ribosomal protein S10
 gi|210133445|gb|ACJ08436.1| 30S ribosomal protein S10 [Helicobacter pylori P12]
          Length = 104

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 71/96 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + LKA+D R+LD S+  IV   K+SGS+I GPIP P   +R+TV RSPHV+K SR+Q
Sbjct: 3   KIRLKLKAYDHRVLDRSVVAIVEAVKRSGSEIRGPIPLPTKNKRYTVLRSPHVNKDSREQ 62

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVI 102
            E+R Y RL+ II  TP+TVD+LMKLD+A  V+V +
Sbjct: 63  FEIRFYSRLIDIISATPETVDSLMKLDLAPEVDVEV 98


>gi|297582449|ref|YP_003698229.1| 30S ribosomal protein S10 [Bacillus selenitireducens MLS10]
 gi|297140906|gb|ADH97663.1| ribosomal protein S10 [Bacillus selenitireducens MLS10]
          Length = 102

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 72/98 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA++ R+LD S  +IV T K+SG+ + GPIP P     +TV R+ H  K SR+Q
Sbjct: 5   KIRIRLKAYEHRVLDQSAEKIVETAKRSGASVAGPIPLPTEKTVYTVLRAVHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I++PTPQTVDALM+LD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDIVEPTPQTVDALMRLDLPSGVDIEIKL 102


>gi|56961931|ref|YP_173653.1| 30S ribosomal protein S10 [Bacillus clausii KSM-K16]
 gi|81601106|sp|Q5WLR3|RS10_BACSK RecName: Full=30S ribosomal protein S10
 gi|56908165|dbj|BAD62692.1| 30S ribosomal protein S10 [Bacillus clausii KSM-K16]
          Length = 102

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D R+LD S  +IV T K+SG+ + GPIP P     +T+ R+ H  K SR+Q
Sbjct: 5   KIRIRLKAYDHRVLDQSAEKIVETAKRSGASVSGPIPLPTEKSVYTILRAVHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ II PTPQTVDALM+LD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDIINPTPQTVDALMRLDLPSGVDIEIKL 102


>gi|16077183|ref|NP_387996.1| 30S ribosomal protein S10 [Bacillus subtilis subsp. subtilis str.
           168]
 gi|52078608|ref|YP_077399.1| 30S ribosomal protein S10 [Bacillus licheniformis ATCC 14580]
 gi|52783970|ref|YP_089799.1| 30S ribosomal protein S10 [Bacillus licheniformis ATCC 14580]
 gi|154684633|ref|YP_001419794.1| 30S ribosomal protein S10 [Bacillus amyloliquefaciens FZB42]
 gi|157690899|ref|YP_001485361.1| 30S ribosomal protein S10 [Bacillus pumilus SAFR-032]
 gi|194017574|ref|ZP_03056185.1| ribosomal protein S10 [Bacillus pumilus ATCC 7061]
 gi|205372070|ref|ZP_03224887.1| 30S ribosomal protein S10 [Bacillus coahuilensis m4-4]
 gi|221307927|ref|ZP_03589774.1| 30S ribosomal protein S10 [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221312248|ref|ZP_03594053.1| 30S ribosomal protein S10 [Bacillus subtilis subsp. subtilis str.
           NCIB 3610]
 gi|221317182|ref|ZP_03598476.1| 30S ribosomal protein S10 [Bacillus subtilis subsp. subtilis str.
           JH642]
 gi|221321445|ref|ZP_03602739.1| 30S ribosomal protein S10 [Bacillus subtilis subsp. subtilis str.
           SMY]
 gi|296333112|ref|ZP_06875566.1| 30S ribosomal protein S10 [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305672814|ref|YP_003864485.1| 30S ribosomal protein S10 [Bacillus subtilis subsp. spizizenii str.
           W23]
 gi|308172006|ref|YP_003918711.1| 30S ribosomal protein S10 (BS13) [Bacillus amyloliquefaciens DSM 7]
 gi|311070762|ref|YP_003975685.1| 30S ribosomal protein S10 [Bacillus atrophaeus 1942]
 gi|319649117|ref|ZP_08003325.1| 30S ribosomal protein S10 [Bacillus sp. BT1B_CT2]
 gi|321313786|ref|YP_004206073.1| 30S ribosomal protein S10 [Bacillus subtilis BSn5]
 gi|33518629|sp|P21471|RS10_BACSU RecName: Full=30S ribosomal protein S10; AltName: Full=BS13
 gi|81667232|sp|Q65PA8|RS10_BACLD RecName: Full=30S ribosomal protein S10
 gi|166231239|sp|A7Z0N7|RS10_BACA2 RecName: Full=30S ribosomal protein S10
 gi|166991565|sp|A8F984|RS10_BACP2 RecName: Full=30S ribosomal protein S10
 gi|1644226|dbj|BAA11006.1| ribosomal protein S10 [Bacillus subtilis]
 gi|2632382|emb|CAB11891.1| ribosomal protein S10 (BS13) [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|52001819|gb|AAU21761.1| ribosomal protein S10 (BS13) [Bacillus licheniformis ATCC 14580]
 gi|52346472|gb|AAU39106.1| RpsJ [Bacillus licheniformis ATCC 14580]
 gi|154350484|gb|ABS72563.1| RpsJ [Bacillus amyloliquefaciens FZB42]
 gi|157679657|gb|ABV60801.1| ribosomal protein S10 [Bacillus pumilus SAFR-032]
 gi|194010846|gb|EDW20417.1| ribosomal protein S10 [Bacillus pumilus ATCC 7061]
 gi|291482488|dbj|BAI83563.1| 30S ribosomal protein S10 [Bacillus subtilis subsp. natto BEST195]
 gi|296149728|gb|EFG90623.1| 30S ribosomal protein S10 [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305411057|gb|ADM36175.1| 30S ribosomal protein S10 [Bacillus subtilis subsp. spizizenii str.
           W23]
 gi|307604870|emb|CBI41241.1| ribosomal protein S10 (BS13) [Bacillus amyloliquefaciens DSM 7]
 gi|310871279|gb|ADP34754.1| 30S ribosomal protein S10 [Bacillus atrophaeus 1942]
 gi|317388817|gb|EFV69636.1| 30S ribosomal protein S10 [Bacillus sp. BT1B_CT2]
 gi|320020060|gb|ADV95046.1| 30S ribosomal protein S10 [Bacillus subtilis BSn5]
 gi|328551816|gb|AEB22308.1| 30S ribosomal protein S10 [Bacillus amyloliquefaciens TA208]
          Length = 102

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D RILD S  +IV T K+SG+ + GPIP P     +T+ R+ H  K SR+Q
Sbjct: 5   KIRIRLKAYDHRILDQSAEKIVETAKRSGASVSGPIPLPTEKSVYTILRAVHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTPQTVDALM+LD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDIVNPTPQTVDALMRLDLPSGVDIEIKL 102


>gi|15639181|ref|NP_218627.1| 30S ribosomal protein S10 [Treponema pallidum subsp. pallidum str.
           Nichols]
 gi|189025421|ref|YP_001933193.1| 30S ribosomal protein S10 [Treponema pallidum subsp. pallidum SS14]
 gi|6094145|sp|O83218|RS10_TREPA RecName: Full=30S ribosomal protein S10
 gi|226705642|sp|B2S2D5|RS10_TREPS RecName: Full=30S ribosomal protein S10
 gi|3322452|gb|AAC65173.1| ribosomal protein S10 (rpsJ) [Treponema pallidum subsp. pallidum
           str. Nichols]
 gi|189017996|gb|ACD70614.1| ribosomal protein S10 [Treponema pallidum subsp. pallidum SS14]
 gi|291059595|gb|ADD72330.1| ribosomal protein S10 [Treponema pallidum subsp. pallidum str.
           Chicago]
          Length = 102

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 50/103 (48%), Positives = 75/103 (72%), Gaps = 2/103 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M    IR+ +C   FD  ++D S R IV   +K+G++++GPIP P  + +FTV RSPHV+
Sbjct: 1   MARERIRVKLC--GFDVELVDQSSRAIVHAVQKAGAEVLGPIPLPTRMHKFTVLRSPHVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           KKSR+Q EMR +KRL+ II+P+ + ++ALM L+++AGV+V IK
Sbjct: 59  KKSREQFEMRTHKRLIDIIEPSQEVMNALMGLELSAGVDVRIK 101


>gi|210630996|ref|ZP_03296721.1| hypothetical protein COLSTE_00606 [Collinsella stercoris DSM 13279]
 gi|210160212|gb|EEA91183.1| hypothetical protein COLSTE_00606 [Collinsella stercoris DSM 13279]
          Length = 106

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 72/98 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK +D  ++D S + IV T +K+G+++ GPIP P     +TV RSPHV+K SR+Q
Sbjct: 9   KIRIRLKGYDHEVVDQSAKLIVETAQKTGARVSGPIPLPTERNLYTVIRSPHVNKDSREQ 68

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTP TVD+LM+LD+ AGV++ IKL
Sbjct: 69  FEMRTHKRLIDILDPTPGTVDSLMRLDLPAGVDIEIKL 106


>gi|238928156|ref|ZP_04659916.1| ribosomal protein S10 [Selenomonas flueggei ATCC 43531]
 gi|238884116|gb|EEQ47754.1| ribosomal protein S10 [Selenomonas flueggei ATCC 43531]
          Length = 119

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 52/102 (50%), Positives = 75/102 (73%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           ++  +I I LKA+D + LD S  +IV T KK+G+ + GPIP P     +T+ RSPHV+K 
Sbjct: 18  AKQQKIRIRLKAYDHKALDQSAAKIVDTAKKTGAMVSGPIPLPTEKNVYTILRSPHVNKD 77

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           SR+Q EMR +KRL+ I++PT +TVD+LM+LD+ AGV++ IKL
Sbjct: 78  SREQFEMRTHKRLIDILQPTNKTVDSLMRLDLPAGVDIEIKL 119


>gi|313773098|gb|EFS39064.1| ribosomal protein S10 [Propionibacterium acnes HL074PA1]
 gi|313830137|gb|EFS67851.1| ribosomal protein S10 [Propionibacterium acnes HL007PA1]
 gi|313832592|gb|EFS70306.1| ribosomal protein S10 [Propionibacterium acnes HL056PA1]
 gi|314965096|gb|EFT09195.1| ribosomal protein S10 [Propionibacterium acnes HL082PA2]
 gi|314973014|gb|EFT17110.1| ribosomal protein S10 [Propionibacterium acnes HL053PA1]
 gi|314975510|gb|EFT19605.1| ribosomal protein S10 [Propionibacterium acnes HL045PA1]
 gi|314979748|gb|EFT23842.1| ribosomal protein S10 [Propionibacterium acnes HL072PA2]
 gi|314984920|gb|EFT29012.1| ribosomal protein S10 [Propionibacterium acnes HL005PA1]
 gi|315089920|gb|EFT61896.1| ribosomal protein S10 [Propionibacterium acnes HL072PA1]
 gi|315096758|gb|EFT68734.1| ribosomal protein S10 [Propionibacterium acnes HL038PA1]
 gi|327325198|gb|EGE67003.1| ribosomal protein S10 [Propionibacterium acnes HL096PA2]
 gi|327332708|gb|EGE74442.1| ribosomal protein S10 [Propionibacterium acnes HL097PA1]
 gi|327443999|gb|EGE90653.1| ribosomal protein S10 [Propionibacterium acnes HL043PA1]
 gi|327449399|gb|EGE96053.1| ribosomal protein S10 [Propionibacterium acnes HL043PA2]
 gi|328761384|gb|EGF74911.1| ribosomal protein S10 [Propionibacterium acnes HL099PA1]
          Length = 103

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 75/104 (72%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   L+A+D  ++DSS R+IV T  ++G+++ GP+P P     F V RSPH D
Sbjct: 1   MAGQKIRIR--LRAYDHEVIDSSARKIVDTVTRTGAKVAGPVPLPTEKNVFCVIRSPHKD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+  EMR +KRL+ I++PTP+TVD+LM+LD+ AGV++ IKL
Sbjct: 59  KDSREHFEMRTHKRLIDILEPTPKTVDSLMRLDLPAGVDIEIKL 102


>gi|269792795|ref|YP_003317699.1| 30S ribosomal protein S10 [Thermanaerovibrio acidaminovorans DSM
           6589]
 gi|269100430|gb|ACZ19417.1| ribosomal protein S10 [Thermanaerovibrio acidaminovorans DSM 6589]
          Length = 101

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 78/102 (76%), Gaps = 2/102 (1%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           ++NIRI   LKAFD R+LD+S  +I  T +++G+++ GPIP P  IR+FT+ +SPH DK 
Sbjct: 2   AKNIRIK--LKAFDHRVLDASAVQIAETAERTGARVSGPIPLPTQIRKFTILKSPHKDKD 59

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +R+Q E R++KRL+ I+ P  +T++ALM+L++ +GV++ IKL
Sbjct: 60  AREQFEQRVHKRLIDILDPNQKTMEALMQLNLPSGVDIQIKL 101


>gi|309803697|ref|ZP_07697787.1| ribosomal protein S10 [Lactobacillus iners LactinV 11V1-d]
 gi|309804980|ref|ZP_07699038.1| ribosomal protein S10 [Lactobacillus iners LactinV 09V1-c]
 gi|309806705|ref|ZP_07700700.1| ribosomal protein S10 [Lactobacillus iners LactinV 03V1-b]
 gi|309809114|ref|ZP_07702987.1| ribosomal protein S10 [Lactobacillus iners SPIN 2503V10-D]
 gi|312871184|ref|ZP_07731282.1| ribosomal protein S10 [Lactobacillus iners LEAF 3008A-a]
 gi|312872763|ref|ZP_07732828.1| ribosomal protein S10 [Lactobacillus iners LEAF 2062A-h1]
 gi|312874930|ref|ZP_07734949.1| ribosomal protein S10 [Lactobacillus iners LEAF 2053A-b]
 gi|315654027|ref|ZP_07906943.1| 30S ribosomal protein S10 [Lactobacillus iners ATCC 55195]
 gi|325912364|ref|ZP_08174760.1| ribosomal protein S10 [Lactobacillus iners UPII 143-D]
 gi|325913221|ref|ZP_08175590.1| ribosomal protein S10 [Lactobacillus iners UPII 60-B]
 gi|329920652|ref|ZP_08277339.1| ribosomal protein S10 [Lactobacillus iners SPIN 1401G]
 gi|308164295|gb|EFO66552.1| ribosomal protein S10 [Lactobacillus iners LactinV 11V1-d]
 gi|308165740|gb|EFO67965.1| ribosomal protein S10 [Lactobacillus iners LactinV 09V1-c]
 gi|308166885|gb|EFO69069.1| ribosomal protein S10 [Lactobacillus iners LactinV 03V1-b]
 gi|308170559|gb|EFO72579.1| ribosomal protein S10 [Lactobacillus iners SPIN 2503V10-D]
 gi|311089675|gb|EFQ48100.1| ribosomal protein S10 [Lactobacillus iners LEAF 2053A-b]
 gi|311091805|gb|EFQ50184.1| ribosomal protein S10 [Lactobacillus iners LEAF 2062A-h1]
 gi|311093198|gb|EFQ51544.1| ribosomal protein S10 [Lactobacillus iners LEAF 3008A-a]
 gi|315488723|gb|EFU78369.1| 30S ribosomal protein S10 [Lactobacillus iners ATCC 55195]
 gi|325475835|gb|EGC79005.1| ribosomal protein S10 [Lactobacillus iners UPII 143-D]
 gi|325477485|gb|EGC80628.1| ribosomal protein S10 [Lactobacillus iners UPII 60-B]
 gi|328935910|gb|EGG32370.1| ribosomal protein S10 [Lactobacillus iners SPIN 1401G]
          Length = 102

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 53/104 (50%), Positives = 76/104 (73%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+ IRI   LK+++  ILD S  +IV T +++G++I GP+P P     FTV RSPH +
Sbjct: 1   MASQQIRIR--LKSYEHSILDESAAKIVATAQRTGAEISGPVPLPTERTLFTVLRSPHKN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+Q E+R +KRL+ I+ PTP+TVD+LMKLD+ +GV++ IKL
Sbjct: 59  KDSREQFEIRTHKRLIDIVNPTPKTVDSLMKLDLPSGVDIEIKL 102


>gi|323490622|ref|ZP_08095827.1| 30S ribosomal protein S10 [Planococcus donghaensis MPA1U2]
 gi|323395714|gb|EGA88555.1| 30S ribosomal protein S10 [Planococcus donghaensis MPA1U2]
          Length = 102

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D RILD S  +IV T K+SG+ + GPIP P     +T+ R+ H  K +R+Q
Sbjct: 5   KIRIRLKAYDHRILDQSAEKIVETAKRSGASVSGPIPLPTERSVYTILRAVHKYKDAREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTPQTVDALMKLD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDIVNPTPQTVDALMKLDLPSGVDIEIKL 102


>gi|225175675|ref|ZP_03729669.1| ribosomal protein S10 [Dethiobacter alkaliphilus AHT 1]
 gi|225169004|gb|EEG77804.1| ribosomal protein S10 [Dethiobacter alkaliphilus AHT 1]
          Length = 102

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 73/98 (74%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD +ILD S  +IV T K++G+ + GPIP P     +TV R+PH  K SR+Q
Sbjct: 5   KIRIRLKAFDHQILDQSSSKIVETAKRTGANVSGPIPLPTEKSIYTVIRAPHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I++PTP+T+D+LM+LD+ AGV++ IKL
Sbjct: 65  FEMRTHKRLIDILEPTPKTIDSLMRLDLPAGVDIEIKL 102


>gi|288554724|ref|YP_003426659.1| 30S ribosomal protein S10 [Bacillus pseudofirmus OF4]
 gi|288545884|gb|ADC49767.1| 30S ribosomal protein S10 [Bacillus pseudofirmus OF4]
          Length = 102

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D R+LD S  +IV T K+SG+ + GPIP P     +TV R+ H  K SR+Q
Sbjct: 5   KIRIRLKAYDHRVLDQSAEKIVDTAKRSGANVSGPIPLPTEKSVYTVLRAVHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTPQTVDALM+LD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDIVNPTPQTVDALMRLDLPSGVDIEIKL 102


>gi|15612696|ref|NP_240999.1| 30S ribosomal protein S10 [Bacillus halodurans C-125]
 gi|7388121|sp|Q9Z9L5|RS10_BACHD RecName: Full=30S ribosomal protein S10
 gi|4512403|dbj|BAA75270.1| rpsJ homologue (identity of 98% to B. subtilis ) [Bacillus
           halodurans]
 gi|10172745|dbj|BAB03852.1| 30S ribosomal protein S10 [Bacillus halodurans C-125]
          Length = 102

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D R+LD S  +IV T K+SG+ + GPIP P     +T+ R+ H  K SR+Q
Sbjct: 5   KIRIRLKAYDHRVLDQSAEKIVETAKRSGANVSGPIPLPTEKSVYTILRAVHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTPQTVDALM+LD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDIVNPTPQTVDALMRLDLPSGVDIEIKL 102


>gi|229815789|ref|ZP_04446114.1| hypothetical protein COLINT_02838 [Collinsella intestinalis DSM
           13280]
 gi|229808705|gb|EEP44482.1| hypothetical protein COLINT_02838 [Collinsella intestinalis DSM
           13280]
          Length = 107

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 53/104 (50%), Positives = 76/104 (73%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           ++S+ IRI   LK +D  ++D S + IV T +K+G+++ GPIP P     +TV RSPHV+
Sbjct: 6   LSSQKIRIR--LKGYDHEVVDQSAKLIVDTAQKTGARVSGPIPLPTERNLYTVIRSPHVN 63

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+Q EMR +KRL+ I+ PTP TVD+LM+LD+ AGV++ IKL
Sbjct: 64  KDSREQFEMRTHKRLIDILDPTPGTVDSLMRLDLPAGVDIEIKL 107


>gi|227891543|ref|ZP_04009348.1| 30S ribosomal protein S10 [Lactobacillus salivarius ATCC 11741]
 gi|227866690|gb|EEJ74111.1| 30S ribosomal protein S10 [Lactobacillus salivarius ATCC 11741]
          Length = 132

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 72/98 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA++ RILD S  +IV T K++G+ I GPIP P     +TV RSPH  K SR+Q
Sbjct: 35  KIRIRLKAYEHRILDQSADKIVETAKRTGATISGPIPLPTERTLYTVIRSPHKYKDSREQ 94

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTP+TVD+LMKLD+ +GV++ IKL
Sbjct: 95  FEMRTHKRLIDIVNPTPKTVDSLMKLDLPSGVDIEIKL 132


>gi|225621027|ref|YP_002722285.1| 30S ribosomal protein S10 [Brachyspira hyodysenteriae WA1]
 gi|296126864|ref|YP_003634116.1| ribosomal protein S10 [Brachyspira murdochii DSM 12563]
 gi|1710723|sp|P52857|RS10_TREHY RecName: Full=30S ribosomal protein S10
 gi|254809606|sp|C0QVZ5|RS10_BRAHW RecName: Full=30S ribosomal protein S10
 gi|1256783|gb|AAA96521.1| ribosomal protein subunit S10 [Brachyspira hyodysenteriae]
 gi|225215847|gb|ACN84581.1| 30S ribosomal protein S10 [Brachyspira hyodysenteriae WA1]
 gi|296018680|gb|ADG71917.1| ribosomal protein S10 [Brachyspira murdochii DSM 12563]
          Length = 101

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 53/97 (54%), Positives = 72/97 (74%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + LKAFD  ++D S + IV + KK+G+++ GPIP P SIR+ TV RSPHV+ KSR+Q
Sbjct: 5   KIRVKLKAFDIELIDQSAQSIVASVKKTGARVSGPIPLPTSIRKVTVIRSPHVNIKSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            EMRIYKRL+ I   TPQT ++L KL + AGV+V +K
Sbjct: 65  FEMRIYKRLIDIFDVTPQTTESLKKLALPAGVDVQLK 101


>gi|2500434|sp|P72232|RS10_PLARO RecName: Full=30S ribosomal protein S10
 gi|1679860|emb|CAA67346.1| ribosomal protein S10 [Planobispora rosea]
          Length = 102

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 74/104 (71%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LKA+D  ++DSS ++IV T  ++G+++ GP+P P     + V RSPH D
Sbjct: 1   MAGQKIRIR--LKAYDHEVIDSSAKKIVETVTRTGAKVAGPVPLPTEKNVYCVIRSPHND 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+  EMR +KRL+ II PTP+TVD+LM+LD+ AGV++ IKL
Sbjct: 59  KDSREHFEMRTHKRLIDIIDPTPKTVDSLMRLDLPAGVDISIKL 102


>gi|326803032|ref|YP_004320850.1| ribosomal protein S10 [Aerococcus urinae ACS-120-V-Col10a]
 gi|326650410|gb|AEA00593.1| ribosomal protein S10 [Aerococcus urinae ACS-120-V-Col10a]
          Length = 102

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 72/98 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA++ R LD S ++IV T K++G+Q+ GPIP P     FTV R+ H  K SR+Q
Sbjct: 5   KIRIRLKAYEHRALDQSAQKIVDTAKRTGAQVAGPIPLPTERSIFTVIRATHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTP+TVDALMKLD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLVDIVNPTPKTVDALMKLDLPSGVDIEIKL 102


>gi|289523370|ref|ZP_06440224.1| ribosomal protein S10 [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
 gi|289503062|gb|EFD24226.1| ribosomal protein S10 [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
          Length = 101

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 79/102 (77%), Gaps = 2/102 (1%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           ++NIRI   LKAFD R+LD+S  +I  T K++G+++ GPIP P +I ++TV +SPH DK 
Sbjct: 2   AQNIRIK--LKAFDHRVLDASALQIAETAKRTGAKVSGPIPLPTAINKYTVLKSPHKDKD 59

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +R+Q E+R +KRL+ I+ PT +T++ALM+L++ +GV++ I+L
Sbjct: 60  AREQFEVRTHKRLIDIVDPTQKTMEALMQLNLPSGVDIQIQL 101


>gi|256827417|ref|YP_003151376.1| 30S ribosomal protein S10P [Cryptobacterium curtum DSM 15641]
 gi|257790716|ref|YP_003181322.1| 30S ribosomal protein S10 [Eggerthella lenta DSM 2243]
 gi|317488573|ref|ZP_07947118.1| ribosomal protein S10 [Eggerthella sp. 1_3_56FAA]
 gi|325831920|ref|ZP_08165017.1| ribosomal protein S10 [Eggerthella sp. HGA1]
 gi|256583560|gb|ACU94694.1| SSU ribosomal protein S10P [Cryptobacterium curtum DSM 15641]
 gi|257474613|gb|ACV54933.1| ribosomal protein S10 [Eggerthella lenta DSM 2243]
 gi|316912315|gb|EFV33879.1| ribosomal protein S10 [Eggerthella sp. 1_3_56FAA]
 gi|325486241|gb|EGC88693.1| ribosomal protein S10 [Eggerthella sp. HGA1]
          Length = 102

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 72/100 (72%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LK +D  I+D S + IV T +K+G+++ GPIP P     + V + PHVDK SR
Sbjct: 3   NQKIRIRLKGYDHEIVDQSTKLIVDTAQKTGAKVSGPIPLPTERNLYCVVKGPHVDKDSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KRL+ I++PTP TVD+LM+LD+ AGV++ IKL
Sbjct: 63  EQFEMRTHKRLIDILEPTPNTVDSLMRLDLPAGVDIEIKL 102


>gi|152989971|ref|YP_001355693.1| 30S ribosomal protein S10 [Nitratiruptor sp. SB155-2]
 gi|166231301|sp|A6Q1H7|RS10_NITSB RecName: Full=30S ribosomal protein S10
 gi|151421832|dbj|BAF69336.1| 30S ribosomal protein S10 [Nitratiruptor sp. SB155-2]
          Length = 103

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 50/97 (51%), Positives = 73/97 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + L+A+D R+LD S+  IV   K++G++I GPIP P  IRR+TV RSPH++K SR+Q
Sbjct: 3   KIRLKLRAYDHRVLDRSVSAIVEAVKRTGAEIRGPIPLPTKIRRYTVLRSPHINKDSREQ 62

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E+RI+ RL+ I+  TP TVD+LMKLD+A  V+V ++
Sbjct: 63  FEIRIHSRLIDIVSATPDTVDSLMKLDLAPEVDVEVR 99


>gi|328955915|ref|YP_004373248.1| SSU ribosomal protein S10P [Coriobacterium glomerans PW2]
 gi|328456239|gb|AEB07433.1| SSU ribosomal protein S10P [Coriobacterium glomerans PW2]
          Length = 102

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 54/104 (51%), Positives = 74/104 (71%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M+S+ IRI   LK +D  ++D S + IV T +K+G+++ GPIP P     +TV RSPH D
Sbjct: 1   MSSQKIRIR--LKGYDHEVVDQSAKLIVDTAQKTGARVAGPIPLPTERNLYTVIRSPHKD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+Q EMR +KRL+ I+ PT  TVDALM+LD+ AGV++ IKL
Sbjct: 59  KDSREQFEMRTHKRLIDILDPTSGTVDALMRLDLPAGVDIEIKL 102


>gi|91200666|emb|CAJ73717.1| strongly similar to 30S ribosomal protein S10 [Candidatus Kuenenia
           stuttgartiensis]
          Length = 110

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 75/97 (77%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I ++A+D RILD S  EIV T K++G+++ GP+P P  I R+TV RSPH+DK+SR+Q
Sbjct: 13  KIRIRMEAYDYRILDQSALEIVETAKRTGAKVFGPVPLPTRIERYTVLRSPHIDKRSREQ 72

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E+R +KRL+ I++PT +T+DAL ++++ AG+ + IK
Sbjct: 73  FEVRTHKRLIDILEPTAKTMDALNRINMPAGIEIKIK 109


>gi|28377831|ref|NP_784723.1| 30S ribosomal protein S10 [Lactobacillus plantarum WCFS1]
 gi|254556016|ref|YP_003062433.1| 30S ribosomal protein S10 [Lactobacillus plantarum JDM1]
 gi|300767820|ref|ZP_07077730.1| 30S ribosomal protein S10 [Lactobacillus plantarum subsp. plantarum
           ATCC 14917]
 gi|308180010|ref|YP_003924138.1| 30S ribosomal protein S10 [Lactobacillus plantarum subsp. plantarum
           ST-III]
 gi|38258535|sp|Q88XY7|RS10_LACPL RecName: Full=30S ribosomal protein S10
 gi|28270664|emb|CAD63570.1| ribosomal protein S10 [Lactobacillus plantarum WCFS1]
 gi|254044943|gb|ACT61736.1| 30S ribosomal protein S10 [Lactobacillus plantarum JDM1]
 gi|300494805|gb|EFK29963.1| 30S ribosomal protein S10 [Lactobacillus plantarum subsp. plantarum
           ATCC 14917]
 gi|308045501|gb|ADN98044.1| 30S ribosomal protein S10 [Lactobacillus plantarum subsp. plantarum
           ST-III]
          Length = 102

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 72/98 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA++ RILD S  +IV T K++G+ I GPIP P     +TV RSPH  K SR+Q
Sbjct: 5   KIRIRLKAYEHRILDQSADKIVETAKRTGATISGPIPLPTERTIYTVLRSPHKFKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTP+TVD+LMKLD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDIVNPTPKTVDSLMKLDLPSGVDIEIKL 102


>gi|315640162|ref|ZP_07895284.1| 30S ribosomal protein S10 [Enterococcus italicus DSM 15952]
 gi|315484139|gb|EFU74613.1| 30S ribosomal protein S10 [Enterococcus italicus DSM 15952]
          Length = 122

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA++ RILD S  +IV T K++G+ + GPIP P     +TV R+ H  K SR+Q
Sbjct: 25  KIRIRLKAYEHRILDQSADKIVETAKRTGADVSGPIPLPTERSLYTVIRATHKYKDSREQ 84

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTP+TVDALMKLD+ +GVN+ IKL
Sbjct: 85  FEMRTHKRLIDIVNPTPKTVDALMKLDLPSGVNIEIKL 122


>gi|304413144|ref|ZP_07394617.1| 30S ribosomal subunit protein S10 [Candidatus Regiella insecticola
           LSR1]
 gi|304283987|gb|EFL92380.1| 30S ribosomal subunit protein S10 [Candidatus Regiella insecticola
           LSR1]
          Length = 132

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I LKAFD  ++D S  EIV T K++G+ + GPIP P    RFT+  SPHV+K +RDQ
Sbjct: 34  RIRIRLKAFDHLLIDRSTSEIVETAKRTGATVRGPIPLPTRKERFTILISPHVNKDARDQ 93

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+  +KRL+ I++PT  TVDALM+LD+AAGV+V I L
Sbjct: 94  YEILTHKRLIDIVEPTENTVDALMRLDLAAGVDVQISL 131


>gi|56418640|ref|YP_145958.1| 30S ribosomal protein S10 [Geobacillus kaustophilus HTA426]
 gi|138893784|ref|YP_001124237.1| 30S ribosomal protein S10 [Geobacillus thermodenitrificans NG80-2]
 gi|196251025|ref|ZP_03149707.1| ribosomal protein S10 [Geobacillus sp. G11MC16]
 gi|261417606|ref|YP_003251288.1| 30S ribosomal protein S10 [Geobacillus sp. Y412MC61]
 gi|297528481|ref|YP_003669756.1| ribosomal protein S10 [Geobacillus sp. C56-T3]
 gi|319765264|ref|YP_004130765.1| ribosomal protein S10 [Geobacillus sp. Y412MC52]
 gi|81558136|sp|Q5L3Z8|RS10_GEOKA RecName: Full=30S ribosomal protein S10
 gi|166231274|sp|A4IJI8|RS10_GEOTN RecName: Full=30S ribosomal protein S10
 gi|56378482|dbj|BAD74390.1| 30S ribosomal protein S10 (BS13) [Geobacillus kaustophilus HTA426]
 gi|134265297|gb|ABO65492.1| SSU ribosomal protein S10P [Geobacillus thermodenitrificans NG80-2]
 gi|196209497|gb|EDY04274.1| ribosomal protein S10 [Geobacillus sp. G11MC16]
 gi|261374063|gb|ACX76806.1| ribosomal protein S10 [Geobacillus sp. Y412MC61]
 gi|297251733|gb|ADI25179.1| ribosomal protein S10 [Geobacillus sp. C56-T3]
 gi|317110130|gb|ADU92622.1| ribosomal protein S10 [Geobacillus sp. Y412MC52]
          Length = 102

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 72/98 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D RILD S  +IV T K+SG+++ GPIP P     +T+ R+ H  K SR+Q
Sbjct: 5   KIRIRLKAYDHRILDQSAEKIVETAKRSGAKVSGPIPLPTERTVYTILRAVHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ II PTPQTVD+LM+LD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDIINPTPQTVDSLMRLDLPSGVDIEIKL 102


>gi|296120746|ref|YP_003628524.1| ribosomal protein S10 [Planctomyces limnophilus DSM 3776]
 gi|296013086|gb|ADG66325.1| ribosomal protein S10 [Planctomyces limnophilus DSM 3776]
          Length = 108

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 52/97 (53%), Positives = 73/97 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I ++A+D  +LD S  EIV T K++G+ + GPIP P  I R+TV RSPH+D+KSR+Q
Sbjct: 8   KIRIRMEAYDHSVLDLSASEIVDTAKRTGAIVHGPIPLPTRIERYTVLRSPHIDRKSREQ 67

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E+R +KRL+ II+PT +T+DAL KL + AGV+V IK
Sbjct: 68  FEIRTHKRLIDIIQPTGKTIDALNKLSLPAGVDVKIK 104


>gi|256960670|ref|ZP_05564841.1| 30S ribosomal protein S10P [Enterococcus faecalis Merz96]
 gi|293382759|ref|ZP_06628684.1| ribosomal protein S10 [Enterococcus faecalis R712]
 gi|293388058|ref|ZP_06632586.1| ribosomal protein S10 [Enterococcus faecalis S613]
 gi|312908654|ref|ZP_07767596.1| ribosomal protein S10 [Enterococcus faecalis DAPTO 512]
 gi|312909198|ref|ZP_07768055.1| ribosomal protein S10 [Enterococcus faecalis DAPTO 516]
 gi|256951166|gb|EEU67798.1| 30S ribosomal protein S10P [Enterococcus faecalis Merz96]
 gi|291079919|gb|EFE17283.1| ribosomal protein S10 [Enterococcus faecalis R712]
 gi|291082509|gb|EFE19472.1| ribosomal protein S10 [Enterococcus faecalis S613]
 gi|310625441|gb|EFQ08724.1| ribosomal protein S10 [Enterococcus faecalis DAPTO 512]
 gi|311290440|gb|EFQ68996.1| ribosomal protein S10 [Enterococcus faecalis DAPTO 516]
          Length = 114

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA++ RILD S  +IV T K++G+ + GPIP P     +TV R+ H  K SR+Q
Sbjct: 17  KIRIRLKAYEHRILDQSADKIVETAKRTGADVSGPIPLPTERSLYTVVRATHKYKDSREQ 76

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTP+TVDALMKLD+ +GVN+ IKL
Sbjct: 77  FEMRTHKRLIDIVNPTPKTVDALMKLDLPSGVNIEIKL 114


>gi|116334270|ref|YP_795797.1| 30S ribosomal protein S10 [Lactobacillus brevis ATCC 367]
 gi|122269048|sp|Q03PV6|RS10_LACBA RecName: Full=30S ribosomal protein S10
 gi|116099617|gb|ABJ64766.1| SSU ribosomal protein S10P [Lactobacillus brevis ATCC 367]
          Length = 102

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 72/98 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA++ RILD S  +IV T K++G+ I GPIP P     +TV RSPH  K SR+Q
Sbjct: 5   KIRIRLKAYEHRILDQSADKIVETAKRTGAGISGPIPLPTERTIYTVLRSPHKFKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTP+TVD+LMKLD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDIVNPTPKTVDSLMKLDLPSGVDIEIKL 102


>gi|328469806|gb|EGF40723.1| 30S ribosomal protein S10 [Listeria monocytogenes 220]
          Length = 124

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D RILD S  +IV T K+SG+ + GPIP P     +TV R+ H  K SR+Q
Sbjct: 27  KIRIRLKAYDHRILDQSAEKIVETAKRSGASVSGPIPLPTEKSIYTVLRAVHKYKDSREQ 86

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTPQTVD+LM+LD+ +GV++ IKL
Sbjct: 87  FEMRTHKRLIDIVNPTPQTVDSLMRLDLPSGVDIEIKL 124


>gi|304405617|ref|ZP_07387276.1| ribosomal protein S10 [Paenibacillus curdlanolyticus YK9]
 gi|304345656|gb|EFM11491.1| ribosomal protein S10 [Paenibacillus curdlanolyticus YK9]
          Length = 102

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D RILD S  +IV T K+SG+ + GPIP P   +  TV R+ H  K SR+Q
Sbjct: 5   KIRIRLKAYDHRILDQSAEKIVETAKRSGAGVSGPIPLPTEKQIITVLRAVHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTPQTVDALM+LD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDIVNPTPQTVDALMRLDLPSGVDIEIKL 102


>gi|227519991|ref|ZP_03950040.1| 30S ribosomal protein S10 [Enterococcus faecalis TX0104]
 gi|227555852|ref|ZP_03985899.1| 30S ribosomal protein S10 [Enterococcus faecalis HH22]
 gi|229546965|ref|ZP_04435690.1| 30S ribosomal protein S10 [Enterococcus faecalis TX1322]
 gi|229550554|ref|ZP_04439279.1| 30S ribosomal protein S10 [Enterococcus faecalis ATCC 29200]
 gi|255971708|ref|ZP_05422294.1| SSU ribosomal protein S10P [Enterococcus faecalis T1]
 gi|255974708|ref|ZP_05425294.1| SSU ribosomal protein S10P [Enterococcus faecalis T2]
 gi|256618381|ref|ZP_05475227.1| SSU ribosomal protein S10P [Enterococcus faecalis ATCC 4200]
 gi|256762002|ref|ZP_05502582.1| SSU ribosomal protein S10P [Enterococcus faecalis T3]
 gi|256855162|ref|ZP_05560523.1| ribosomal protein S10 [Enterococcus faecalis T8]
 gi|256956863|ref|ZP_05561034.1| SSU ribosomal protein S10P [Enterococcus faecalis DS5]
 gi|256964131|ref|ZP_05568302.1| 30S ribosomal protein S10P [Enterococcus faecalis HIP11704]
 gi|257078533|ref|ZP_05572894.1| 30S ribosomal protein S10P [Enterococcus faecalis JH1]
 gi|257081496|ref|ZP_05575857.1| SSU ribosomal protein S10P [Enterococcus faecalis E1Sol]
 gi|257084144|ref|ZP_05578505.1| 30S ribosomal protein S10 [Enterococcus faecalis Fly1]
 gi|257087971|ref|ZP_05582332.1| SSU ribosomal protein S10P [Enterococcus faecalis D6]
 gi|257088648|ref|ZP_05583009.1| 30S ribosomal protein S10P [Enterococcus faecalis CH188]
 gi|257417575|ref|ZP_05594569.1| SSU ribosomal protein S10P [Enterococcus faecalis AR01/DG]
 gi|257418700|ref|ZP_05595694.1| 30S ribosomal protein S10P [Enterococcus faecalis T11]
 gi|257421499|ref|ZP_05598489.1| 30S ribosomal protein S10 [Enterococcus faecalis X98]
 gi|307269086|ref|ZP_07550447.1| ribosomal protein S10 [Enterococcus faecalis TX4248]
 gi|307274170|ref|ZP_07555378.1| ribosomal protein S10 [Enterococcus faecalis TX0855]
 gi|307276395|ref|ZP_07557518.1| ribosomal protein S10 [Enterococcus faecalis TX2134]
 gi|307278605|ref|ZP_07559675.1| ribosomal protein S10 [Enterococcus faecalis TX0860]
 gi|307287015|ref|ZP_07567090.1| ribosomal protein S10 [Enterococcus faecalis TX0109]
 gi|307291644|ref|ZP_07571519.1| ribosomal protein S10 [Enterococcus faecalis TX0411]
 gi|312901123|ref|ZP_07760411.1| ribosomal protein S10 [Enterococcus faecalis TX0470]
 gi|312904685|ref|ZP_07763840.1| ribosomal protein S10 [Enterococcus faecalis TX0635]
 gi|312952606|ref|ZP_07771470.1| ribosomal protein S10 [Enterococcus faecalis TX0102]
 gi|227072539|gb|EEI10502.1| 30S ribosomal protein S10 [Enterococcus faecalis TX0104]
 gi|227175019|gb|EEI55991.1| 30S ribosomal protein S10 [Enterococcus faecalis HH22]
 gi|229304273|gb|EEN70269.1| 30S ribosomal protein S10 [Enterococcus faecalis ATCC 29200]
 gi|229307893|gb|EEN73880.1| 30S ribosomal protein S10 [Enterococcus faecalis TX1322]
 gi|255962726|gb|EET95202.1| SSU ribosomal protein S10P [Enterococcus faecalis T1]
 gi|255967580|gb|EET98202.1| SSU ribosomal protein S10P [Enterococcus faecalis T2]
 gi|256597908|gb|EEU17084.1| SSU ribosomal protein S10P [Enterococcus faecalis ATCC 4200]
 gi|256683253|gb|EEU22948.1| SSU ribosomal protein S10P [Enterococcus faecalis T3]
 gi|256709675|gb|EEU24722.1| ribosomal protein S10 [Enterococcus faecalis T8]
 gi|256947359|gb|EEU63991.1| SSU ribosomal protein S10P [Enterococcus faecalis DS5]
 gi|256954627|gb|EEU71259.1| 30S ribosomal protein S10P [Enterococcus faecalis HIP11704]
 gi|256986563|gb|EEU73865.1| 30S ribosomal protein S10P [Enterococcus faecalis JH1]
 gi|256989526|gb|EEU76828.1| SSU ribosomal protein S10P [Enterococcus faecalis E1Sol]
 gi|256992174|gb|EEU79476.1| 30S ribosomal protein S10 [Enterococcus faecalis Fly1]
 gi|256996001|gb|EEU83303.1| SSU ribosomal protein S10P [Enterococcus faecalis D6]
 gi|256997460|gb|EEU83980.1| 30S ribosomal protein S10P [Enterococcus faecalis CH188]
 gi|257159403|gb|EEU89363.1| SSU ribosomal protein S10P [Enterococcus faecalis ARO1/DG]
 gi|257160528|gb|EEU90488.1| 30S ribosomal protein S10P [Enterococcus faecalis T11]
 gi|257163323|gb|EEU93283.1| 30S ribosomal protein S10 [Enterococcus faecalis X98]
 gi|306497263|gb|EFM66805.1| ribosomal protein S10 [Enterococcus faecalis TX0411]
 gi|306501961|gb|EFM71250.1| ribosomal protein S10 [Enterococcus faecalis TX0109]
 gi|306504665|gb|EFM73865.1| ribosomal protein S10 [Enterococcus faecalis TX0860]
 gi|306506875|gb|EFM76022.1| ribosomal protein S10 [Enterococcus faecalis TX2134]
 gi|306509132|gb|EFM78194.1| ribosomal protein S10 [Enterococcus faecalis TX0855]
 gi|306514566|gb|EFM83120.1| ribosomal protein S10 [Enterococcus faecalis TX4248]
 gi|310629394|gb|EFQ12677.1| ribosomal protein S10 [Enterococcus faecalis TX0102]
 gi|310632037|gb|EFQ15320.1| ribosomal protein S10 [Enterococcus faecalis TX0635]
 gi|311291795|gb|EFQ70351.1| ribosomal protein S10 [Enterococcus faecalis TX0470]
 gi|315026836|gb|EFT38768.1| ribosomal protein S10 [Enterococcus faecalis TX2137]
 gi|315028876|gb|EFT40808.1| ribosomal protein S10 [Enterococcus faecalis TX4000]
 gi|315031138|gb|EFT43070.1| ribosomal protein S10 [Enterococcus faecalis TX0017]
 gi|315036016|gb|EFT47948.1| ribosomal protein S10 [Enterococcus faecalis TX0027]
 gi|315145335|gb|EFT89351.1| ribosomal protein S10 [Enterococcus faecalis TX2141]
 gi|315147172|gb|EFT91188.1| ribosomal protein S10 [Enterococcus faecalis TX4244]
 gi|315151070|gb|EFT95086.1| ribosomal protein S10 [Enterococcus faecalis TX0012]
 gi|315153610|gb|EFT97626.1| ribosomal protein S10 [Enterococcus faecalis TX0031]
 gi|315156210|gb|EFU00227.1| ribosomal protein S10 [Enterococcus faecalis TX0043]
 gi|315158645|gb|EFU02662.1| ribosomal protein S10 [Enterococcus faecalis TX0312]
 gi|315160727|gb|EFU04744.1| ribosomal protein S10 [Enterococcus faecalis TX0645]
 gi|315165902|gb|EFU09919.1| ribosomal protein S10 [Enterococcus faecalis TX1302]
 gi|315168099|gb|EFU12116.1| ribosomal protein S10 [Enterococcus faecalis TX1341]
 gi|315171461|gb|EFU15478.1| ribosomal protein S10 [Enterococcus faecalis TX1342]
 gi|315172695|gb|EFU16712.1| ribosomal protein S10 [Enterococcus faecalis TX1346]
 gi|315573513|gb|EFU85704.1| ribosomal protein S10 [Enterococcus faecalis TX0309B]
 gi|315579325|gb|EFU91516.1| ribosomal protein S10 [Enterococcus faecalis TX0630]
 gi|315582139|gb|EFU94330.1| ribosomal protein S10 [Enterococcus faecalis TX0309A]
 gi|327534003|gb|AEA92837.1| 30S ribosomal protein S10 [Enterococcus faecalis OG1RF]
 gi|329577750|gb|EGG59176.1| ribosomal protein S10 [Enterococcus faecalis TX1467]
          Length = 114

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA++ RILD S  +IV T K++G+ + GPIP P     +TV R+ H  K SR+Q
Sbjct: 17  KIRIRLKAYEHRILDQSADKIVETAKRTGADVSGPIPLPTERSLYTVIRATHKYKDSREQ 76

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTP+TVDALMKLD+ +GVN+ IKL
Sbjct: 77  FEMRTHKRLIDIVNPTPKTVDALMKLDLPSGVNIEIKL 114


>gi|300870648|ref|YP_003785519.1| 30S ribosomal protein S10 [Brachyspira pilosicoli 95/1000]
 gi|17865593|sp|Q9FA05|RS10_BRAPL RecName: Full=30S ribosomal protein S10
 gi|11036692|gb|AAG27263.1| putative S10 ribosomal protein [Brachyspira pilosicoli]
 gi|300688347|gb|ADK31018.1| 30S ribosomal protein S10 [Brachyspira pilosicoli 95/1000]
          Length = 101

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 52/97 (53%), Positives = 72/97 (74%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + LKAFD  ++D S + IV + KK+G+++ GPIP P SIR+ TV RSPHV+ KSR+Q
Sbjct: 5   KIRVKLKAFDIELIDQSAQSIVASVKKTGARVSGPIPLPTSIRKVTVIRSPHVNIKSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            EMR+YKRL+ I   TPQT ++L KL + AGV+V +K
Sbjct: 65  FEMRVYKRLIDIFDVTPQTTESLKKLALPAGVDVQLK 101


>gi|23097573|ref|NP_691039.1| 30S ribosomal protein S10 [Oceanobacillus iheyensis HTE831]
 gi|44888498|sp|Q8ETY3|RS10_OCEIH RecName: Full=30S ribosomal protein S10
 gi|22775796|dbj|BAC12074.1| 30S ribosomal protein S10 [Oceanobacillus iheyensis HTE831]
          Length = 102

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 73/98 (74%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D RILD S  +IV T K+SG+++ GPIP P     +TV R+ H  K SR+Q
Sbjct: 5   KIRIRLKAYDHRILDQSAEKIVDTAKRSGAKVSGPIPLPTEKSVYTVLRAVHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I++PTP+TVDALM+LD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDILEPTPKTVDALMRLDLPSGVDIEIKL 102


>gi|220928206|ref|YP_002505115.1| 30S ribosomal protein S10 [Clostridium cellulolyticum H10]
 gi|326203897|ref|ZP_08193759.1| ribosomal protein S10 [Clostridium papyrosolvens DSM 2782]
 gi|254809596|sp|B8I7X8|RS10_CLOCE RecName: Full=30S ribosomal protein S10
 gi|219998534|gb|ACL75135.1| ribosomal protein S10 [Clostridium cellulolyticum H10]
 gi|325985995|gb|EGD46829.1| ribosomal protein S10 [Clostridium papyrosolvens DSM 2782]
          Length = 103

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 73/102 (71%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           S   +I I LKAFD ++LD S  +IV T K++G+++ GP+P P      T+ R+PH  K 
Sbjct: 2   SNKQKIRIRLKAFDHQVLDQSAEKIVETAKRTGAKVSGPVPLPTEKEIITILRAPHKYKD 61

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           SR+Q EMR +KRL+ ++ PTP+TVDALM+LD+ AGV++ IKL
Sbjct: 62  SREQFEMRTHKRLIDVVLPTPKTVDALMRLDLPAGVDIEIKL 103


>gi|16801843|ref|NP_472111.1| 30S ribosomal protein S10 [Listeria innocua Clip11262]
 gi|16804671|ref|NP_466156.1| 30S ribosomal protein S10 [Listeria monocytogenes EGD-e]
 gi|46908805|ref|YP_015194.1| 30S ribosomal protein S10 [Listeria monocytogenes str. 4b F2365]
 gi|47097670|ref|ZP_00235185.1| ribosomal protein S10 [Listeria monocytogenes str. 1/2a F6854]
 gi|116873999|ref|YP_850780.1| 30S ribosomal protein S10 [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|217966168|ref|YP_002351846.1| ribosomal protein S10 [Listeria monocytogenes HCC23]
 gi|224499306|ref|ZP_03667655.1| 30S ribosomal protein S10 [Listeria monocytogenes Finland 1988]
 gi|224503573|ref|ZP_03671880.1| 30S ribosomal protein S10 [Listeria monocytogenes FSL R2-561]
 gi|226225178|ref|YP_002759285.1| ribosomal protein S10 [Listeria monocytogenes Clip81459]
 gi|254825006|ref|ZP_05230007.1| rpsJ [Listeria monocytogenes FSL J1-194]
 gi|254829082|ref|ZP_05233769.1| ribosomal protein S10 [Listeria monocytogenes FSL N3-165]
 gi|254830935|ref|ZP_05235590.1| 30S ribosomal protein S10 [Listeria monocytogenes 10403S]
 gi|254854161|ref|ZP_05243509.1| ribosomal protein S10 [Listeria monocytogenes FSL R2-503]
 gi|254899916|ref|ZP_05259840.1| 30S ribosomal protein S10 [Listeria monocytogenes J0161]
 gi|254912878|ref|ZP_05262890.1| ribosomal protein S10 [Listeria monocytogenes J2818]
 gi|254931097|ref|ZP_05264456.1| rpsJ [Listeria monocytogenes HPB2262]
 gi|254937258|ref|ZP_05268955.1| ribosomal protein S10 [Listeria monocytogenes F6900]
 gi|255017008|ref|ZP_05289134.1| 30S ribosomal protein S10 [Listeria monocytogenes FSL F2-515]
 gi|255022703|ref|ZP_05294689.1| 30S ribosomal protein S10 [Listeria monocytogenes FSL J1-208]
 gi|255027143|ref|ZP_05299129.1| 30S ribosomal protein S10 [Listeria monocytogenes FSL J2-003]
 gi|255029692|ref|ZP_05301643.1| 30S ribosomal protein S10 [Listeria monocytogenes LO28]
 gi|255519639|ref|ZP_05386876.1| 30S ribosomal protein S10 [Listeria monocytogenes FSL J1-175]
 gi|284800481|ref|YP_003412346.1| 30S ribosomal protein S10 [Listeria monocytogenes 08-5578]
 gi|284993667|ref|YP_003415435.1| 30S ribosomal protein S10 [Listeria monocytogenes 08-5923]
 gi|289435899|ref|YP_003465771.1| hypothetical protein lse_2538 [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|290891818|ref|ZP_06554815.1| ribosomal protein S10 [Listeria monocytogenes FSL J2-071]
 gi|300763616|ref|ZP_07073614.1| ribosomal protein S10 [Listeria monocytogenes FSL N1-017]
 gi|315304967|ref|ZP_07875050.1| ribosomal protein S10 [Listeria ivanovii FSL F6-596]
 gi|54036373|sp|Q71WE5|RS10_LISMF RecName: Full=30S ribosomal protein S10
 gi|54039318|sp|P66331|RS10_LISIN RecName: Full=30S ribosomal protein S10
 gi|54042099|sp|P66330|RS10_LISMO RecName: Full=30S ribosomal protein S10
 gi|123458739|sp|A0ALW9|RS10_LISW6 RecName: Full=30S ribosomal protein S10
 gi|254809584|sp|B8DB07|RS10_LISMH RecName: Full=30S ribosomal protein S10
 gi|259494597|sp|C1KZI1|RS10_LISMC RecName: Full=30S ribosomal protein S10
 gi|16412121|emb|CAD00711.1| ribosomal protein S10 [Listeria monocytogenes EGD-e]
 gi|16415318|emb|CAC98008.1| ribosomal protein S10 [Listeria innocua Clip11262]
 gi|46882078|gb|AAT05371.1| ribosomal protein S10 [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47013951|gb|EAL04969.1| ribosomal protein S10 [Listeria monocytogenes str. 1/2a F6854]
 gi|116742877|emb|CAK22001.1| ribosomal protein S10 [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|217335438|gb|ACK41232.1| ribosomal protein S10 [Listeria monocytogenes HCC23]
 gi|225877640|emb|CAS06354.1| ribosomal protein S10 [Listeria monocytogenes serotype 4b str. CLIP
           80459]
 gi|258601493|gb|EEW14818.1| ribosomal protein S10 [Listeria monocytogenes FSL N3-165]
 gi|258607553|gb|EEW20161.1| ribosomal protein S10 [Listeria monocytogenes FSL R2-503]
 gi|258609865|gb|EEW22473.1| ribosomal protein S10 [Listeria monocytogenes F6900]
 gi|284056043|gb|ADB66984.1| 30S ribosomal protein S10 [Listeria monocytogenes 08-5578]
 gi|284059134|gb|ADB70073.1| 30S ribosomal protein S10 [Listeria monocytogenes 08-5923]
 gi|289172143|emb|CBH28689.1| rpsJ [Listeria seeligeri serovar 1/2b str. SLCC3954]
 gi|290558412|gb|EFD91929.1| ribosomal protein S10 [Listeria monocytogenes FSL J2-071]
 gi|293582643|gb|EFF94675.1| rpsJ [Listeria monocytogenes HPB2262]
 gi|293590878|gb|EFF99212.1| ribosomal protein S10 [Listeria monocytogenes J2818]
 gi|293594246|gb|EFG02007.1| rpsJ [Listeria monocytogenes FSL J1-194]
 gi|300515893|gb|EFK42942.1| ribosomal protein S10 [Listeria monocytogenes FSL N1-017]
 gi|307572222|emb|CAR85401.1| rpsJ [Listeria monocytogenes L99]
 gi|313616899|gb|EFR89556.1| ribosomal protein S10 [Listeria innocua FSL S4-378]
 gi|313622208|gb|EFR92737.1| ribosomal protein S10 [Listeria innocua FSL J1-023]
 gi|313626663|gb|EFR95713.1| ribosomal protein S10 [Listeria ivanovii FSL F6-596]
 gi|313636106|gb|EFS01981.1| ribosomal protein S10 [Listeria seeligeri FSL S4-171]
 gi|328468117|gb|EGF39123.1| 30S ribosomal protein S10 [Listeria monocytogenes 1816]
          Length = 102

 Score =  107 bits (267), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D RILD S  +IV T K+SG+ + GPIP P     +TV R+ H  K SR+Q
Sbjct: 5   KIRIRLKAYDHRILDQSAEKIVETAKRSGASVSGPIPLPTEKSIYTVLRAVHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTPQTVD+LM+LD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDIVNPTPQTVDSLMRLDLPSGVDIEIKL 102


>gi|47094371|ref|ZP_00232065.1| 30S ribosomal protein [Listeria monocytogenes str. 4b H7858]
 gi|47017253|gb|EAL08092.1| 30S ribosomal protein [Listeria monocytogenes str. 4b H7858]
          Length = 125

 Score =  107 bits (267), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D RILD S  +IV T K+SG+ + GPIP P     +TV R+ H  K SR+Q
Sbjct: 28  KIRIRLKAYDHRILDQSAEKIVETAKRSGASVSGPIPLPTEKSIYTVLRAVHKYKDSREQ 87

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTPQTVD+LM+LD+ +GV++ IKL
Sbjct: 88  FEMRTHKRLIDIVNPTPQTVDSLMRLDLPSGVDIEIKL 125


>gi|158319542|ref|YP_001512049.1| ribosomal protein S10 [Alkaliphilus oremlandii OhILAs]
 gi|166991563|sp|A8MLD9|RS10_ALKOO RecName: Full=30S ribosomal protein S10
 gi|158139741|gb|ABW18053.1| ribosomal protein S10 [Alkaliphilus oremlandii OhILAs]
          Length = 104

 Score =  107 bits (267), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 53/104 (50%), Positives = 72/104 (69%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M   N +I I LKA+D   LD S  +IV T KKSG+++ GP+P P   +  T+ R+ H  
Sbjct: 1   MAKNNQKIRIRLKAYDHMALDQSAEKIVETAKKSGAEVSGPVPLPTEKQIITILRAVHKY 60

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+Q EMR +KRL+ I+ PTP+TVDALM+LD+ AGV++ IKL
Sbjct: 61  KDSREQFEMRTHKRLIDILNPTPKTVDALMRLDLPAGVDIEIKL 104


>gi|289641167|ref|ZP_06473335.1| ribosomal protein S10 [Frankia symbiont of Datisca glomerata]
 gi|289509108|gb|EFD30039.1| ribosomal protein S10 [Frankia symbiont of Datisca glomerata]
          Length = 102

 Score =  107 bits (267), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 53/104 (50%), Positives = 74/104 (71%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M ++ IRI   LKA+D  I+DSS R+IV T  ++G+Q+ GP+P P     + V RSPH  
Sbjct: 1   MAAQKIRIR--LKAYDHEIIDSSARKIVETVTRTGAQVAGPVPLPTEKNVYCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+  EMR +KRL+ I+ PTP+TVD+LM+LD+ AGV++ IKL
Sbjct: 59  KDSREHFEMRTHKRLIDILDPTPKTVDSLMRLDLPAGVDIEIKL 102


>gi|29374850|ref|NP_814003.1| 30S ribosomal protein S10 [Enterococcus faecalis V583]
 gi|294781050|ref|ZP_06746401.1| ribosomal protein S10 [Enterococcus faecalis PC1.1]
 gi|300862277|ref|ZP_07108357.1| ribosomal protein S10 [Enterococcus faecalis TUSoD Ef11]
 gi|44888454|sp|Q839G5|RS10_ENTFA RecName: Full=30S ribosomal protein S10
 gi|29342308|gb|AAO80074.1| ribosomal protein S10 [Enterococcus faecalis V583]
 gi|294451853|gb|EFG20304.1| ribosomal protein S10 [Enterococcus faecalis PC1.1]
 gi|295112505|emb|CBL31142.1| ribosomal protein S10, bacterial/organelle [Enterococcus sp. 7L76]
 gi|300848802|gb|EFK76559.1| ribosomal protein S10 [Enterococcus faecalis TUSoD Ef11]
 gi|323479421|gb|ADX78860.1| ribosomal protein S10 [Enterococcus faecalis 62]
          Length = 102

 Score =  107 bits (267), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA++ RILD S  +IV T K++G+ + GPIP P     +TV R+ H  K SR+Q
Sbjct: 5   KIRIRLKAYEHRILDQSADKIVETAKRTGADVSGPIPLPTERSLYTVIRATHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTP+TVDALMKLD+ +GVN+ IKL
Sbjct: 65  FEMRTHKRLIDIVNPTPKTVDALMKLDLPSGVNIEIKL 102


>gi|297564036|ref|YP_003683009.1| ribosomal protein S10 [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
 gi|296848485|gb|ADH70503.1| ribosomal protein S10 [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
          Length = 102

 Score =  107 bits (267), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 53/104 (50%), Positives = 73/104 (70%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LKA+D  ++DSS R+IV T  ++G+Q+ GP+P P     + V RSPH  
Sbjct: 1   MAGQKIRIR--LKAYDHEVIDSSARKIVETVTRTGAQVAGPVPLPTEKNVYCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+  EMR +KRL+ II PTP+TVD+LM+LD+ AGV++ IKL
Sbjct: 59  KDSREHFEMRTHKRLIDIIDPTPKTVDSLMRLDLPAGVDIEIKL 102


>gi|229542204|ref|ZP_04431264.1| ribosomal protein S10 [Bacillus coagulans 36D1]
 gi|229326624|gb|EEN92299.1| ribosomal protein S10 [Bacillus coagulans 36D1]
          Length = 102

 Score =  107 bits (267), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D RILD S  +IV T K+SG+ + GPIP P     +T+ R+ H  K SR+Q
Sbjct: 5   KIRIRLKAYDHRILDQSAEKIVETAKRSGANVSGPIPLPTEKSVYTILRAVHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTPQTVD+LM+LD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDIVNPTPQTVDSLMRLDLPSGVDIEIKL 102


>gi|315453736|ref|YP_004074006.1| 30S ribosomal protein S10 [Helicobacter felis ATCC 49179]
 gi|315132788|emb|CBY83416.1| 30S ribosomal protein S10 [Helicobacter felis ATCC 49179]
          Length = 104

 Score =  107 bits (267), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 72/96 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + LKA+D R+LD S+  IV   K+SGS+I GPIP P   RR+TV RSPH++K SR+Q
Sbjct: 3   KIRLKLKAYDHRVLDRSVMAIVEAVKRSGSEIRGPIPLPTRNRRYTVLRSPHINKDSREQ 62

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVI 102
            E+R++ RL+ I+  TP+TVD+LMKLD+A  V+V +
Sbjct: 63  FEIRVHSRLIDIMSATPETVDSLMKLDLAPEVDVEV 98


>gi|260886875|ref|ZP_05898138.1| ribosomal protein S10 [Selenomonas sputigena ATCC 35185]
 gi|260863474|gb|EEX77974.1| ribosomal protein S10 [Selenomonas sputigena ATCC 35185]
          Length = 117

 Score =  107 bits (267), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 52/102 (50%), Positives = 75/102 (73%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           S+  +I I LKA+D + LD S  +IV T K++G+++ GPIP P     +T+ RSPHV+K 
Sbjct: 16  SKQQKIRIRLKAYDHKALDQSAVKIVDTAKRTGARVSGPIPLPTEKNIYTILRSPHVNKD 75

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           SR+Q EMR +KRL+ I+ P+ +TVDALM+LD+ AGV++ IKL
Sbjct: 76  SREQFEMRTHKRLIDILDPSNKTVDALMRLDLPAGVDIEIKL 117


>gi|239825692|ref|YP_002948316.1| 30S ribosomal protein S10 [Geobacillus sp. WCH70]
 gi|295401921|ref|ZP_06811884.1| ribosomal protein S10 [Geobacillus thermoglucosidasius C56-YS93]
 gi|312109260|ref|YP_003987576.1| ribosomal protein S10 [Geobacillus sp. Y4.1MC1]
 gi|259494595|sp|C5D3R6|RS10_GEOSW RecName: Full=30S ribosomal protein S10
 gi|239805985|gb|ACS23050.1| ribosomal protein S10 [Geobacillus sp. WCH70]
 gi|294976051|gb|EFG51666.1| ribosomal protein S10 [Geobacillus thermoglucosidasius C56-YS93]
 gi|311214361|gb|ADP72965.1| ribosomal protein S10 [Geobacillus sp. Y4.1MC1]
          Length = 102

 Score =  107 bits (266), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 72/98 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D RILD S  +IV T K+SG+++ GPIP P     +T+ R+ H  K SR+Q
Sbjct: 5   KIRIRLKAYDHRILDQSAEKIVETAKRSGAKVSGPIPLPTERTVYTILRAVHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTPQTVD+LM+LD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDIVNPTPQTVDSLMRLDLPSGVDIEIKL 102


>gi|57239337|ref|YP_180473.1| 30S ribosomal protein S10 [Ehrlichia ruminantium str. Welgevonden]
 gi|58579303|ref|YP_197515.1| 30S ribosomal protein S10 [Ehrlichia ruminantium str. Welgevonden]
 gi|81557284|sp|Q5HAS1|RS10_EHRRW RecName: Full=30S ribosomal protein S10
 gi|57161416|emb|CAH58340.1| 30S ribosomal protein S10 [Ehrlichia ruminantium str. Welgevonden]
 gi|58417929|emb|CAI27133.1| 30S ribosomal protein S10 [Ehrlichia ruminantium str. Welgevonden]
          Length = 111

 Score =  107 bits (266), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFDS +LD S R I+LT K+SG+++ GPI FPR + +F VNRS HVDKKSR+Q
Sbjct: 7   KIYIELKAFDSYLLDRSARSIILTAKRSGARVNGPIFFPRRVAKFIVNRSTHVDKKSREQ 66

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRL+ + K     + ALM L + AGV+V +K+
Sbjct: 67  FEIRTHKRLISLPKANSTIIQALMSLQLPAGVDVKVKV 104


>gi|330839327|ref|YP_004413907.1| 30S ribosomal protein S10 [Selenomonas sputigena ATCC 35185]
 gi|329747091|gb|AEC00448.1| 30S ribosomal protein S10 [Selenomonas sputigena ATCC 35185]
          Length = 103

 Score =  107 bits (266), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 52/102 (50%), Positives = 75/102 (73%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           S+  +I I LKA+D + LD S  +IV T K++G+++ GPIP P     +T+ RSPHV+K 
Sbjct: 2   SKQQKIRIRLKAYDHKALDQSAVKIVDTAKRTGARVSGPIPLPTEKNIYTILRSPHVNKD 61

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           SR+Q EMR +KRL+ I+ P+ +TVDALM+LD+ AGV++ IKL
Sbjct: 62  SREQFEMRTHKRLIDILDPSNKTVDALMRLDLPAGVDIEIKL 103


>gi|284049258|ref|YP_003399597.1| ribosomal protein S10 [Acidaminococcus fermentans DSM 20731]
 gi|283953479|gb|ADB48282.1| ribosomal protein S10 [Acidaminococcus fermentans DSM 20731]
          Length = 103

 Score =  107 bits (266), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 50/101 (49%), Positives = 74/101 (73%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           ++  +I I LKA+D + LD S  +IV T K++G+Q+ GPIP P     +T+ RSPHV+K 
Sbjct: 2   AKTQKIRIRLKAYDYKALDQSASKIVETAKRTGAQVSGPIPLPTEKNIYTILRSPHVNKD 61

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           SR+Q EMR +KRL+ I++PT +T+DAL +LD+ AGV++ IK
Sbjct: 62  SREQFEMRTHKRLVDILEPTAKTIDALTRLDLPAGVDIEIK 102


>gi|288574661|ref|ZP_06393018.1| ribosomal protein S10 [Dethiosulfovibrio peptidovorans DSM 11002]
 gi|288570402|gb|EFC91959.1| ribosomal protein S10 [Dethiosulfovibrio peptidovorans DSM 11002]
          Length = 101

 Score =  107 bits (266), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 73/98 (74%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD ++LD+S  +I  T  +SG+++ GPIP P  + +F + +SPHVDK +R+Q
Sbjct: 4   KIRIRLKAFDHKVLDTSAAQIAETADRSGARVSGPIPLPTEVNKFCILKSPHVDKDAREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ II P  +T+DALM+L++ +GV++ IKL
Sbjct: 64  FEMRTHKRLIDIIDPNQKTMDALMQLNLPSGVDIQIKL 101


>gi|58617357|ref|YP_196556.1| 30S ribosomal protein S10 [Ehrlichia ruminantium str. Gardel]
 gi|75432694|sp|Q5FFT9|RS10_EHRRG RecName: Full=30S ribosomal protein S10
 gi|58416969|emb|CAI28082.1| 30S ribosomal protein S10 [Ehrlichia ruminantium str. Gardel]
          Length = 110

 Score =  107 bits (266), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFDS +LD S R I+LT K+SG+++ GPI FPR + +F VNRS HVDKKSR+Q
Sbjct: 7   KIYIELKAFDSYLLDRSARSIILTAKRSGARVNGPIFFPRRVAKFIVNRSTHVDKKSREQ 66

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRL+ + K     + ALM L + AGV+V +K+
Sbjct: 67  FEIRTHKRLISLPKANSTIIQALMSLQLPAGVDVKVKV 104


>gi|125975383|ref|YP_001039293.1| SSU ribosomal protein S10P [Clostridium thermocellum ATCC 27405]
 gi|256005330|ref|ZP_05430296.1| ribosomal protein S10 [Clostridium thermocellum DSM 2360]
 gi|281419345|ref|ZP_06250360.1| ribosomal protein S10 [Clostridium thermocellum JW20]
 gi|166231265|sp|A3DJH1|RS10_CLOTH RecName: Full=30S ribosomal protein S10
 gi|125715608|gb|ABN54100.1| SSU ribosomal protein S10P [Clostridium thermocellum ATCC 27405]
 gi|255990766|gb|EEU00882.1| ribosomal protein S10 [Clostridium thermocellum DSM 2360]
 gi|281406965|gb|EFB37228.1| ribosomal protein S10 [Clostridium thermocellum JW20]
 gi|316939499|gb|ADU73533.1| ribosomal protein S10 [Clostridium thermocellum DSM 1313]
          Length = 103

 Score =  107 bits (266), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 72/98 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD ++LD S  +IV T K++G+++ GP+P P      T+ R+PH  K SR+Q
Sbjct: 6   KIRIRLKAFDHQVLDQSAEKIVETAKRTGAKVSGPVPLPTEREVITILRAPHKYKDSREQ 65

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTP+TVDALM+LD+ AGV++ IKL
Sbjct: 66  FEMRTHKRLIDILLPTPKTVDALMRLDLPAGVDIEIKL 103


>gi|157164137|ref|YP_001467721.1| 30S ribosomal protein S10 [Campylobacter concisus 13826]
 gi|157101400|gb|ABV23507.1| ribosomal protein S10 [Campylobacter concisus 13826]
          Length = 112

 Score =  107 bits (266), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 72/97 (74%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI + LKA+D R+LD ++  IV   K++G+ + GP+P P  I+R+TV +SPH++K SR+Q
Sbjct: 13  RIRLKLKAYDHRVLDRTVAAIVEAVKRTGADVRGPVPMPTKIKRYTVLKSPHINKDSREQ 72

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            EMRI+ R+L I+  TP+TVD+L KLD+A  VNV ++
Sbjct: 73  FEMRIHARMLDIVAATPETVDSLTKLDLAPEVNVEVR 109


>gi|42779190|ref|NP_976437.1| 30S ribosomal protein S10 [Bacillus cereus ATCC 10987]
 gi|54036380|sp|Q73F97|RS10_BACC1 RecName: Full=30S ribosomal protein S10
 gi|42735105|gb|AAS39045.1| ribosomal protein S10 [Bacillus cereus ATCC 10987]
          Length = 102

 Score =  107 bits (266), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D RILD S  +IV T K+SG+ + GPIP P     +T+ R+ H  K SR+Q
Sbjct: 5   KIRIRLKAYDHRILDQSAEKIVETAKRSGATVSGPIPLPTEKTVYTILRAVHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTPQTVD+LM+LD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDIVSPTPQTVDSLMRLDLXSGVDIEIKL 102


>gi|89100350|ref|ZP_01173215.1| 30S ribosomal protein S10 [Bacillus sp. NRRL B-14911]
 gi|89084971|gb|EAR64107.1| 30S ribosomal protein S10 [Bacillus sp. NRRL B-14911]
          Length = 102

 Score =  107 bits (266), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D RILD S  +IV T K+SG+ + GPIP P     +T+ R+ H  K SR+Q
Sbjct: 5   KIRIRLKAYDHRILDQSAEKIVETAKRSGAAVSGPIPLPTEKSIYTILRAVHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ II PTPQTVD+LM+LD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDIINPTPQTVDSLMRLDLPSGVDIEIKL 102


>gi|225024696|ref|ZP_03713888.1| hypothetical protein EIKCOROL_01578 [Eikenella corrodens ATCC
           23834]
 gi|225076394|ref|ZP_03719593.1| hypothetical protein NEIFLAOT_01439 [Neisseria flavescens
           NRL30031/H210]
 gi|238023038|ref|ZP_04603464.1| hypothetical protein GCWU000324_02961 [Kingella oralis ATCC 51147]
 gi|241759624|ref|ZP_04757725.1| ribosomal protein S10 [Neisseria flavescens SK114]
 gi|255068547|ref|ZP_05320402.1| ribosomal protein S10 [Neisseria sicca ATCC 29256]
 gi|261366026|ref|ZP_05978909.1| ribosomal protein S10 [Neisseria mucosa ATCC 25996]
 gi|261380558|ref|ZP_05985131.1| ribosomal protein S10 [Neisseria subflava NJ9703]
 gi|294668922|ref|ZP_06734009.1| ribosomal protein S10 [Neisseria elongata subsp. glycolytica ATCC
           29315]
 gi|294789196|ref|ZP_06754435.1| ribosomal protein S10 [Simonsiella muelleri ATCC 29453]
 gi|298370592|ref|ZP_06981907.1| ribosomal protein S10 [Neisseria sp. oral taxon 014 str. F0314]
 gi|313667438|ref|YP_004047722.1| 30S ribosomal protein S10 [Neisseria lactamica ST-640]
 gi|319639548|ref|ZP_07994295.1| 30S ribosomal protein S10 [Neisseria mucosa C102]
 gi|224942535|gb|EEG23744.1| hypothetical protein EIKCOROL_01578 [Eikenella corrodens ATCC
           23834]
 gi|224952242|gb|EEG33451.1| hypothetical protein NEIFLAOT_01439 [Neisseria flavescens
           NRL30031/H210]
 gi|237865421|gb|EEP66561.1| hypothetical protein GCWU000324_02961 [Kingella oralis ATCC 51147]
 gi|241319996|gb|EER56377.1| ribosomal protein S10 [Neisseria flavescens SK114]
 gi|254674257|emb|CBA10041.1| 30S ribosomal protein S10 [Neisseria meningitidis alpha275]
 gi|255047183|gb|EET42647.1| ribosomal protein S10 [Neisseria sicca ATCC 29256]
 gi|284796526|gb|EFC51873.1| ribosomal protein S10 [Neisseria subflava NJ9703]
 gi|288565381|gb|EFC86941.1| ribosomal protein S10 [Neisseria mucosa ATCC 25996]
 gi|291309095|gb|EFE50338.1| ribosomal protein S10 [Neisseria elongata subsp. glycolytica ATCC
           29315]
 gi|294482937|gb|EFG30625.1| ribosomal protein S10 [Simonsiella muelleri ATCC 29453]
 gi|298281202|gb|EFI22692.1| ribosomal protein S10 [Neisseria sp. oral taxon 014 str. F0314]
 gi|313004900|emb|CBN86326.1| 30S ribosomal protein S10 [Neisseria lactamica 020-06]
 gi|317399119|gb|EFV79793.1| 30S ribosomal protein S10 [Neisseria mucosa C102]
          Length = 103

 Score =  107 bits (266), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 73/100 (73%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA+D  ++D S +EIV T K++G+ + GPIP P  I RF + RSPHV+K SR
Sbjct: 3   NQKIRIRLKAYDYSLIDRSAQEIVETAKRTGAVVKGPIPLPTKIERFNILRSPHVNKTSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +QLE+R + RL+ I+  T +T DALMKLD+ AGV+V IK+
Sbjct: 63  EQLEIRTHLRLMDIVDWTDKTTDALMKLDLPAGVDVEIKV 102


>gi|15676068|ref|NP_273198.1| 30S ribosomal protein S10 [Neisseria meningitidis MC58]
 gi|59802162|ref|YP_208874.1| 30S ribosomal protein S10 [Neisseria gonorrhoeae FA 1090]
 gi|161870917|ref|YP_001600097.1| 30S ribosomal protein S10 [Neisseria meningitidis 053442]
 gi|218767172|ref|YP_002341684.1| 30S ribosomal protein S10 [Neisseria meningitidis Z2491]
 gi|240081690|ref|ZP_04726233.1| 30S ribosomal protein S10 [Neisseria gonorrhoeae FA19]
 gi|240124462|ref|ZP_04737418.1| 30S ribosomal protein S10 [Neisseria gonorrhoeae PID332]
 gi|254805815|ref|YP_003084036.1| 30S ribosomal protein S10 [Neisseria meningitidis alpha14]
 gi|261400048|ref|ZP_05986173.1| ribosomal protein S10 [Neisseria lactamica ATCC 23970]
 gi|268597788|ref|ZP_06131955.1| 30S ribosomal protein S10 [Neisseria gonorrhoeae FA19]
 gi|268683092|ref|ZP_06149954.1| 30S ribosomal protein S10 [Neisseria gonorrhoeae PID332]
 gi|293398204|ref|ZP_06642409.1| 30S ribosomal protein S10 [Neisseria gonorrhoeae F62]
 gi|296314588|ref|ZP_06864529.1| ribosomal protein S10 [Neisseria polysaccharea ATCC 43768]
 gi|304388941|ref|ZP_07370988.1| 30S ribosomal protein S10 [Neisseria meningitidis ATCC 13091]
 gi|54039319|sp|P66333|RS10_NEIMB RecName: Full=30S ribosomal protein S10
 gi|54042100|sp|P66332|RS10_NEIMA RecName: Full=30S ribosomal protein S10
 gi|75432356|sp|Q5F5S5|RS10_NEIG1 RecName: Full=30S ribosomal protein S10
 gi|189040380|sp|A9M3W8|RS10_NEIM0 RecName: Full=30S ribosomal protein S10
 gi|7225358|gb|AAF40599.1| 30S ribosomal protein S10 [Neisseria meningitidis MC58]
 gi|59719057|gb|AAW90462.1| 30S ribosomal protein S10 [Neisseria gonorrhoeae FA 1090]
 gi|121051180|emb|CAM07451.1| 30S ribosomal protein S10 [Neisseria meningitidis Z2491]
 gi|161596470|gb|ABX74130.1| 30S ribosomal protein S10 [Neisseria meningitidis 053442]
 gi|254669357|emb|CBA08448.1| 30S ribosomal protein S10 [Neisseria meningitidis alpha14]
 gi|254671118|emb|CBA08114.1| 30S ribosomal protein S10 [Neisseria meningitidis alpha153]
 gi|261391677|emb|CAX49125.1| 30S ribosomal protein S10 [Neisseria meningitidis 8013]
 gi|268551576|gb|EEZ46595.1| 30S ribosomal protein S10 [Neisseria gonorrhoeae FA19]
 gi|268623376|gb|EEZ55776.1| 30S ribosomal protein S10 [Neisseria gonorrhoeae PID332]
 gi|269210273|gb|EEZ76728.1| ribosomal protein S10 [Neisseria lactamica ATCC 23970]
 gi|291611467|gb|EFF40537.1| 30S ribosomal protein S10 [Neisseria gonorrhoeae F62]
 gi|296838655|gb|EFH22593.1| ribosomal protein S10 [Neisseria polysaccharea ATCC 43768]
 gi|304337075|gb|EFM03262.1| 30S ribosomal protein S10 [Neisseria meningitidis ATCC 13091]
 gi|308388357|gb|ADO30677.1| 30S ribosomal protein S10 [Neisseria meningitidis alpha710]
 gi|309379162|emb|CBX22293.1| 30S ribosomal protein S10 [Neisseria lactamica Y92-1009]
 gi|316985669|gb|EFV64615.1| ribosomal protein S10 [Neisseria meningitidis H44/76]
 gi|319411377|emb|CBY91788.1| 30S ribosomal protein S10 [Neisseria meningitidis WUE 2594]
 gi|325129058|gb|EGC51907.1| ribosomal protein S10 [Neisseria meningitidis N1568]
 gi|325131082|gb|EGC53805.1| ribosomal protein S10 [Neisseria meningitidis OX99.30304]
 gi|325135146|gb|EGC57772.1| ribosomal protein S10 [Neisseria meningitidis M13399]
 gi|325137199|gb|EGC59794.1| ribosomal protein S10 [Neisseria meningitidis M0579]
 gi|325141155|gb|EGC63655.1| ribosomal protein S10 [Neisseria meningitidis CU385]
 gi|325145338|gb|EGC67615.1| ribosomal protein S10 [Neisseria meningitidis M01-240013]
 gi|325199353|gb|ADY94808.1| ribosomal protein S10 [Neisseria meningitidis H44/76]
 gi|325203025|gb|ADY98479.1| ribosomal protein S10 [Neisseria meningitidis M01-240149]
 gi|325203260|gb|ADY98713.1| ribosomal protein S10 [Neisseria meningitidis M01-240355]
 gi|325205233|gb|ADZ00686.1| ribosomal protein S10 [Neisseria meningitidis M04-240196]
 gi|325207176|gb|ADZ02628.1| ribosomal protein S10 [Neisseria meningitidis NZ-05/33]
          Length = 103

 Score =  107 bits (266), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 73/100 (73%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA+D  ++D S +EIV T K++G+ + GPIP P  I RF + RSPHV+K SR
Sbjct: 3   NQKIRIRLKAYDYALIDRSAQEIVETAKRTGAVVKGPIPLPTKIERFNILRSPHVNKTSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +QLE+R + RL+ I+  T +T DALMKLD+ AGV+V IK+
Sbjct: 63  EQLEIRTHLRLMDIVDWTDKTTDALMKLDLPAGVDVEIKV 102


>gi|299820954|ref|ZP_07052843.1| 30S ribosomal protein S10 [Listeria grayi DSM 20601]
 gi|299817975|gb|EFI85210.1| 30S ribosomal protein S10 [Listeria grayi DSM 20601]
          Length = 117

 Score =  107 bits (266), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D RILD S  +IV T K+SG+ + GPIP P     +T+ R+ H  K SR+Q
Sbjct: 20  KIRIRLKAYDHRILDQSAEKIVETAKRSGASVSGPIPLPTEKSVYTILRAVHKYKDSREQ 79

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTPQTVD+LM+LD+ +GV++ IKL
Sbjct: 80  FEMRTHKRLIDIVNPTPQTVDSLMRLDLPSGVDIEIKL 117


>gi|312132015|ref|YP_003999355.1| ssu ribosomal protein s10p [Leadbetterella byssophila DSM 17132]
 gi|311908561|gb|ADQ19002.1| SSU ribosomal protein S10P [Leadbetterella byssophila DSM 17132]
          Length = 101

 Score =  107 bits (266), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK+FD  ++D+S  +IV   K +G+ + GPIP P  I +FTV RSPHV KKSR+Q
Sbjct: 4   KIRIKLKSFDHSLVDNSAEKIVKAVKSTGATVSGPIPLPTRIEKFTVLRSPHVSKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            ++  YKRL+ I   +P+TVDALMKL++ AGV+V IK+
Sbjct: 64  FQLSTYKRLIDIFSASPKTVDALMKLELPAGVDVEIKV 101


>gi|322378780|ref|ZP_08053209.1| 30S ribosomal protein S10 [Helicobacter suis HS1]
 gi|322380629|ref|ZP_08054781.1| 30S ribosomal protein S10 [Helicobacter suis HS5]
 gi|321146951|gb|EFX41699.1| 30S ribosomal protein S10 [Helicobacter suis HS5]
 gi|321148810|gb|EFX43281.1| 30S ribosomal protein S10 [Helicobacter suis HS1]
          Length = 104

 Score =  107 bits (266), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 71/96 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + LKA+D R+LD S+  IV   K+SGS+I GPIP P   RR+TV RSPH++K SR+Q
Sbjct: 3   KIRLKLKAYDHRVLDRSVVAIVEAVKRSGSEIRGPIPLPTKNRRYTVLRSPHINKDSREQ 62

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVI 102
            E+R++ RL+ I+  TP+TVD+LMKLD+A  V V +
Sbjct: 63  FEIRVHSRLIDIMAATPETVDSLMKLDLAPEVEVEV 98


>gi|312899042|ref|ZP_07758426.1| ribosomal protein S10 [Megasphaera micronuciformis F0359]
 gi|310619827|gb|EFQ03403.1| ribosomal protein S10 [Megasphaera micronuciformis F0359]
          Length = 103

 Score =  107 bits (266), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 52/102 (50%), Positives = 74/102 (72%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           ++  RI I LKA+D + LD S  +IV T K++G+ + GPIP P     FT+ RSPHV+K 
Sbjct: 2   AKQERIRIRLKAYDHKTLDLSAAKIVDTAKRTGAMVSGPIPLPTEKNIFTILRSPHVNKD 61

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           SR+Q E+R +KRL+ I+  +P+TVDALM+LD+ AGV++ IKL
Sbjct: 62  SREQFELRTHKRLIDILNASPKTVDALMRLDLPAGVDIQIKL 103


>gi|294055237|ref|YP_003548895.1| ribosomal protein S10 [Coraliomargarita akajimensis DSM 45221]
 gi|293614570|gb|ADE54725.1| ribosomal protein S10 [Coraliomargarita akajimensis DSM 45221]
          Length = 102

 Score =  107 bits (266), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 72/98 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I LK FD R++D S  +IV T K+SG+++ GP+P P  I +FTVNRS HV+KK+ +Q
Sbjct: 5   RIRIRLKGFDYRVIDQSAADIVETAKRSGARVSGPVPMPTRIEKFTVNRSVHVNKKAMEQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRL+ II+PT  TVD L KL++ AGV++ I +
Sbjct: 65  FEVRTHKRLIDIIEPTAATVDELKKLNLPAGVDISINV 102


>gi|110774858|ref|XP_001120185.1| PREDICTED: 30S ribosomal protein S10-like [Apis mellifera]
          Length = 103

 Score =  107 bits (266), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 74/101 (73%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
           +N +I I LKA+D  ++D S +EIV T K++G+ + GPIP P  I RF + RSPHV+K S
Sbjct: 2   KNQKIRIRLKAYDYALIDRSAQEIVDTAKRTGAVVKGPIPLPTKIERFNLLRSPHVNKTS 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           R+QLE+R + RL+ II  T +T DALMKLD+ AGV+V IK+
Sbjct: 62  REQLEIRTHLRLMDIIDWTDKTTDALMKLDLPAGVDVEIKV 102


>gi|158317792|ref|YP_001510300.1| 30S ribosomal protein S10 [Frankia sp. EAN1pec]
 gi|288917229|ref|ZP_06411598.1| ribosomal protein S10 [Frankia sp. EUN1f]
 gi|226705448|sp|A8LC57|RS10_FRASN RecName: Full=30S ribosomal protein S10
 gi|158113197|gb|ABW15394.1| ribosomal protein S10 [Frankia sp. EAN1pec]
 gi|288351420|gb|EFC85628.1| ribosomal protein S10 [Frankia sp. EUN1f]
          Length = 102

 Score =  107 bits (266), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 74/104 (71%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M ++ IRI   LKA+D  ++DSS R+IV T  ++G+Q+ GP+P P     + V RSPH  
Sbjct: 1   MAAQKIRIR--LKAYDHEVIDSSARKIVETVTRTGAQVAGPVPLPTEKNVYCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+  EMR +KRL+ I+ PTP+TVD+LM+LD+ AGV++ IKL
Sbjct: 59  KDSREHFEMRTHKRLIDILDPTPKTVDSLMRLDLPAGVDIEIKL 102


>gi|189218694|ref|YP_001939335.1| Ribosomal protein S10 [Methylacidiphilum infernorum V4]
 gi|189185552|gb|ACD82737.1| Ribosomal protein S10 [Methylacidiphilum infernorum V4]
          Length = 101

 Score =  107 bits (266), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK+FD R+LD +  EI  T +++GS + GPIP P  I R+ VNRSPHVDKKS D 
Sbjct: 4   KIRIRLKSFDYRLLDRAASEIAETARRTGSAVSGPIPLPTKIERYAVNRSPHVDKKSMDL 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRL+ I +PT +TVD L KL++ AGV++ I++
Sbjct: 64  FEIRTHKRLIDIKEPTSKTVDELKKLNLPAGVDISIRI 101


>gi|257784965|ref|YP_003180182.1| 30S ribosomal protein S10 [Atopobium parvulum DSM 20469]
 gi|257473472|gb|ACV51591.1| ribosomal protein S10 [Atopobium parvulum DSM 20469]
          Length = 102

 Score =  107 bits (266), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 53/104 (50%), Positives = 74/104 (71%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M+S+ IRI   LK +D  ++D S + IV T +K+G+++ GPIP P     +TV RSPH D
Sbjct: 1   MSSQKIRIR--LKGYDHEVIDQSAKLIVDTAQKTGARVSGPIPLPTERNLYTVIRSPHKD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SRDQ EMR +KRL+ I+ P+  TVD+LM+LD+ AGV++ IKL
Sbjct: 59  KDSRDQFEMRTHKRLIDILDPSASTVDSLMRLDLPAGVDIEIKL 102


>gi|251799643|ref|YP_003014374.1| ribosomal protein S10 [Paenibacillus sp. JDR-2]
 gi|308070976|ref|YP_003872581.1| 30S ribosomal protein S10 [Paenibacillus polymyxa E681]
 gi|310644203|ref|YP_003948962.1| 30S ribosomal protein s10 [Paenibacillus polymyxa SC2]
 gi|247547269|gb|ACT04288.1| ribosomal protein S10 [Paenibacillus sp. JDR-2]
 gi|305860255|gb|ADM72043.1| 30S ribosomal protein S10 [Paenibacillus polymyxa E681]
 gi|309249154|gb|ADO58721.1| 30S ribosomal protein S10 [Paenibacillus polymyxa SC2]
          Length = 102

 Score =  106 bits (265), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D RILD S  +IV T K+SG+ + GPIP P   +  T+ R+ H  K SR+Q
Sbjct: 5   KIRIRLKAYDHRILDQSAEKIVETAKRSGAGVSGPIPLPTEKQIITILRAVHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTPQTVDALM+LD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDIVNPTPQTVDALMRLDLPSGVDIEIKL 102


>gi|116493164|ref|YP_804899.1| 30S ribosomal protein S10 [Pediococcus pentosaceus ATCC 25745]
 gi|270291134|ref|ZP_06197357.1| 30S ribosomal protein S10 [Pediococcus acidilactici 7_4]
 gi|122265372|sp|Q03EB5|RS10_PEDPA RecName: Full=30S ribosomal protein S10
 gi|116103314|gb|ABJ68457.1| SSU ribosomal protein S10P [Pediococcus pentosaceus ATCC 25745]
 gi|270280530|gb|EFA26365.1| 30S ribosomal protein S10 [Pediococcus acidilactici 7_4]
          Length = 102

 Score =  106 bits (265), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 72/98 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA++ RILD S  +IV T K++G+ I GPIP P     +TV  SPH  KK+R+Q
Sbjct: 5   KIRIRLKAYEHRILDQSADKIVETAKRTGATISGPIPLPTERTVYTVLSSPHKFKKAREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTP+TVD+LMKLD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDIVNPTPKTVDSLMKLDLPSGVDIEIKL 102


>gi|258615212|ref|ZP_05712982.1| 30S ribosomal protein S10 [Enterococcus faecium DO]
 gi|293379445|ref|ZP_06625589.1| ribosomal protein S10 [Enterococcus faecium PC4.1]
 gi|293556600|ref|ZP_06675168.1| ribosomal protein S10 [Enterococcus faecium E1039]
 gi|293562945|ref|ZP_06677412.1| ribosomal protein S10 [Enterococcus faecium E1162]
 gi|293567932|ref|ZP_06679273.1| ribosomal protein S10 [Enterococcus faecium E1071]
 gi|293570683|ref|ZP_06681733.1| ribosomal protein S10 [Enterococcus faecium E980]
 gi|294615394|ref|ZP_06695267.1| ribosomal protein S10 [Enterococcus faecium E1636]
 gi|294618321|ref|ZP_06697902.1| ribosomal protein S10 [Enterococcus faecium E1679]
 gi|294621077|ref|ZP_06700268.1| ribosomal protein S10 [Enterococcus faecium U0317]
 gi|291589517|gb|EFF21324.1| ribosomal protein S10 [Enterococcus faecium E1071]
 gi|291591768|gb|EFF23404.1| ribosomal protein S10 [Enterococcus faecium E1636]
 gi|291595415|gb|EFF26727.1| ribosomal protein S10 [Enterococcus faecium E1679]
 gi|291599313|gb|EFF30339.1| ribosomal protein S10 [Enterococcus faecium U0317]
 gi|291601276|gb|EFF31560.1| ribosomal protein S10 [Enterococcus faecium E1039]
 gi|291605071|gb|EFF34538.1| ribosomal protein S10 [Enterococcus faecium E1162]
 gi|291609155|gb|EFF38427.1| ribosomal protein S10 [Enterococcus faecium E980]
 gi|292641968|gb|EFF60134.1| ribosomal protein S10 [Enterococcus faecium PC4.1]
          Length = 102

 Score =  106 bits (265), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA++ RILD S  +IV T K++G+ + GPIP P     +T+ R+ H  K SR+Q
Sbjct: 5   KIRIRLKAYEHRILDQSADKIVETAKRTGASVSGPIPLPTERSLYTIIRATHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTP+TVDALMKLD+ +GVN+ IKL
Sbjct: 65  FEMRTHKRLIDIVNPTPKTVDALMKLDLPSGVNIEIKL 102


>gi|187734816|ref|YP_001876928.1| ribosomal protein S10 [Akkermansia muciniphila ATCC BAA-835]
 gi|254809571|sp|B2UMU1|RS10_AKKM8 RecName: Full=30S ribosomal protein S10
 gi|187424868|gb|ACD04147.1| ribosomal protein S10 [Akkermansia muciniphila ATCC BAA-835]
          Length = 102

 Score =  106 bits (265), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 74/98 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I L+AFD R +D S +EIV T K++G+++ GPIP P  I +F+VNRS HV+KKS +Q
Sbjct: 5   KIRIRLRAFDYRAIDRSSQEIVETAKRTGAKVHGPIPLPTRIEKFSVNRSVHVNKKSAEQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRLL I+ PT +T+D L KL++ AGV++ I++
Sbjct: 65  FEIRTHKRLLDIVDPTARTIDELKKLNLPAGVDITIRI 102


>gi|212637953|ref|YP_002314473.1| 30S ribosomal protein S10 [Anoxybacillus flavithermus WK1]
 gi|212559433|gb|ACJ32488.1| Ribosomal protein S10 [Anoxybacillus flavithermus WK1]
          Length = 115

 Score =  106 bits (265), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D RILD S  +IV T K+SG+ + GPIP P     +T+ R+ H  K SR+Q
Sbjct: 18  KIRIRLKAYDHRILDQSAEKIVETAKRSGATVSGPIPLPTEKTVYTILRAVHKYKDSREQ 77

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTPQTVD+LM+LD+ +GV++ IKL
Sbjct: 78  FEMRTHKRLIDIVNPTPQTVDSLMRLDLPSGVDIEIKL 115


>gi|311029048|ref|ZP_07707138.1| Ribosomal protein S10 [Bacillus sp. m3-13]
          Length = 102

 Score =  106 bits (265), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D RILD S  +IV T K+SG+ + GPIP P     +T+ R+ H  K SR+Q
Sbjct: 5   KIRIRLKAYDHRILDQSSEKIVETAKRSGATVSGPIPLPTERSVYTILRAVHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ II PTPQTVD+LM+LD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDIINPTPQTVDSLMRLDLPSGVDIEIKL 102


>gi|30018379|ref|NP_830010.1| 30S ribosomal protein S10 [Bacillus cereus ATCC 14579]
 gi|49479272|ref|YP_034461.1| 30S ribosomal protein S10 [Bacillus thuringiensis serovar konkukian
           str. 97-27]
 gi|52145109|ref|YP_081720.1| 30S ribosomal protein S10 [Bacillus cereus E33L]
 gi|118475878|ref|YP_893029.1| 30S ribosomal protein S10 [Bacillus thuringiensis str. Al Hakam]
 gi|152973955|ref|YP_001373472.1| 30S ribosomal protein S10 [Bacillus cereus subsp. cytotoxis NVH
           391-98]
 gi|206972252|ref|ZP_03233199.1| 30S ribosomal protein S10 [Bacillus cereus AH1134]
 gi|217957684|ref|YP_002336228.1| 30S ribosomal protein S10 [Bacillus cereus AH187]
 gi|218234609|ref|YP_002364958.1| 30S ribosomal protein S10 [Bacillus cereus B4264]
 gi|218901313|ref|YP_002449147.1| ribosomal protein S10 [Bacillus cereus AH820]
 gi|222093879|ref|YP_002527929.1| 30S ribosomal protein s10 [Bacillus cereus Q1]
 gi|225862161|ref|YP_002747539.1| 30S ribosomal protein S10 [Bacillus cereus 03BB102]
 gi|228912848|ref|ZP_04076495.1| 30S ribosomal protein S10 [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228919059|ref|ZP_04082438.1| 30S ribosomal protein S10 [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228925362|ref|ZP_04088458.1| 30S ribosomal protein S10 [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228931611|ref|ZP_04094517.1| 30S ribosomal protein S10 [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228943915|ref|ZP_04106300.1| 30S ribosomal protein S10 [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|228950657|ref|ZP_04112791.1| 30S ribosomal protein S10 [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|228956550|ref|ZP_04118346.1| 30S ribosomal protein S10 [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|228983364|ref|ZP_04143577.1| 30S ribosomal protein S10 [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|228989318|ref|ZP_04149309.1| 30S ribosomal protein S10 [Bacillus pseudomycoides DSM 12442]
 gi|228995500|ref|ZP_04155168.1| 30S ribosomal protein S10 [Bacillus mycoides Rock3-17]
 gi|229003125|ref|ZP_04160971.1| 30S ribosomal protein S10 [Bacillus mycoides Rock1-4]
 gi|229041014|ref|ZP_04189777.1| 30S ribosomal protein S10 [Bacillus cereus AH676]
 gi|229067874|ref|ZP_04201191.1| 30S ribosomal protein S10 [Bacillus cereus F65185]
 gi|229077409|ref|ZP_04210062.1| 30S ribosomal protein S10 [Bacillus cereus Rock4-2]
 gi|229083429|ref|ZP_04215777.1| 30S ribosomal protein S10 [Bacillus cereus Rock3-44]
 gi|229089240|ref|ZP_04220521.1| 30S ribosomal protein S10 [Bacillus cereus Rock3-42]
 gi|229107795|ref|ZP_04237431.1| 30S ribosomal protein S10 [Bacillus cereus Rock1-15]
 gi|229119771|ref|ZP_04249032.1| 30S ribosomal protein S10 [Bacillus cereus 95/8201]
 gi|229125626|ref|ZP_04254658.1| 30S ribosomal protein S10 [Bacillus cereus BDRD-Cer4]
 gi|229136955|ref|ZP_04265582.1| 30S ribosomal protein S10 [Bacillus cereus BDRD-ST26]
 gi|229142915|ref|ZP_04271356.1| 30S ribosomal protein S10 [Bacillus cereus BDRD-ST24]
 gi|229148518|ref|ZP_04276774.1| 30S ribosomal protein S10 [Bacillus cereus m1550]
 gi|229153887|ref|ZP_04282017.1| 30S ribosomal protein S10 [Bacillus cereus ATCC 4342]
 gi|229159282|ref|ZP_04287306.1| 30S ribosomal protein S10 [Bacillus cereus R309803]
 gi|229176709|ref|ZP_04304113.1| 30S ribosomal protein S10 [Bacillus cereus 172560W]
 gi|229182503|ref|ZP_04309754.1| 30S ribosomal protein S10 [Bacillus cereus BGSC 6E1]
 gi|229188394|ref|ZP_04315442.1| 30S ribosomal protein S10 [Bacillus cereus ATCC 10876]
 gi|229194499|ref|ZP_04321302.1| 30S ribosomal protein S10 [Bacillus cereus m1293]
 gi|254720831|ref|ZP_05182623.1| 30S ribosomal protein S10 [Bacillus anthracis str. A1055]
 gi|296500943|ref|YP_003662643.1| 30S ribosomal protein S10 [Bacillus thuringiensis BMB171]
 gi|300119579|ref|ZP_07057123.1| 30S ribosomal protein S10 [Bacillus cereus SJ1]
 gi|301051846|ref|YP_003790057.1| 30S ribosomal protein S10 [Bacillus anthracis CI]
 gi|44888443|sp|Q81J43|RS10_BACCR RecName: Full=30S ribosomal protein S10
 gi|54036357|sp|Q6HPQ9|RS10_BACHK RecName: Full=30S ribosomal protein S10
 gi|81689840|sp|Q63H91|RS10_BACCZ RecName: Full=30S ribosomal protein S10
 gi|166231240|sp|A0R8H9|RS10_BACAH RecName: Full=30S ribosomal protein S10
 gi|189040359|sp|A7GK19|RS10_BACCN RecName: Full=30S ribosomal protein S10
 gi|226705396|sp|B7JKB8|RS10_BACC0 RecName: Full=30S ribosomal protein S10
 gi|226705398|sp|B7HJ47|RS10_BACC4 RecName: Full=30S ribosomal protein S10
 gi|226705399|sp|B7HQU3|RS10_BACC7 RecName: Full=30S ribosomal protein S10
 gi|254809578|sp|C1ET38|RS10_BACC3 RecName: Full=30S ribosomal protein S10
 gi|254809579|sp|B9IZJ3|RS10_BACCQ RecName: Full=30S ribosomal protein S10
 gi|29893919|gb|AAP07211.1| SSU ribosomal protein S10P [Bacillus cereus ATCC 14579]
 gi|49330828|gb|AAT61474.1| ribosomal protein S10 (30S ribosomal protein S10) [Bacillus
           thuringiensis serovar konkukian str. 97-27]
 gi|51978578|gb|AAU20128.1| ribosomal protein S10 (30S ribosomal protein S10) [Bacillus cereus
           E33L]
 gi|118415103|gb|ABK83522.1| SSU ribosomal protein S10P [Bacillus thuringiensis str. Al Hakam]
 gi|152022707|gb|ABS20477.1| ribosomal protein S10 [Bacillus cytotoxicus NVH 391-98]
 gi|206732826|gb|EDZ50001.1| 30S ribosomal protein S10 [Bacillus cereus AH1134]
 gi|217067169|gb|ACJ81419.1| ribosomal protein S10 [Bacillus cereus AH187]
 gi|218162566|gb|ACK62558.1| ribosomal protein S10 [Bacillus cereus B4264]
 gi|218540164|gb|ACK92562.1| ribosomal protein S10 [Bacillus cereus AH820]
 gi|221237927|gb|ACM10637.1| ribosomal protein S10 (30S ribosomal protein S10) [Bacillus cereus
           Q1]
 gi|225787672|gb|ACO27889.1| 30S ribosomal protein S10 [Bacillus cereus 03BB102]
 gi|228588965|gb|EEK46980.1| 30S ribosomal protein S10 [Bacillus cereus m1293]
 gi|228595068|gb|EEK52839.1| 30S ribosomal protein S10 [Bacillus cereus ATCC 10876]
 gi|228600958|gb|EEK58527.1| 30S ribosomal protein S10 [Bacillus cereus BGSC 6E1]
 gi|228606752|gb|EEK64169.1| 30S ribosomal protein S10 [Bacillus cereus 172560W]
 gi|228624174|gb|EEK80976.1| 30S ribosomal protein S10 [Bacillus cereus R309803]
 gi|228629568|gb|EEK86265.1| 30S ribosomal protein S10 [Bacillus cereus ATCC 4342]
 gi|228634934|gb|EEK91507.1| 30S ribosomal protein S10 [Bacillus cereus m1550]
 gi|228640536|gb|EEK96925.1| 30S ribosomal protein S10 [Bacillus cereus BDRD-ST24]
 gi|228646493|gb|EEL02700.1| 30S ribosomal protein S10 [Bacillus cereus BDRD-ST26]
 gi|228657818|gb|EEL13624.1| 30S ribosomal protein S10 [Bacillus cereus BDRD-Cer4]
 gi|228663672|gb|EEL19251.1| 30S ribosomal protein S10 [Bacillus cereus 95/8201]
 gi|228675644|gb|EEL30852.1| 30S ribosomal protein S10 [Bacillus cereus Rock1-15]
 gi|228694079|gb|EEL47761.1| 30S ribosomal protein S10 [Bacillus cereus Rock3-42]
 gi|228699862|gb|EEL52499.1| 30S ribosomal protein S10 [Bacillus cereus Rock3-44]
 gi|228705900|gb|EEL58233.1| 30S ribosomal protein S10 [Bacillus cereus Rock4-2]
 gi|228715233|gb|EEL67092.1| 30S ribosomal protein S10 [Bacillus cereus F65185]
 gi|228727311|gb|EEL78505.1| 30S ribosomal protein S10 [Bacillus cereus AH676]
 gi|228758088|gb|EEM07287.1| 30S ribosomal protein S10 [Bacillus mycoides Rock1-4]
 gi|228764229|gb|EEM13108.1| 30S ribosomal protein S10 [Bacillus mycoides Rock3-17]
 gi|228770396|gb|EEM18969.1| 30S ribosomal protein S10 [Bacillus pseudomycoides DSM 12442]
 gi|228776354|gb|EEM24707.1| 30S ribosomal protein S10 [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|228803115|gb|EEM49937.1| 30S ribosomal protein S10 [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|228809008|gb|EEM55493.1| 30S ribosomal protein S10 [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|228815748|gb|EEM61984.1| 30S ribosomal protein S10 [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|228828039|gb|EEM73767.1| 30S ribosomal protein S10 [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228834284|gb|EEM79825.1| 30S ribosomal protein S10 [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228840584|gb|EEM85846.1| 30S ribosomal protein S10 [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228846784|gb|EEM91789.1| 30S ribosomal protein S10 [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|296321995|gb|ADH04923.1| 30S ribosomal protein S10 [Bacillus thuringiensis BMB171]
 gi|298723051|gb|EFI63949.1| 30S ribosomal protein S10 [Bacillus cereus SJ1]
 gi|300374015|gb|ADK02919.1| 30S ribosomal protein S10 [Bacillus cereus biovar anthracis str.
           CI]
 gi|324324100|gb|ADY19360.1| 30S ribosomal protein S10 [Bacillus thuringiensis serovar finitimus
           YBT-020]
          Length = 102

 Score =  106 bits (265), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D RILD S  +IV T K+SG+ + GPIP P     +T+ R+ H  K SR+Q
Sbjct: 5   KIRIRLKAYDHRILDQSAEKIVETAKRSGATVSGPIPLPTEKTVYTILRAVHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTPQTVD+LM+LD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDIVSPTPQTVDSLMRLDLPSGVDIEIKL 102


>gi|294496982|ref|YP_003560682.1| 30S ribosomal protein S10 [Bacillus megaterium QM B1551]
 gi|294496984|ref|YP_003560684.1| 30S ribosomal protein S10 [Bacillus megaterium QM B1551]
 gi|295702349|ref|YP_003595424.1| 30S ribosomal protein S10 [Bacillus megaterium DSM 319]
 gi|294346919|gb|ADE67248.1| 30S ribosomal protein S10 [Bacillus megaterium QM B1551]
 gi|294346921|gb|ADE67250.1| 30S ribosomal protein S10 [Bacillus megaterium QM B1551]
 gi|294800008|gb|ADF37074.1| 30S ribosomal protein S10 [Bacillus megaterium DSM 319]
          Length = 102

 Score =  106 bits (265), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D RILD S  +IV T K+SG+ + GPIP P     +T+ R+ H  K SR+Q
Sbjct: 5   KIRIRLKAYDHRILDQSAEKIVETAKRSGAAVSGPIPLPTEKSIYTILRAVHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTPQTVD+LM+LD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDIVNPTPQTVDSLMRLDLPSGVDIEIKL 102


>gi|221632979|ref|YP_002522202.1| 30S ribosomal protein S10 [Thermomicrobium roseum DSM 5159]
 gi|221155929|gb|ACM05056.1| ribosomal protein S10 [Thermomicrobium roseum DSM 5159]
          Length = 105

 Score =  106 bits (265), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 72/98 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I LK+ D RILD S R+IV T + +G+++ GPIP P  I RFTV RSP +DK S++ 
Sbjct: 8   RIRIRLKSHDHRILDQSARQIVETAESTGAKVAGPIPLPTRIERFTVIRSPFIDKDSQEH 67

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRL+ +++P+P T+ ALM+L + AGV++ IKL
Sbjct: 68  FEIRTHKRLIDVLEPSPSTIRALMRLTLPAGVDIEIKL 105


>gi|261409522|ref|YP_003245763.1| 30S ribosomal protein S10 [Paenibacillus sp. Y412MC10]
 gi|329922038|ref|ZP_08277831.1| ribosomal protein S10 [Paenibacillus sp. HGF5]
 gi|261285985|gb|ACX67956.1| ribosomal protein S10 [Paenibacillus sp. Y412MC10]
 gi|328942421|gb|EGG38685.1| ribosomal protein S10 [Paenibacillus sp. HGF5]
          Length = 102

 Score =  106 bits (265), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D R+LD S  +IV T K+SG+ + GPIP P   +  T+ R+ H  K SR+Q
Sbjct: 5   KIRIRLKAYDHRVLDQSAEKIVETAKRSGAGVSGPIPLPTEKQVITILRAVHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTPQTVDALM+LD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDIVNPTPQTVDALMRLDLPSGVDIEIKL 102


>gi|118475131|ref|YP_891243.1| 30S ribosomal protein S10 [Campylobacter fetus subsp. fetus 82-40]
 gi|166231254|sp|A0RM10|RS10_CAMFF RecName: Full=30S ribosomal protein S10
 gi|118414357|gb|ABK82777.1| ribosomal protein S10 [Campylobacter fetus subsp. fetus 82-40]
          Length = 103

 Score =  106 bits (265), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 49/97 (50%), Positives = 71/97 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI + LKA+D R+LD ++  IV   K++G+ + GP+P P  I+R+TV +SPHV+K SR+Q
Sbjct: 3   RIRLKLKAYDHRVLDRTVAAIVEAVKRTGADVRGPVPMPTKIKRYTVLKSPHVNKDSREQ 62

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            EMRI+ R+L I+  TP TVD+L KLD+A  VNV ++
Sbjct: 63  FEMRIHARMLDIVAATPDTVDSLTKLDLAPEVNVEVR 99


>gi|319654867|ref|ZP_08008942.1| 30S ribosomal protein S10 [Bacillus sp. 2_A_57_CT2]
 gi|317393430|gb|EFV74193.1| 30S ribosomal protein S10 [Bacillus sp. 2_A_57_CT2]
          Length = 102

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D RILD S  +IV T K+SG+ + GPIP P     +T+ R+ H  K SR+Q
Sbjct: 5   KIRIRLKAYDHRILDQSAEKIVETAKRSGAAVSGPIPLPTEKSIYTILRAVHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTPQTVD+LM+LD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDIVNPTPQTVDSLMRLDLPSGVDIEIKL 102


>gi|259500891|ref|ZP_05743793.1| 30S ribosomal protein S10 [Lactobacillus iners DSM 13335]
 gi|302190656|ref|ZP_07266910.1| 30S ribosomal protein S10 [Lactobacillus iners AB-1]
 gi|259167585|gb|EEW52080.1| 30S ribosomal protein S10 [Lactobacillus iners DSM 13335]
          Length = 102

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 77/104 (74%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+ IRI   LK+++  ILD S  +IV T +++G++I GP+P P     FTV RSP+++
Sbjct: 1   MASQQIRIR--LKSYEHSILDESAAKIVATAQRTGAEISGPVPLPTERTLFTVLRSPYMN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+Q E+R +KRL+ I+ PTP+TVD+LMKLD+ +GV++ IKL
Sbjct: 59  KDSREQFEIRTHKRLIDIVNPTPKTVDSLMKLDLPSGVDIEIKL 102


>gi|269925830|ref|YP_003322453.1| ribosomal protein S10 [Thermobaculum terrenum ATCC BAA-798]
 gi|269789490|gb|ACZ41631.1| ribosomal protein S10 [Thermobaculum terrenum ATCC BAA-798]
          Length = 102

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 77/104 (74%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M+ + IRI   LKA+D ++LD S ++IV T +++G+Q+ GP+P P  I+RFTV RSP +D
Sbjct: 1   MSKQKIRIR--LKAYDHKLLDQSAQQIVETAQRTGAQVAGPVPLPTEIKRFTVIRSPFID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K S++Q E+R +KRL+ +++P  QT+  LM L++ AGV++ IKL
Sbjct: 59  KDSQEQFEIRTHKRLIDVLEPRRQTISELMSLNLPAGVDIEIKL 102


>gi|37912949|gb|AAR05281.1| ribosomal protein S10 [uncultured marine gamma proteobacterium
           EB000-45B06]
 gi|40063176|gb|AAR38013.1| ribosomal protein S10 [uncultured marine bacterium 562]
          Length = 103

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 73/101 (72%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
            N  I I LKAFD R++D+S + IV T KK+G+ I GPIP P    R T+ +SPH DK +
Sbjct: 2   ENQLIRIRLKAFDYRLIDASAKLIVETVKKTGAIINGPIPLPVKKERTTILKSPHKDKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           RDQ E+  YKRL+ I++PT +TVDALMKLD+++GV+V I L
Sbjct: 62  RDQYEIVTYKRLMDIVQPTDKTVDALMKLDLSSGVDVQISL 102


>gi|86739294|ref|YP_479694.1| 30S ribosomal protein S10 [Frankia sp. CcI3]
 gi|111220545|ref|YP_711339.1| 30S ribosomal protein S10 [Frankia alni ACN14a]
 gi|312200021|ref|YP_004020082.1| ribosomal protein S10 [Frankia sp. EuI1c]
 gi|108884795|sp|Q2JFH7|RS10_FRASC RecName: Full=30S ribosomal protein S10
 gi|123339022|sp|Q0RRS2|RS10_FRAAA RecName: Full=30S ribosomal protein S10
 gi|86566156|gb|ABD09965.1| SSU ribosomal protein S10P [Frankia sp. CcI3]
 gi|111148077|emb|CAJ59745.1| 30S ribosomal subunit protein S10 [Frankia alni ACN14a]
 gi|311231357|gb|ADP84212.1| ribosomal protein S10 [Frankia sp. EuI1c]
          Length = 102

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 74/104 (71%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M ++ IRI   LKA+D  ++DSS R+IV T  ++G+Q+ GP+P P     + V RSPH  
Sbjct: 1   MAAQKIRIR--LKAYDHEVIDSSARKIVETVTRTGAQVAGPVPLPTEKNIYCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+  EMR +KRL+ I+ PTP+TVD+LM+LD+ AGV++ IKL
Sbjct: 59  KDSREHFEMRTHKRLIDILDPTPKTVDSLMRLDLPAGVDIEIKL 102


>gi|42526278|ref|NP_971376.1| 30S ribosomal protein S10 [Treponema denticola ATCC 35405]
 gi|54036383|sp|Q73PN2|RS10_TREDE RecName: Full=30S ribosomal protein S10
 gi|41816390|gb|AAS11257.1| ribosomal protein S10 [Treponema denticola ATCC 35405]
 gi|325473222|gb|EGC76417.1| 30S ribosomal protein S10 [Treponema denticola F0402]
          Length = 102

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 50/103 (48%), Positives = 75/103 (72%), Gaps = 2/103 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           MT   IR+   L+ FD  ++D S + IV   +K+G+++ GPIP P  I +FTV RSPHV+
Sbjct: 1   MTKEKIRVK--LRGFDVELVDQSSKAIVQAVQKAGAKVCGPIPLPTRINKFTVLRSPHVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           KKSR+Q EMR +KRL+ II+P+ + ++AL+ L+++AGV+V IK
Sbjct: 59  KKSREQFEMRTHKRLIDIIEPSAEVMNALLALELSAGVDVEIK 101


>gi|314937607|ref|ZP_07844933.1| ribosomal protein S10 [Enterococcus faecium TX0133a04]
 gi|314942894|ref|ZP_07849707.1| ribosomal protein S10 [Enterococcus faecium TX0133C]
 gi|314947970|ref|ZP_07851374.1| ribosomal protein S10 [Enterococcus faecium TX0082]
 gi|314950887|ref|ZP_07853956.1| ribosomal protein S10 [Enterococcus faecium TX0133A]
 gi|314991465|ref|ZP_07856942.1| ribosomal protein S10 [Enterococcus faecium TX0133B]
 gi|314995014|ref|ZP_07860134.1| ribosomal protein S10 [Enterococcus faecium TX0133a01]
 gi|313590740|gb|EFR69585.1| ribosomal protein S10 [Enterococcus faecium TX0133a01]
 gi|313593945|gb|EFR72790.1| ribosomal protein S10 [Enterococcus faecium TX0133B]
 gi|313596896|gb|EFR75741.1| ribosomal protein S10 [Enterococcus faecium TX0133A]
 gi|313598366|gb|EFR77211.1| ribosomal protein S10 [Enterococcus faecium TX0133C]
 gi|313642984|gb|EFS07564.1| ribosomal protein S10 [Enterococcus faecium TX0133a04]
 gi|313645568|gb|EFS10148.1| ribosomal protein S10 [Enterococcus faecium TX0082]
          Length = 143

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA++ RILD S  +IV T K++G+ + GPIP P     +T+ R+ H  K SR+Q
Sbjct: 46  KIRIRLKAYEHRILDQSADKIVETAKRTGASVSGPIPLPTERSLYTIIRATHKYKDSREQ 105

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTP+TVDALMKLD+ +GVN+ IKL
Sbjct: 106 FEMRTHKRLIDIVNPTPKTVDALMKLDLPSGVNIEIKL 143


>gi|257870516|ref|ZP_05650169.1| ribosomal protein S10 [Enterococcus gallinarum EG2]
 gi|257804680|gb|EEV33502.1| ribosomal protein S10 [Enterococcus gallinarum EG2]
          Length = 102

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA++ RILD S  +IV T K++G+ + GPIP P     +T+ R+ H  K SR+Q
Sbjct: 5   KIRIRLKAYEHRILDQSADKIVETAKRTGAGVSGPIPLPTERSLYTIIRATHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTP+TVDALMKLD+ +GVN+ IKL
Sbjct: 65  FEMRTHKRLIDIVNPTPKTVDALMKLDLPSGVNIEIKL 102


>gi|226309807|ref|YP_002769701.1| 30S ribosomal protein S10 [Brevibacillus brevis NBRC 100599]
 gi|254809605|sp|C0ZIH9|RS10_BREBN RecName: Full=30S ribosomal protein S10
 gi|226092755|dbj|BAH41197.1| 30S ribosomal protein S10 [Brevibacillus brevis NBRC 100599]
          Length = 102

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D +ILD S  +IV T K+SG+ + GPIP P     +T+ R+ H  K SR+Q
Sbjct: 5   KIRIRLKAYDHKILDQSAEKIVDTAKRSGANVSGPIPLPTEKAVYTILRAVHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTPQTVDALM+LD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDILNPTPQTVDALMRLDLPSGVDIEIKL 102


>gi|315649700|ref|ZP_07902784.1| ribosomal protein S10 [Paenibacillus vortex V453]
 gi|315274888|gb|EFU38264.1| ribosomal protein S10 [Paenibacillus vortex V453]
          Length = 102

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D R+LD S  +IV T K+SG+ + GPIP P   +  T+ R+ H  K SR+Q
Sbjct: 5   KIRIRLKAYDHRVLDQSAEKIVETAKRSGAGVSGPIPLPTEKQIITILRAVHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTPQTVDALM+LD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDIVNPTPQTVDALMRLDLPSGVDIEIKL 102


>gi|163938117|ref|YP_001643001.1| 30S ribosomal protein S10 [Bacillus weihenstephanensis KBAB4]
 gi|218895244|ref|YP_002443655.1| ribosomal protein S10 [Bacillus cereus G9842]
 gi|228898862|ref|ZP_04063144.1| 30S ribosomal protein S10 [Bacillus thuringiensis IBL 4222]
 gi|228905906|ref|ZP_04069803.1| 30S ribosomal protein S10 [Bacillus thuringiensis IBL 200]
 gi|228937412|ref|ZP_04100058.1| 30S ribosomal protein S10 [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|228963209|ref|ZP_04124378.1| 30S ribosomal protein S10 [Bacillus thuringiensis serovar sotto
           str. T04001]
 gi|228970298|ref|ZP_04130957.1| 30S ribosomal protein S10 [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228976868|ref|ZP_04137280.1| 30S ribosomal protein S10 [Bacillus thuringiensis Bt407]
 gi|229009618|ref|ZP_04166844.1| 30S ribosomal protein S10 [Bacillus mycoides DSM 2048]
 gi|229015511|ref|ZP_04172509.1| 30S ribosomal protein S10 [Bacillus cereus AH1273]
 gi|229021720|ref|ZP_04178302.1| 30S ribosomal protein S10 [Bacillus cereus AH1272]
 gi|229027957|ref|ZP_04184110.1| 30S ribosomal protein S10 [Bacillus cereus AH1271]
 gi|229053955|ref|ZP_04195389.1| 30S ribosomal protein S10 [Bacillus cereus AH603]
 gi|229074170|ref|ZP_04207216.1| 30S ribosomal protein S10 [Bacillus cereus Rock4-18]
 gi|229094831|ref|ZP_04225836.1| 30S ribosomal protein S10 [Bacillus cereus Rock3-29]
 gi|229100908|ref|ZP_04231712.1| 30S ribosomal protein S10 [Bacillus cereus Rock3-28]
 gi|229113785|ref|ZP_04243220.1| 30S ribosomal protein S10 [Bacillus cereus Rock1-3]
 gi|229131117|ref|ZP_04260029.1| 30S ribosomal protein S10 [Bacillus cereus BDRD-ST196]
 gi|229165097|ref|ZP_04292892.1| 30S ribosomal protein S10 [Bacillus cereus AH621]
 gi|229170960|ref|ZP_04298561.1| 30S ribosomal protein S10 [Bacillus cereus MM3]
 gi|226705397|sp|B7IT18|RS10_BACC2 RecName: Full=30S ribosomal protein S10
 gi|226705400|sp|A9VP76|RS10_BACWK RecName: Full=30S ribosomal protein S10
 gi|163860314|gb|ABY41373.1| ribosomal protein S10 [Bacillus weihenstephanensis KBAB4]
 gi|218542468|gb|ACK94862.1| ribosomal protein S10 [Bacillus cereus G9842]
 gi|228612500|gb|EEK69721.1| 30S ribosomal protein S10 [Bacillus cereus MM3]
 gi|228618360|gb|EEK75390.1| 30S ribosomal protein S10 [Bacillus cereus AH621]
 gi|228652330|gb|EEL08255.1| 30S ribosomal protein S10 [Bacillus cereus BDRD-ST196]
 gi|228669656|gb|EEL25063.1| 30S ribosomal protein S10 [Bacillus cereus Rock1-3]
 gi|228682487|gb|EEL36560.1| 30S ribosomal protein S10 [Bacillus cereus Rock3-28]
 gi|228688574|gb|EEL42447.1| 30S ribosomal protein S10 [Bacillus cereus Rock3-29]
 gi|228708940|gb|EEL61067.1| 30S ribosomal protein S10 [Bacillus cereus Rock4-18]
 gi|228721373|gb|EEL72894.1| 30S ribosomal protein S10 [Bacillus cereus AH603]
 gi|228733345|gb|EEL84174.1| 30S ribosomal protein S10 [Bacillus cereus AH1271]
 gi|228739588|gb|EEL90002.1| 30S ribosomal protein S10 [Bacillus cereus AH1272]
 gi|228745798|gb|EEL95802.1| 30S ribosomal protein S10 [Bacillus cereus AH1273]
 gi|228751640|gb|EEM01440.1| 30S ribosomal protein S10 [Bacillus mycoides DSM 2048]
 gi|228782838|gb|EEM31004.1| 30S ribosomal protein S10 [Bacillus thuringiensis Bt407]
 gi|228789407|gb|EEM37327.1| 30S ribosomal protein S10 [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228796467|gb|EEM43906.1| 30S ribosomal protein S10 [Bacillus thuringiensis serovar sotto
           str. T04001]
 gi|228822245|gb|EEM68227.1| 30S ribosomal protein S10 [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|228853721|gb|EEM98481.1| 30S ribosomal protein S10 [Bacillus thuringiensis IBL 200]
 gi|228860762|gb|EEN05140.1| 30S ribosomal protein S10 [Bacillus thuringiensis IBL 4222]
 gi|326937904|gb|AEA13800.1| 30S ribosomal protein S10 [Bacillus thuringiensis serovar chinensis
           CT-43]
          Length = 102

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D RILD S  +IV T K+SG+ + GPIP P     +T+ R+ H  K SR+Q
Sbjct: 5   KIRIRLKAYDHRILDQSAEKIVETAKRSGATVSGPIPLPTEKTIYTILRAVHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTPQTVD+LM+LD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDIVSPTPQTVDSLMRLDLPSGVDIEIKL 102


>gi|222823102|ref|YP_002574675.1| 30S ribosomal protein S10 [Campylobacter lari RM2100]
 gi|254809601|sp|B9KED9|RS10_CAMLR RecName: Full=30S ribosomal protein S10
 gi|222538323|gb|ACM63424.1| 30S ribosomal protein S10 [Campylobacter lari RM2100]
          Length = 103

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 49/97 (50%), Positives = 71/97 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI + LKA+D R+LD ++  IV   K++G+ I GP+P P  I+R+TV +SPH++K SR+Q
Sbjct: 3   RIRLKLKAYDHRVLDRTVAAIVEAVKRTGADIRGPVPMPTKIKRYTVLKSPHINKDSREQ 62

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            EMRI+ R+L I+  TP TVD+L KLD+A  VNV ++
Sbjct: 63  FEMRIHARMLDIVAATPDTVDSLTKLDLAPEVNVEVR 99


>gi|320103616|ref|YP_004179207.1| 30S ribosomal protein S10P [Isosphaera pallida ATCC 43644]
 gi|319750898|gb|ADV62658.1| SSU ribosomal protein S10P [Isosphaera pallida ATCC 43644]
          Length = 110

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 51/97 (52%), Positives = 73/97 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I ++A+D  ILD S REI+ T +++ + + GPIP P  I R+TV RSPH+DKKSR+Q
Sbjct: 8   RIRIRMEAYDHVILDQSAREIIDTARRTEAVVHGPIPLPTRIERYTVLRSPHIDKKSREQ 67

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E+R +KRL+ I++PT +T+DAL KL + AGV++ IK
Sbjct: 68  FEIRTHKRLIDIVQPTIKTIDALNKLSLPAGVDIKIK 104


>gi|257456891|ref|ZP_05622072.1| ribosomal protein S10 [Treponema vincentii ATCC 35580]
 gi|257445600|gb|EEV20662.1| ribosomal protein S10 [Treponema vincentii ATCC 35580]
          Length = 109

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 73/97 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + L+ FD  ++D S + IV   +K G++++GPIP P  I +FTV RSPHV+KKSR+Q
Sbjct: 12  KIRVKLRGFDVELVDQSSKAIVQAVQKVGAKVLGPIPLPTRINKFTVLRSPHVNKKSREQ 71

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            EMR +KRL+ II+P+ + ++ALM L+++AGV+V IK
Sbjct: 72  FEMRTHKRLIDIIEPSAEVMNALMALELSAGVDVEIK 108


>gi|217967368|ref|YP_002352874.1| ribosomal protein S10 [Dictyoglomus turgidum DSM 6724]
 gi|217336467|gb|ACK42260.1| ribosomal protein S10 [Dictyoglomus turgidum DSM 6724]
          Length = 106

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 51/97 (52%), Positives = 72/97 (74%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD R+LD S ++I+ T + +G++I GPIP P  + R+ V RSPHV+K S + 
Sbjct: 9   KIRIKLKAFDHRVLDLSTKKIIDTVRGTGAKISGPIPLPTKVTRYWVLRSPHVNKNSGEH 68

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E+RI+KRL+ II+PT +TV+ALM L++ AGV V IK
Sbjct: 69  FEIRIHKRLIDIIEPTAKTVEALMNLELPAGVEVEIK 105


>gi|88657891|ref|YP_507226.1| 30S ribosomal protein S10 [Ehrlichia chaffeensis str. Arkansas]
 gi|115305621|sp|Q2GH57|RS10_EHRCR RecName: Full=30S ribosomal protein S10
 gi|88599348|gb|ABD44817.1| ribosomal protein S10 [Ehrlichia chaffeensis str. Arkansas]
          Length = 108

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFDS +LD S R I+LT K+SG+++ GPI FPR I +F VNRS HVDKKSR+Q
Sbjct: 5   KIYIELKAFDSCLLDRSARSIILTAKRSGARVNGPIFFPRKIMKFIVNRSTHVDKKSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRL+ + K     + ALM L + AGV+V +K+
Sbjct: 65  FEIRTHKRLISLPKANSTIIQALMSLQLPAGVDVKVKV 102


>gi|297170809|gb|ADI21829.1| hypothetical protein [uncultured gamma proteobacterium
           HF0130_25M15]
          Length = 104

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 52/97 (53%), Positives = 73/97 (75%)

Query: 8   ICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQL 67
           I I LK+FD +++D+S  EIV T K++GS + GPIP P S  R+TV  SPHV+K +RDQ 
Sbjct: 7   IRIRLKSFDHKLIDASTDEIVETVKRTGSVVSGPIPLPTSRERYTVLISPHVNKDARDQY 66

Query: 68  EMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           E+  +KR++ I+ P+ +TVDALMKL++ AGV+V IKL
Sbjct: 67  ELTTHKRVMDILNPSDKTVDALMKLELPAGVDVQIKL 103


>gi|292669861|ref|ZP_06603287.1| 30S ribosomal protein S10 [Selenomonas noxia ATCC 43541]
 gi|292648658|gb|EFF66630.1| 30S ribosomal protein S10 [Selenomonas noxia ATCC 43541]
          Length = 93

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 49/93 (52%), Positives = 70/93 (75%)

Query: 12  LKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQLEMRI 71
           +KA+D + LD S  +IV T KK+G+ + GPIP P     +T+ RSPHV+K SR+Q EMR 
Sbjct: 1   MKAYDHKALDQSAAKIVDTAKKTGAMVSGPIPLPTEKNVYTILRSPHVNKDSREQFEMRT 60

Query: 72  YKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +KRL+ I++PT +TVD+LM+LD+ AGV++ IKL
Sbjct: 61  HKRLIDILQPTNKTVDSLMRLDLPAGVDIEIKL 93


>gi|315283853|ref|ZP_07871908.1| ribosomal protein S10 [Listeria marthii FSL S4-120]
 gi|313612503|gb|EFR86590.1| ribosomal protein S10 [Listeria marthii FSL S4-120]
          Length = 95

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 52/95 (54%), Positives = 69/95 (72%)

Query: 10  ICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQLEM 69
           I LKA+D RILD S  +IV T K+SG+ + GPIP P     +TV R+ H  K SR+Q EM
Sbjct: 1   IRLKAYDHRILDQSAEKIVETAKRSGASVSGPIPLPTEKSIYTVLRAVHKYKDSREQFEM 60

Query: 70  RIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           R +KRL+ I+ PTPQTVD+LM+LD+ +GV++ IKL
Sbjct: 61  RTHKRLIDIVNPTPQTVDSLMRLDLPSGVDIEIKL 95


>gi|284034003|ref|YP_003383934.1| 30S ribosomal protein S10 [Kribbella flavida DSM 17836]
 gi|283813296|gb|ADB35135.1| ribosomal protein S10 [Kribbella flavida DSM 17836]
          Length = 102

 Score =  105 bits (263), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 53/104 (50%), Positives = 73/104 (70%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LKA+D  ++DSS R+IV T  ++G+++ GP+P P     F V RSPH  
Sbjct: 1   MAGQKIRIR--LKAYDHEVIDSSARKIVDTVTRTGAKVAGPVPLPTEKNVFCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+  EMR +KRL+ II PTP+TVD+LM+LD+ AGV++ IKL
Sbjct: 59  KDSREHFEMRTHKRLIDIIDPTPKTVDSLMRLDLPAGVDIEIKL 102


>gi|330837656|ref|YP_004412297.1| 30S ribosomal protein S10P [Spirochaeta coccoides DSM 17374]
 gi|329749559|gb|AEC02915.1| SSU ribosomal protein S10P [Spirochaeta coccoides DSM 17374]
          Length = 102

 Score =  105 bits (263), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 50/99 (50%), Positives = 73/99 (73%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N RI + L+ FD  +++ S + IV T  K+G+++ GP+P P  I + TV RSPHV+KKSR
Sbjct: 3   NERIRVRLRGFDIELVEQSSKAIVQTAVKAGAKVSGPVPLPTRINKVTVLRSPHVNKKSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           +Q EMR +KRL+ I++PT + +DALMKL++ AGV+V IK
Sbjct: 63  EQFEMRTHKRLIDILEPTSKVMDALMKLELPAGVDVEIK 101


>gi|291334060|gb|ADD93733.1| ribosomal protein S10 [uncultured marine bacterium
          MedDCM-OCT-S05-C114]
          Length = 95

 Score =  105 bits (263), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 65/86 (75%)

Query: 7  RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
          RI I L+ FD R++D S  +IV T K++G+++ GPIP P  I R+TVNRSPHVDKKS DQ
Sbjct: 5  RIRIKLRGFDYRVIDQSASDIVDTAKRTGARVAGPIPMPTRIERYTVNRSPHVDKKSMDQ 64

Query: 67 LEMRIYKRLLYIIKPTPQTVDALMKL 92
           E+R +KRL+ I++PT QTVD L KL
Sbjct: 65 FELRTHKRLIDIMEPTVQTVDELKKL 90


>gi|220906144|ref|YP_002481455.1| 30S ribosomal protein S10 [Cyanothece sp. PCC 7425]
 gi|254809592|sp|B8HV47|RS10_CYAP4 RecName: Full=30S ribosomal protein S10
 gi|219862755|gb|ACL43094.1| ribosomal protein S10 [Cyanothece sp. PCC 7425]
          Length = 105

 Score =  105 bits (263), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 72/98 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD R+LD+S  +IV T K++ +  VGPIP P   R + V RSPHVDK SR+ 
Sbjct: 8   KIRIRLKAFDHRLLDTSCEKIVDTAKRTSASAVGPIPLPTRRRIYCVLRSPHVDKDSREH 67

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R ++R++ I +P+P+T+DALMKLD+ AGV++ +KL
Sbjct: 68  FETRTHRRIIDIYQPSPKTIDALMKLDLPAGVDIEVKL 105


>gi|327467334|gb|EGF12834.1| 30S ribosomal protein S10 [Streptococcus sanguinis SK330]
          Length = 102

 Score =  105 bits (263), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 72/100 (72%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA++ R LD++  +IV T  ++G+++ GPIP P     +T+ R+ H+ K SR
Sbjct: 3   NKKIRIRLKAYEHRTLDTAAAKIVETATRTGAEVAGPIPLPTERSLYTIIRATHIYKDSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KRL+ II PT +TVDALMKLD+ +GVNV IKL
Sbjct: 63  EQFEMRTHKRLIDIINPTQKTVDALMKLDLPSGVNVEIKL 102


>gi|257878724|ref|ZP_05658377.1| ribosomal protein S10 [Enterococcus faecium 1,230,933]
 gi|257881365|ref|ZP_05661018.1| ribosomal protein S10 [Enterococcus faecium 1,231,502]
 gi|257885633|ref|ZP_05665286.1| ribosomal protein S10 [Enterococcus faecium 1,231,501]
 gi|257890583|ref|ZP_05670236.1| ribosomal protein S10 [Enterococcus faecium 1,231,410]
 gi|257899333|ref|ZP_05678986.1| ribosomal protein S10 [Enterococcus faecium Com15]
 gi|260558286|ref|ZP_05830482.1| ribosomal protein S10 [Enterococcus faecium C68]
 gi|261206992|ref|ZP_05921681.1| ribosomal protein S10 [Enterococcus faecium TC 6]
 gi|289565373|ref|ZP_06445823.1| small subunit ribosomal protein S10 [Enterococcus faecium D344SRF]
 gi|257812952|gb|EEV41710.1| ribosomal protein S10 [Enterococcus faecium 1,230,933]
 gi|257817023|gb|EEV44351.1| ribosomal protein S10 [Enterococcus faecium 1,231,502]
 gi|257821489|gb|EEV48619.1| ribosomal protein S10 [Enterococcus faecium 1,231,501]
 gi|257826943|gb|EEV53569.1| ribosomal protein S10 [Enterococcus faecium 1,231,410]
 gi|257837245|gb|EEV62319.1| ribosomal protein S10 [Enterococcus faecium Com15]
 gi|260075460|gb|EEW63766.1| ribosomal protein S10 [Enterococcus faecium C68]
 gi|260078620|gb|EEW66322.1| ribosomal protein S10 [Enterococcus faecium TC 6]
 gi|289162863|gb|EFD10713.1| small subunit ribosomal protein S10 [Enterococcus faecium D344SRF]
          Length = 151

 Score =  105 bits (263), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA++ RILD S  +IV T K++G+ + GPIP P     +T+ R+ H  K SR+Q
Sbjct: 54  KIRIRLKAYEHRILDQSADKIVETAKRTGASVSGPIPLPTERSLYTIIRATHKYKDSREQ 113

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTP+TVDALMKLD+ +GVN+ IKL
Sbjct: 114 FEMRTHKRLIDIVNPTPKTVDALMKLDLPSGVNIEIKL 151


>gi|227550719|ref|ZP_03980768.1| 30S ribosomal protein S10 [Enterococcus faecium TX1330]
 gi|257888022|ref|ZP_05667675.1| ribosomal protein S10 [Enterococcus faecium 1,141,733]
 gi|257893173|ref|ZP_05672826.1| ribosomal protein S10 [Enterococcus faecium 1,231,408]
 gi|257896359|ref|ZP_05676012.1| ribosomal protein S10 [Enterococcus faecium Com12]
 gi|227180180|gb|EEI61152.1| 30S ribosomal protein S10 [Enterococcus faecium TX1330]
 gi|257824076|gb|EEV51008.1| ribosomal protein S10 [Enterococcus faecium 1,141,733]
 gi|257829552|gb|EEV56159.1| ribosomal protein S10 [Enterococcus faecium 1,231,408]
 gi|257832924|gb|EEV59345.1| ribosomal protein S10 [Enterococcus faecium Com12]
          Length = 151

 Score =  105 bits (263), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA++ RILD S  +IV T K++G+ + GPIP P     +T+ R+ H  K SR+Q
Sbjct: 54  KIRIRLKAYEHRILDQSADKIVETAKRTGASVSGPIPLPTERSLYTIIRATHKYKDSREQ 113

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTP+TVDALMKLD+ +GVN+ IKL
Sbjct: 114 FEMRTHKRLIDIVNPTPKTVDALMKLDLPSGVNIEIKL 151


>gi|154174951|ref|YP_001409154.1| 30S ribosomal protein S10 [Campylobacter curvus 525.92]
 gi|153793153|gb|ABS50414.1| ribosomal protein S10p/S20e [Campylobacter curvus 525.92]
          Length = 126

 Score =  105 bits (263), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 72/97 (74%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI + LKA+D R+LD ++  IV   K++G+ + GP+P P  I+R+TV +SPH++K SR+Q
Sbjct: 27  RIRLKLKAYDHRVLDRTVAAIVEAVKRTGADVRGPVPMPTKIKRYTVLKSPHINKDSREQ 86

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            EMRI+ R+L I+  TP+TVD+L KLD+A  VNV ++
Sbjct: 87  FEMRIHARMLDIVAATPETVDSLTKLDLAPEVNVEVR 123


>gi|304385415|ref|ZP_07367760.1| 30S ribosomal protein S10 [Pediococcus acidilactici DSM 20284]
 gi|304328622|gb|EFL95843.1| 30S ribosomal protein S10 [Pediococcus acidilactici DSM 20284]
          Length = 143

 Score =  105 bits (263), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 72/98 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA++ RILD S  +IV T K++G+ I GPIP P     +TV  SPH  KK+R+Q
Sbjct: 46  KIRIRLKAYEHRILDQSADKIVETAKRTGATISGPIPLPTERTVYTVLSSPHKFKKAREQ 105

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTP+TVD+LMKLD+ +GV++ IKL
Sbjct: 106 FEMRTHKRLIDIVNPTPKTVDSLMKLDLPSGVDIEIKL 143


>gi|206900457|ref|YP_002250700.1| ribosomal protein S10 [Dictyoglomus thermophilum H-6-12]
 gi|206739560|gb|ACI18618.1| ribosomal protein S10 [Dictyoglomus thermophilum H-6-12]
          Length = 106

 Score =  105 bits (263), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 51/97 (52%), Positives = 72/97 (74%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD R+LD S ++I+ T + +G++I GPIP P  + R+ V RSPHV+K S + 
Sbjct: 9   KIRIKLKAFDHRVLDISTKKIIDTVRGTGAKISGPIPLPTKVTRYWVLRSPHVNKNSGEH 68

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E+RI+KRL+ II+PT +TV+ALM L++ AGV V IK
Sbjct: 69  FEIRIHKRLIDIIEPTSKTVEALMNLELPAGVEVEIK 105


>gi|257866528|ref|ZP_05646181.1| ribosomal protein S10 [Enterococcus casseliflavus EC30]
 gi|257872957|ref|ZP_05652610.1| ribosomal protein S10 [Enterococcus casseliflavus EC10]
 gi|257876132|ref|ZP_05655785.1| ribosomal protein S10 [Enterococcus casseliflavus EC20]
 gi|325567377|ref|ZP_08144044.1| 30S ribosomal protein S10 [Enterococcus casseliflavus ATCC 12755]
 gi|257800486|gb|EEV29514.1| ribosomal protein S10 [Enterococcus casseliflavus EC30]
 gi|257807121|gb|EEV35943.1| ribosomal protein S10 [Enterococcus casseliflavus EC10]
 gi|257810298|gb|EEV39118.1| ribosomal protein S10 [Enterococcus casseliflavus EC20]
 gi|325158810|gb|EGC70956.1| 30S ribosomal protein S10 [Enterococcus casseliflavus ATCC 12755]
          Length = 117

 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA++ RILD S  +IV T K++G+ + GPIP P     +T+ R+ H  K SR+Q
Sbjct: 20  KIRIRLKAYEHRILDQSADKIVETAKRTGAGVSGPIPLPTERSLYTIIRATHKYKDSREQ 79

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTP+TVDALMKLD+ +GVN+ IKL
Sbjct: 80  FEMRTHKRLIDIVNPTPKTVDALMKLDLPSGVNIEIKL 117


>gi|257064321|ref|YP_003143993.1| SSU ribosomal protein S10P [Slackia heliotrinireducens DSM 20476]
 gi|256791974|gb|ACV22644.1| SSU ribosomal protein S10P [Slackia heliotrinireducens DSM 20476]
          Length = 107

 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 71/100 (71%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LK +D  I+D S + IV T +K+G+++ GPIP P     + V R PHVDK SR
Sbjct: 8   NQKIRIRLKGYDHEIVDQSTKLIVDTAQKTGAKVSGPIPLPTERNLYCVVRGPHVDKDSR 67

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KRL+ I++PT  TVD+LM+LD+ AGV++ IKL
Sbjct: 68  EQFEMRTHKRLIDILEPTQSTVDSLMRLDLPAGVDIEIKL 107


>gi|226226278|ref|YP_002760384.1| 30S ribosomal protein S10 [Gemmatimonas aurantiaca T-27]
 gi|226089469|dbj|BAH37914.1| 30S ribosomal protein S10 [Gemmatimonas aurantiaca T-27]
          Length = 102

 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I LKAFD  ++D +  +IV T +K+G+ + GPIP P   +R+TV RSPHVDKKSR+Q
Sbjct: 4   RIRIRLKAFDHAVIDQASADIVRTAEKTGASVSGPIPLPTKTQRWTVLRSPHVDKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E++ +KR++ I+     TVDAL KLD+ AGV+V IK+
Sbjct: 64  FELKTHKRVIDILDSRAGTVDALTKLDLPAGVDVEIKV 101


>gi|255321774|ref|ZP_05362929.1| ribosomal protein S10 [Campylobacter showae RM3277]
 gi|255301254|gb|EET80516.1| ribosomal protein S10 [Campylobacter showae RM3277]
          Length = 103

 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 71/97 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI + LKA+D R+LD ++  IV   K++G+ + GP+P P  I+R+TV +SPH++K SR+Q
Sbjct: 3   RIRLKLKAYDHRVLDRTVAAIVEAVKRTGADVRGPVPMPTKIKRYTVLKSPHINKDSREQ 62

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            EMRI+ R+L I+  TP TVD+L KLD+A  VNV ++
Sbjct: 63  FEMRIHARMLDIVAATPDTVDSLTKLDLAPEVNVEVR 99


>gi|260584415|ref|ZP_05852162.1| 30S ribosomal protein S10 [Granulicatella elegans ATCC 700633]
 gi|260157933|gb|EEW93002.1| 30S ribosomal protein S10 [Granulicatella elegans ATCC 700633]
          Length = 127

 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA++ R LD S  +IV T K++G+ + GPIP P     +TV R+ H  K SR+Q
Sbjct: 30  KIRIRLKAYEHRALDQSAEKIVETAKRTGASVAGPIPLPTERSLYTVIRATHKYKDSREQ 89

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTP+TVDALMKLD+ +GV++ IKL
Sbjct: 90  FEMRTHKRLIDIVNPTPKTVDALMKLDLPSGVDIEIKL 127


>gi|30260300|ref|NP_842677.1| 30S ribosomal protein S10 [Bacillus anthracis str. Ames]
 gi|47525365|ref|YP_016714.1| 30S ribosomal protein S10 [Bacillus anthracis str. 'Ames Ancestor']
 gi|49183143|ref|YP_026395.1| 30S ribosomal protein S10 [Bacillus anthracis str. Sterne]
 gi|227812782|ref|YP_002812791.1| 30S ribosomal protein S10 [Bacillus anthracis str. CDC 684]
 gi|229604318|ref|YP_002864760.1| 30S ribosomal protein S10 [Bacillus anthracis str. A0248]
 gi|254684387|ref|ZP_05148247.1| 30S ribosomal protein S10 [Bacillus anthracis str. CNEVA-9066]
 gi|254733590|ref|ZP_05191310.1| 30S ribosomal protein S10 [Bacillus anthracis str. Western North
           America USA6153]
 gi|254739506|ref|ZP_05197203.1| 30S ribosomal protein S10 [Bacillus anthracis str. Kruger B]
 gi|254751229|ref|ZP_05203267.1| 30S ribosomal protein S10 [Bacillus anthracis str. Vollum]
 gi|254756764|ref|ZP_05208793.1| 30S ribosomal protein S10 [Bacillus anthracis str. Australia 94]
 gi|44888444|sp|Q81VT1|RS10_BACAN RecName: Full=30S ribosomal protein S10
 gi|254809576|sp|C3P9Q4|RS10_BACAA RecName: Full=30S ribosomal protein S10
 gi|254809577|sp|C3LJ81|RS10_BACAC RecName: Full=30S ribosomal protein S10
 gi|30253621|gb|AAP24163.1| 30S ribosomal protein S10 [Bacillus anthracis str. Ames]
 gi|47500513|gb|AAT29189.1| ribosomal protein S10 [Bacillus anthracis str. 'Ames Ancestor']
 gi|49177070|gb|AAT52446.1| ribosomal protein S10 [Bacillus anthracis str. Sterne]
 gi|227002756|gb|ACP12499.1| 30S ribosomal protein S10 [Bacillus anthracis str. CDC 684]
 gi|229268726|gb|ACQ50363.1| 30S ribosomal protein S10 [Bacillus anthracis str. A0248]
          Length = 102

 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D RILD S  +IV T K+SG+ + GPIP P     +T+ R+ H  K SR+Q
Sbjct: 5   KIRIRLKAYDHRILDQSADKIVETAKRSGATVSGPIPLPTEKTVYTILRAVHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTPQTVD+LM+LD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDIVSPTPQTVDSLMRLDLPSGVDIEIKL 102


>gi|259047556|ref|ZP_05737957.1| 30S ribosomal protein S10 [Granulicatella adiacens ATCC 49175]
 gi|259035747|gb|EEW37002.1| 30S ribosomal protein S10 [Granulicatella adiacens ATCC 49175]
          Length = 112

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA++ R LD S  +IV T K++G+ + GPIP P     +TV R+ H  K SR+Q
Sbjct: 15  KIRIRLKAYEHRALDQSAEKIVETAKRTGASVAGPIPLPTERSLYTVIRATHKYKDSREQ 74

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTP+TVDALMKLD+ +GV++ IKL
Sbjct: 75  FEMRTHKRLIDIVNPTPKTVDALMKLDLPSGVDIEIKL 112


>gi|239997924|ref|ZP_04717848.1| 30S ribosomal protein S10 [Neisseria gonorrhoeae 35/02]
 gi|240015098|ref|ZP_04722011.1| 30S ribosomal protein S10 [Neisseria gonorrhoeae DGI18]
 gi|240017547|ref|ZP_04724087.1| 30S ribosomal protein S10 [Neisseria gonorrhoeae FA6140]
 gi|240114195|ref|ZP_04728685.1| 30S ribosomal protein S10 [Neisseria gonorrhoeae MS11]
 gi|240116702|ref|ZP_04730764.1| 30S ribosomal protein S10 [Neisseria gonorrhoeae PID18]
 gi|240118924|ref|ZP_04732986.1| 30S ribosomal protein S10 [Neisseria gonorrhoeae PID1]
 gi|240122170|ref|ZP_04735132.1| 30S ribosomal protein S10 [Neisseria gonorrhoeae PID24-1]
 gi|240126751|ref|ZP_04739637.1| 30S ribosomal protein S10 [Neisseria gonorrhoeae SK-92-679]
 gi|240129204|ref|ZP_04741865.1| 30S ribosomal protein S10 [Neisseria gonorrhoeae SK-93-1035]
 gi|254494724|ref|ZP_05107895.1| 30S ribosomal protein S10 [Neisseria gonorrhoeae 1291]
 gi|260439539|ref|ZP_05793355.1| 30S ribosomal protein S10 [Neisseria gonorrhoeae DGI2]
 gi|268593773|ref|ZP_06127940.1| 30S ribosomal protein S10 [Neisseria gonorrhoeae 35/02]
 gi|268600269|ref|ZP_06134436.1| 30S ribosomal protein S10 [Neisseria gonorrhoeae MS11]
 gi|268602371|ref|ZP_06136538.1| 30S ribosomal protein S10 [Neisseria gonorrhoeae PID18]
 gi|268604634|ref|ZP_06138801.1| 30S ribosomal protein S10 [Neisseria gonorrhoeae PID1]
 gi|268685329|ref|ZP_06152191.1| 30S ribosomal protein S10 [Neisseria gonorrhoeae SK-92-679]
 gi|268687589|ref|ZP_06154451.1| 30S ribosomal protein S10 [Neisseria gonorrhoeae SK-93-1035]
 gi|291042774|ref|ZP_06568515.1| 30S ribosomal protein S10 [Neisseria gonorrhoeae DGI2]
 gi|226513764|gb|EEH63109.1| 30S ribosomal protein S10 [Neisseria gonorrhoeae 1291]
 gi|268547162|gb|EEZ42580.1| 30S ribosomal protein S10 [Neisseria gonorrhoeae 35/02]
 gi|268584400|gb|EEZ49076.1| 30S ribosomal protein S10 [Neisseria gonorrhoeae MS11]
 gi|268586502|gb|EEZ51178.1| 30S ribosomal protein S10 [Neisseria gonorrhoeae PID18]
 gi|268588765|gb|EEZ53441.1| 30S ribosomal protein S10 [Neisseria gonorrhoeae PID1]
 gi|268625613|gb|EEZ58013.1| 30S ribosomal protein S10 [Neisseria gonorrhoeae SK-92-679]
 gi|268627873|gb|EEZ60273.1| 30S ribosomal protein S10 [Neisseria gonorrhoeae SK-93-1035]
 gi|291013208|gb|EFE05174.1| 30S ribosomal protein S10 [Neisseria gonorrhoeae DGI2]
 gi|317165373|gb|ADV08914.1| 30S ribosomal protein S10 [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 103

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 73/100 (73%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA+D  ++D S +EIV T K++G+ + GPIP P  I RF + RSPH++K SR
Sbjct: 3   NQKIRIRLKAYDYALIDRSAQEIVETAKRTGAVVKGPIPLPTKIERFNILRSPHMNKTSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +QLE+R + RL+ I+  T +T DALMKLD+ AGV+V IK+
Sbjct: 63  EQLEIRTHLRLMDIVDWTDKTTDALMKLDLPAGVDVEIKV 102


>gi|313631757|gb|EFR98951.1| ribosomal protein S10 [Listeria seeligeri FSL N1-067]
          Length = 93

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 51/93 (54%), Positives = 68/93 (73%)

Query: 12  LKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQLEMRI 71
           LKA+D RILD S  +IV T K+SG+ + GPIP P     +TV R+ H  K SR+Q EMR 
Sbjct: 1   LKAYDHRILDQSAEKIVETAKRSGASVSGPIPLPTEKSIYTVLRAVHKYKDSREQFEMRT 60

Query: 72  YKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +KRL+ I+ PTPQTVD+LM+LD+ +GV++ IKL
Sbjct: 61  HKRLIDIVNPTPQTVDSLMRLDLPSGVDIEIKL 93


>gi|325267257|ref|ZP_08133920.1| 30S ribosomal protein S10 [Kingella denitrificans ATCC 33394]
 gi|324981318|gb|EGC16967.1| 30S ribosomal protein S10 [Kingella denitrificans ATCC 33394]
          Length = 103

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 72/100 (72%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA+D  ++D S  EIV T K++G+ + GPIP P  I RF + RSPHV+K SR
Sbjct: 3   NQKIRIRLKAYDYALIDRSAAEIVETAKRTGAVVKGPIPLPTKIERFDILRSPHVNKTSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +QLE+R + RL+ I+  T +T DALMKLD+ AGV+V IK+
Sbjct: 63  EQLEIRTHLRLMDIVDWTDKTTDALMKLDLPAGVDVEIKV 102


>gi|296111428|ref|YP_003621810.1| ribosomal protein S10 [Leuconostoc kimchii IMSNU 11154]
 gi|295832960|gb|ADG40841.1| ribosomal protein S10 [Leuconostoc kimchii IMSNU 11154]
          Length = 102

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 54/104 (51%), Positives = 72/104 (69%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LKA++ RILD S  +IV T K++G++I GPIP P     +TV RSPH  
Sbjct: 1   MAQKKIRIR--LKAYEHRILDQSAEKIVETAKRTGAEIAGPIPLPTERTLYTVLRSPHKH 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+Q EMR +KRL+ I+ PT +TVDAL KL++ +GV + IKL
Sbjct: 59  KDSREQFEMRTHKRLIDIVNPTDKTVDALRKLELPSGVAIEIKL 102


>gi|221194804|ref|ZP_03567861.1| ribosomal protein S10 [Atopobium rimae ATCC 49626]
 gi|221185708|gb|EEE18098.1| ribosomal protein S10 [Atopobium rimae ATCC 49626]
          Length = 102

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 70/100 (70%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LK +D  ++D S + IV T +K+G+++ GPIP P     +TV RSPH DK SR
Sbjct: 3   NQKIRIRLKGYDHEVVDQSAKLIVDTAQKNGARVSGPIPLPTERNLYTVIRSPHKDKDSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           DQ EMR +KRL+ I+ P   TVD+LM+LD+ AGV++ IKL
Sbjct: 63  DQFEMRTHKRLIDILDPNSTTVDSLMRLDLPAGVDIEIKL 102


>gi|153820491|ref|ZP_01973158.1| ribosomal protein S10 [Vibrio cholerae NCTC 8457]
 gi|126508964|gb|EAZ71558.1| ribosomal protein S10 [Vibrio cholerae NCTC 8457]
          Length = 95

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 70/91 (76%)

Query: 4  RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
          +N RI I LKAFD +++D+S  EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +
Sbjct: 2  QNQRIRIRLKAFDYKLIDASTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDA 61

Query: 64 RDQLEMRIYKRLLYIIKPTPQTVDALMKLDI 94
          RDQ E+R +KRL+ I++PT +TVDALM+LD+
Sbjct: 62 RDQYEIRTHKRLIDIVEPTDKTVDALMRLDL 92


>gi|261378040|ref|ZP_05982613.1| ribosomal protein S10 [Neisseria cinerea ATCC 14685]
 gi|269145488|gb|EEZ71906.1| ribosomal protein S10 [Neisseria cinerea ATCC 14685]
          Length = 103

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 73/100 (73%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA+D  ++D S +EIV T K++G+ + GPIP P  I RF + RSPHV+K SR
Sbjct: 3   NQKIRIRLKAYDYSLIDRSAQEIVETAKRTGAVVKGPIPLPTKIERFNILRSPHVNKTSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +QLE+R + RL+ I+  T +T +ALMKLD+ AGV+V IK+
Sbjct: 63  EQLEIRTHLRLMDIVDWTDKTTEALMKLDLPAGVDVEIKV 102


>gi|290968245|ref|ZP_06559788.1| ribosomal protein S10 [Megasphaera genomosp. type_1 str. 28L]
 gi|290781727|gb|EFD94312.1| ribosomal protein S10 [Megasphaera genomosp. type_1 str. 28L]
          Length = 103

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 74/102 (72%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           ++  RI I LKA+D + LD S  +IV T K++G+ + GPIP P     FT+ RSPHV+K 
Sbjct: 2   AKQERIRIRLKAYDHKTLDQSAAKIVDTAKRTGAMVSGPIPLPTEKNIFTILRSPHVNKD 61

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           SR+Q E+R +KRL+ I++ + +TVDALM+LD+ AGV++ IKL
Sbjct: 62  SREQFELRTHKRLIDILEASNKTVDALMRLDLPAGVDIEIKL 103


>gi|15896384|ref|NP_349733.1| 30S ribosomal protein S10 [Clostridium acetobutylicum ATCC 824]
 gi|17865580|sp|Q97EH7|RS10_CLOAB RecName: Full=30S ribosomal protein S10
 gi|15026200|gb|AAK81073.1|AE007808_26 Ribosomal protein S10 [Clostridium acetobutylicum ATCC 824]
 gi|325510540|gb|ADZ22176.1| 30S ribosomal protein S10 [Clostridium acetobutylicum EA 2018]
          Length = 102

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD  ILD S  +IV T K +G+++ GP+P P      T+ RSPH  K SR+Q
Sbjct: 5   KIRIRLKAFDHTILDQSAEKIVETAKTTGAKVAGPVPLPTEKDVVTILRSPHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRL+ II P+P+TVDALM+LD+ AGV++ IKL
Sbjct: 65  FEIRTHKRLIDIISPSPKTVDALMRLDLPAGVDIEIKL 102


>gi|20808661|ref|NP_623832.1| 30S ribosomal protein S10 [Thermoanaerobacter tengcongensis MB4]
 gi|22096101|sp|Q8R7V3|RS10_THETN RecName: Full=30S ribosomal protein S10
 gi|20517295|gb|AAM25436.1| Ribosomal protein S10 [Thermoanaerobacter tengcongensis MB4]
          Length = 102

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 72/98 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD  ILD S ++IV T K++G+++ GPIP P      T+ R+PH  K SR+Q
Sbjct: 5   KIRIRLKAFDHAILDQSAQKIVETAKRTGAEVSGPIPLPTKREVITILRAPHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E++ +KRL+ I+ PTP+TVDALMKLD+ +GV++ IKL
Sbjct: 65  FEIKTHKRLIDILNPTPKTVDALMKLDLPSGVDIEIKL 102


>gi|218290006|ref|ZP_03494183.1| ribosomal protein S10 [Alicyclobacillus acidocaldarius LAA1]
 gi|258512671|ref|YP_003186105.1| 30S ribosomal protein S10 [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
 gi|218239991|gb|EED07178.1| ribosomal protein S10 [Alicyclobacillus acidocaldarius LAA1]
 gi|257479397|gb|ACV59716.1| ribosomal protein S10 [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 102

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D  +LD S   IV T K+SG+++ GP+P P     +T+ R+PH  K SR+Q
Sbjct: 5   KIRIRLKAYDHTVLDQSAERIVETAKRSGAKVSGPVPLPTDRELYTILRAPHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRL+ I  PTPQTVDALM+LD+ +GV++ IKL
Sbjct: 65  FEIRTHKRLIDIHNPTPQTVDALMRLDLPSGVDIEIKL 102


>gi|183221348|ref|YP_001839344.1| 30S ribosomal protein S10 [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Paris)']
 gi|189911441|ref|YP_001962996.1| 30S ribosomal protein S10 [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Ames)']
 gi|226705586|sp|B0SAF5|RS10_LEPBA RecName: Full=30S ribosomal protein S10
 gi|226705587|sp|B0SSH8|RS10_LEPBP RecName: Full=30S ribosomal protein S10
 gi|167776117|gb|ABZ94418.1| 30S Ribosomal protein S10 [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Ames)']
 gi|167779770|gb|ABZ98068.1| 30S ribosomal protein S10 [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Paris)']
          Length = 102

 Score =  105 bits (261), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 52/97 (53%), Positives = 69/97 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI + LKAFD R++D S  EIV T K++G+ + GPIP P     +TV RSPHV+KK+R+Q
Sbjct: 5   RIRVKLKAFDHRLIDQSTFEIVATAKRTGATVSGPIPLPTKKEIYTVLRSPHVNKKAREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            EMR +KRL+ I+     TV+ALMKL + AGV+V IK
Sbjct: 65  FEMRTHKRLIDILNTNEDTVEALMKLQLPAGVSVDIK 101


>gi|1165302|gb|AAC45955.1| S10 [Bacillus subtilis]
          Length = 102

 Score =  105 bits (261), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D RILD S  +IV T K+SG+ + GPIP P     +T+  + H  K SR+Q
Sbjct: 5   KIRIRLKAYDHRILDQSAEKIVETAKRSGASVSGPIPLPTEKSVYTILLAVHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTPQTVDALM+LD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDIVNPTPQTVDALMRLDLPSGVDIEIKL 102


>gi|119953266|ref|YP_945475.1| 30S ribosomal protein S10 [Borrelia turicatae 91E135]
 gi|187918343|ref|YP_001883906.1| 30S ribosomal protein S10 [Borrelia hermsii DAH]
 gi|203284387|ref|YP_002222127.1| 30S ribosomal protein S10 [Borrelia duttonii Ly]
 gi|226705404|sp|B5RM35|RS10_BORDL RecName: Full=30S ribosomal protein S10
 gi|226705405|sp|B2S0I0|RS10_BORHD RecName: Full=30S ribosomal protein S10
 gi|254809607|sp|A1QZR3|RS10_BORT9 RecName: Full=30S ribosomal protein S10
 gi|119861191|gb|AAX16986.1| SSU ribosomal protein S10P [Borrelia hermsii DAH]
 gi|119862037|gb|AAX17805.1| SSU ribosomal protein S10P [Borrelia turicatae 91E135]
 gi|201083830|gb|ACH93421.1| 30S ribosomal protein S10 [Borrelia duttonii Ly]
          Length = 103

 Score =  105 bits (261), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 52/97 (53%), Positives = 71/97 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + L +FD +ILD S   IV   +KS +QI GPIP P  I+++TV RSPHV+KKSR+Q
Sbjct: 6   KIRVRLFSFDVKILDQSAESIVRAVQKSKAQIKGPIPLPTKIKKYTVLRSPHVNKKSREQ 65

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            EMR +KRL+ I++PT   +D+LMKL++ AGV V IK
Sbjct: 66  FEMRTHKRLIDILEPTSALMDSLMKLELPAGVEVDIK 102


>gi|322381127|ref|ZP_08055130.1| 30S ribosomal protein S10-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
 gi|321154703|gb|EFX46974.1| 30S ribosomal protein S10-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
          Length = 102

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D R++D S  +IV T K+SG+ + GPIP P   +  T+ R+ H  K SR+Q
Sbjct: 5   KIRIRLKAYDHRVIDQSAEKIVETAKRSGAGVSGPIPLPTEKQIITILRAVHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTPQTVDALM+LD+ +GV++ IKL
Sbjct: 65  FEMRTHKRLIDIVNPTPQTVDALMRLDLPSGVDIEIKL 102


>gi|289168733|ref|YP_003447002.1| 30S ribosomal protein S10 [Streptococcus mitis B6]
 gi|288908300|emb|CBJ23142.1| 30S ribosomal protein S10 [Streptococcus mitis B6]
          Length = 102

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 72/100 (72%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA++ R LD++  +IV +  ++G+Q+ GPIP P     +T+ R+ H+ K SR
Sbjct: 3   NKKIRIRLKAYEHRTLDTAAAKIVESATRTGAQVAGPIPLPTERSLYTIIRATHMYKDSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KRL+ II PT +TVDALMKLD+ +GVNV IKL
Sbjct: 63  EQFEMRTHKRLIDIINPTQKTVDALMKLDLPSGVNVEIKL 102


>gi|203287921|ref|YP_002222936.1| 30S ribosomal protein S10 [Borrelia recurrentis A1]
 gi|226705407|sp|B5RPI1|RS10_BORRA RecName: Full=30S ribosomal protein S10
 gi|201085141|gb|ACH94715.1| 30S ribosomal protein S10 [Borrelia recurrentis A1]
          Length = 103

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 52/97 (53%), Positives = 71/97 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + L +FD +ILD S   IV   +KS +QI GPIP P  I+++TV RSPHV+KKSR+Q
Sbjct: 6   KIRVRLFSFDVKILDQSAESIVRAVQKSKTQIKGPIPLPTKIKKYTVLRSPHVNKKSREQ 65

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            EMR +KRL+ I++PT   +D+LMKL++ AGV V IK
Sbjct: 66  FEMRTHKRLIDILEPTSALMDSLMKLELPAGVEVDIK 102


>gi|172056139|ref|YP_001812599.1| 30S ribosomal protein S10 [Exiguobacterium sibiricum 255-15]
 gi|226705446|sp|B1YGU9|RS10_EXIS2 RecName: Full=30S ribosomal protein S10
 gi|171988660|gb|ACB59582.1| ribosomal protein S10 [Exiguobacterium sibiricum 255-15]
          Length = 102

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 72/100 (72%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA+D R+LD S  +IV T K+SG+ + GPIP P     +TV R+ H  K +R
Sbjct: 3   NEKIRIRLKAYDHRVLDQSAEKIVETAKRSGATVSGPIPLPTEKAIYTVLRAVHKYKDAR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KRL+ I+ PTP+TVDALM+L++ +GV++ IKL
Sbjct: 63  EQFEMRTHKRLIDIVNPTPKTVDALMRLELPSGVDIEIKL 102


>gi|253577178|ref|ZP_04854498.1| 30S ribosomal protein S10 [Paenibacillus sp. oral taxon 786 str.
           D14]
 gi|251843422|gb|EES71450.1| 30S ribosomal protein S10 [Paenibacillus sp. oral taxon 786 str.
           D14]
          Length = 102

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D RILD S  +IV T K+SG+ + GPIP P   +  T+ R+ H  K SR+Q
Sbjct: 5   KIRIRLKAYDHRILDQSAEKIVETAKRSGAGVSGPIPLPTEKQVITILRAVHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R +KRL+ I+ PTPQTVDALM+LD+ +GV++ IKL
Sbjct: 65  FEQRTHKRLIDIVNPTPQTVDALMRLDLPSGVDIEIKL 102


>gi|312880373|ref|ZP_07740173.1| SSU ribosomal protein S10P [Aminomonas paucivorans DSM 12260]
 gi|310783664|gb|EFQ24062.1| SSU ribosomal protein S10P [Aminomonas paucivorans DSM 12260]
          Length = 103

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 75/97 (77%)

Query: 8   ICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQL 67
           I I LKAFD R+LD+S  +I  T +++G+++ GPIP P  I+++T+ +SPH DK +R+Q 
Sbjct: 7   IRIKLKAFDHRVLDASAVQIADTAERTGARVSGPIPLPTEIKKYTILKSPHKDKDAREQY 66

Query: 68  EMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           E+R +KRL+ I+ PT +T++ALM+L++ +GV++ IKL
Sbjct: 67  ELRTHKRLIDIVDPTQKTMEALMQLNLPSGVDIQIKL 103


>gi|116617328|ref|YP_817699.1| SSU ribosomal protein S10P [Leuconostoc mesenteroides subsp.
           mesenteroides ATCC 8293]
 gi|170017944|ref|YP_001728863.1| ribosomal protein S10 [Leuconostoc citreum KM20]
 gi|227431342|ref|ZP_03913395.1| ribosomal protein S10 [Leuconostoc mesenteroides subsp. cremoris
           ATCC 19254]
 gi|300174032|ref|YP_003773198.1| 30S ribosomal protein S10 [Leuconostoc gasicomitatum LMG 18811]
 gi|326692238|ref|ZP_08229243.1| 30S ribosomal protein S10 [Leuconostoc argentinum KCTC 3773]
 gi|122272471|sp|Q03ZP6|RS10_LEUMM RecName: Full=30S ribosomal protein S10
 gi|226705589|sp|B1MW15|RS10_LEUCK RecName: Full=30S ribosomal protein S10
 gi|116096175|gb|ABJ61326.1| SSU ribosomal protein S10P [Leuconostoc mesenteroides subsp.
           mesenteroides ATCC 8293]
 gi|169804801|gb|ACA83419.1| Ribosomal protein S10 [Leuconostoc citreum KM20]
 gi|227352935|gb|EEJ43108.1| ribosomal protein S10 [Leuconostoc mesenteroides subsp. cremoris
           ATCC 19254]
 gi|299888411|emb|CBL92379.1| 30S ribosomal protein S10 [Leuconostoc gasicomitatum LMG 18811]
          Length = 102

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 53/104 (50%), Positives = 72/104 (69%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LKA++ RILD S  +IV T K++G++I GPIP P     +T+ RSPH  
Sbjct: 1   MAQKKIRIR--LKAYEHRILDQSAEKIVETAKRTGAEIAGPIPLPTERTLYTILRSPHKH 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+Q EMR +KRL+ I+ PT +TVDAL KL++ +GV + IKL
Sbjct: 59  KDSREQFEMRTHKRLIDIVNPTDKTVDALRKLELPSGVAIEIKL 102


>gi|257458709|ref|ZP_05623833.1| ribosomal protein S10 [Campylobacter gracilis RM3268]
 gi|257443898|gb|EEV19017.1| ribosomal protein S10 [Campylobacter gracilis RM3268]
          Length = 103

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 70/96 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + LKA+D R+LD ++  IV   K++G+ + GP+P P  I+R+TV RSPHV+K SR+Q
Sbjct: 3   KIRLKLKAYDHRVLDRTVSAIVEAVKRTGADVRGPVPMPTKIKRYTVLRSPHVNKDSREQ 62

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVI 102
            EM+I+ R+L I+  TP TVD+L KLD+A  VNV +
Sbjct: 63  FEMKIHARMLDIVAATPDTVDSLTKLDLAPEVNVEV 98


>gi|167036800|ref|YP_001664378.1| 30S ribosomal protein S10 [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|167039519|ref|YP_001662504.1| 30S ribosomal protein S10 [Thermoanaerobacter sp. X514]
 gi|256752631|ref|ZP_05493483.1| ribosomal protein S10 [Thermoanaerobacter ethanolicus CCSD1]
 gi|300915230|ref|ZP_07132545.1| ribosomal protein S10 [Thermoanaerobacter sp. X561]
 gi|307267015|ref|ZP_07548531.1| ribosomal protein S10 [Thermoanaerobacter wiegelii Rt8.B1]
 gi|307725154|ref|YP_003904905.1| 30S ribosomal protein S10 [Thermoanaerobacter sp. X513]
 gi|320115222|ref|YP_004185381.1| 30S ribosomal protein S10 [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|326390662|ref|ZP_08212217.1| ribosomal protein S10 [Thermoanaerobacter ethanolicus JW 200]
 gi|226705639|sp|B0KCJ9|RS10_THEP3 RecName: Full=30S ribosomal protein S10
 gi|226705640|sp|B0K5P2|RS10_THEPX RecName: Full=30S ribosomal protein S10
 gi|166853759|gb|ABY92168.1| ribosomal protein S10 [Thermoanaerobacter sp. X514]
 gi|166855634|gb|ABY94042.1| ribosomal protein S10 [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|256748451|gb|EEU61503.1| ribosomal protein S10 [Thermoanaerobacter ethanolicus CCSD1]
 gi|300888954|gb|EFK84101.1| ribosomal protein S10 [Thermoanaerobacter sp. X561]
 gi|306918000|gb|EFN48258.1| ribosomal protein S10 [Thermoanaerobacter wiegelii Rt8.B1]
 gi|307582215|gb|ADN55614.1| ribosomal protein S10 [Thermoanaerobacter sp. X513]
 gi|319928313|gb|ADV78998.1| ribosomal protein S10 [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|325993340|gb|EGD51777.1| ribosomal protein S10 [Thermoanaerobacter ethanolicus JW 200]
          Length = 102

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 72/98 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD  ILD S ++IV T K++G+++ GPIP P      T+ R+PH  K SR+Q
Sbjct: 5   KIRIRLKAFDHAILDQSAQKIVETAKRTGAEVSGPIPLPTEKDIITILRAPHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRL+ I+ PTP+TVDALM+LD+ +GV++ IKL
Sbjct: 65  FEIRTHKRLIDILNPTPKTVDALMRLDLPSGVDIEIKL 102


>gi|311744810|ref|ZP_07718606.1| 30S ribosomal protein S10 [Aeromicrobium marinum DSM 15272]
 gi|311311927|gb|EFQ81848.1| 30S ribosomal protein S10 [Aeromicrobium marinum DSM 15272]
          Length = 102

 Score =  104 bits (260), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 73/104 (70%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LKA+D  ++D+S R+IV T  ++G+++ GP+P P     F V RSPH  
Sbjct: 1   MAGQKIRIR--LKAYDHEVIDTSARKIVDTVTRTGAKVAGPVPLPTEKNVFCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+  EMR +KRL+ II PTP+TVD+LM+LD+ AGV++ IKL
Sbjct: 59  KDSREHFEMRTHKRLIDIIDPTPKTVDSLMRLDLPAGVDIEIKL 102


>gi|219684135|ref|ZP_03539079.1| ribosomal protein S10 [Borrelia garinii PBr]
 gi|219685265|ref|ZP_03540085.1| ribosomal protein S10 [Borrelia garinii Far04]
 gi|219672124|gb|EED29177.1| ribosomal protein S10 [Borrelia garinii PBr]
 gi|219673361|gb|EED30380.1| ribosomal protein S10 [Borrelia garinii Far04]
          Length = 103

 Score =  104 bits (260), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 51/97 (52%), Positives = 71/97 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + L +FD +ILD S   IV   +K+ +QI GPIP P  I+++TV RSPHV+KKSR+Q
Sbjct: 6   KIRVKLFSFDVKILDQSAESIVKAVQKAKAQIKGPIPLPTKIKKYTVLRSPHVNKKSREQ 65

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            EMR +KRL+ I++PT   +D+LMKL++ AGV V IK
Sbjct: 66  FEMRTHKRLIDILEPTSALMDSLMKLELPAGVEVDIK 102


>gi|295398287|ref|ZP_06808329.1| 30S ribosomal protein S10 [Aerococcus viridans ATCC 11563]
 gi|294973426|gb|EFG49211.1| 30S ribosomal protein S10 [Aerococcus viridans ATCC 11563]
          Length = 117

 Score =  104 bits (260), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA++ R LD S  +IV T +++G+++ GPIP P     FTV R+ H  K SR+Q
Sbjct: 20  KIRIRLKAYEHRALDQSAAKIVDTAQRTGAEVSGPIPLPTERSLFTVIRATHKYKDSREQ 79

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTP+TVDALMKLD+ +GV++ IKL
Sbjct: 80  FEMRTHKRLIDIVNPTPKTVDALMKLDLPSGVDIEIKL 117


>gi|223934255|ref|ZP_03626184.1| ribosomal protein S10 [Streptococcus suis 89/1591]
 gi|223897069|gb|EEF63501.1| ribosomal protein S10 [Streptococcus suis 89/1591]
          Length = 102

 Score =  104 bits (260), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 71/100 (71%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA++ R LD++  +IV T  ++G+Q+ GP+P P     +T+ R+ H  K SR
Sbjct: 3   NKKIRIRLKAYEHRTLDTAAAKIVETATRTGAQVAGPVPLPTERSLYTIIRATHKYKDSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KRL+ II PT +TVDALMKLD+ +GVNV IKL
Sbjct: 63  EQFEMRTHKRLIDIINPTQKTVDALMKLDLPSGVNVEIKL 102


>gi|119478133|ref|ZP_01618212.1| ribosomal protein S10 [marine gamma proteobacterium HTCC2143]
 gi|119448839|gb|EAW30082.1| ribosomal protein S10 [marine gamma proteobacterium HTCC2143]
          Length = 87

 Score =  104 bits (260), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 66/86 (76%)

Query: 19  ILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQLEMRIYKRLLYI 78
           ++D S +EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +RDQ E+R +KRLL I
Sbjct: 1   LIDVSTQEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDARDQYEIRTHKRLLDI 60

Query: 79  IKPTPQTVDALMKLDIAAGVNVVIKL 104
           ++PT +TVDALMKLD+AAGV V I L
Sbjct: 61  VEPTEKTVDALMKLDLAAGVEVQISL 86


>gi|167342358|gb|ABZ69136.1| 30S ribosomal protein S10 [Borrelia garinii]
          Length = 100

 Score =  104 bits (260), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 51/97 (52%), Positives = 71/97 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + L +FD +ILD S   IV   +K+ +QI GPIP P  I+++TV RSPHV+KKSR+Q
Sbjct: 2   KIRVKLFSFDVKILDQSAESIVKAVQKAKAQIKGPIPLPTKIKKYTVLRSPHVNKKSREQ 61

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            EMR +KRL+ I++PT   +D+LMKL++ AGV V IK
Sbjct: 62  FEMRTHKRLIDILEPTSALMDSLMKLELPAGVEVDIK 98


>gi|332182017|gb|AEE17705.1| 30S ribosomal protein S10 [Treponema brennaborense DSM 12168]
          Length = 102

 Score =  104 bits (260), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 49/97 (50%), Positives = 73/97 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + L+AFD  ++D S + IV T +++G+++ GPIP P  I + TV RSPHV+KKSR+Q
Sbjct: 5   KIRVRLRAFDVGLIDQSAKAIVQTVQQAGAKVSGPIPLPTRINKVTVLRSPHVNKKSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            EMR +KRL+ II+P+   +D+LMKL++ AGV+V IK
Sbjct: 65  FEMRTHKRLIDIIEPSADVMDSLMKLELPAGVDVEIK 101


>gi|313681318|ref|YP_004059056.1| SSU ribosomal protein s10p [Sulfuricurvum kujiense DSM 16994]
 gi|313154178|gb|ADR32856.1| SSU ribosomal protein S10P [Sulfuricurvum kujiense DSM 16994]
          Length = 103

 Score =  104 bits (260), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 73/97 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + L+A+D R+LD S+  IV   K++G++I GPIP P  IR++TV +SPHV+K SR+Q
Sbjct: 3   KIRLKLRAYDHRVLDRSVASIVEAVKRTGAEIRGPIPLPTKIRKYTVLKSPHVNKDSREQ 62

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E+R++ RL+ I+  TP TVD+LMKLD+A  V+V ++
Sbjct: 63  FEIRMHARLIDIVSATPDTVDSLMKLDLAPEVDVEVR 99


>gi|72163046|ref|YP_290703.1| 30S ribosomal protein S10 [Thermobifida fusca YX]
 gi|118597335|sp|Q47LJ2|RS10_THEFY RecName: Full=30S ribosomal protein S10
 gi|71916778|gb|AAZ56680.1| SSU ribosomal protein S10P [Thermobifida fusca YX]
          Length = 102

 Score =  104 bits (260), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 71/104 (68%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LKA+D  ++D S R IV T  ++G+Q+ GP+P P     + V RSPH  
Sbjct: 1   MAGQKIRIR--LKAYDHEVIDKSARRIVETVTRTGAQVAGPVPLPTEKNVYCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+  EMR +KRL+ II PTP+TVD+LM+LD+ AGV++ IKL
Sbjct: 59  KDSREHFEMRTHKRLIDIIDPTPKTVDSLMRLDLPAGVDIEIKL 102


>gi|158334956|ref|YP_001516128.1| 30S ribosomal protein S10 [Acaryochloris marina MBIC11017]
 gi|189040358|sp|B0CCC9|RS10_ACAM1 RecName: Full=30S ribosomal protein S10
 gi|158305197|gb|ABW26814.1| 30S ribosomal protein S10 [Acaryochloris marina MBIC11017]
          Length = 105

 Score =  104 bits (260), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 74/103 (71%)

Query: 2   TSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDK 61
           T +  +I I LKAFD R+LD+S  +IV T K++ +  VGPIP P   R + V RSPHVDK
Sbjct: 3   TLQQQKIRIRLKAFDHRLLDTSCDKIVETAKRTNASPVGPIPLPTRRRIYCVLRSPHVDK 62

Query: 62  KSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            SR+  E R ++R++ I +P+P+T+DALMKLD+ AGV++ +KL
Sbjct: 63  DSREHFETRTHRRIVDIYQPSPKTIDALMKLDLPAGVDIEVKL 105


>gi|146319919|ref|YP_001199630.1| 30S ribosomal protein S10 [Streptococcus suis 98HAH33]
 gi|253750986|ref|YP_003024127.1| 30S ribosomal protein S10 [Streptococcus suis SC84]
 gi|253752886|ref|YP_003026026.1| 30S ribosomal protein S10 [Streptococcus suis P1/7]
 gi|253754711|ref|YP_003027851.1| 30S ribosomal protein S10 [Streptococcus suis BM407]
 gi|166231787|sp|A4VYP1|RS10_STRS2 RecName: Full=30S ribosomal protein S10
 gi|145690725|gb|ABP91230.1| ribosomal protein S10 [Streptococcus suis 98HAH33]
 gi|251815275|emb|CAZ50841.1| 30S ribosomal protein S10 [Streptococcus suis SC84]
 gi|251817175|emb|CAZ54897.1| 30S ribosomal protein S10 [Streptococcus suis BM407]
 gi|251819131|emb|CAR44221.1| 30S ribosomal protein S10 [Streptococcus suis P1/7]
 gi|292557530|gb|ADE30531.1| ribosomal protein S10 [Streptococcus suis GZ1]
 gi|319757240|gb|ADV69182.1| ribosomal protein S10 [Streptococcus suis JS14]
          Length = 102

 Score =  104 bits (260), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 71/100 (71%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA++ R LD++  +IV T  ++G+Q+ GP+P P     +T+ R+ H  K SR
Sbjct: 3   NKKIRIRLKAYEHRTLDTAAAKIVETATRTGAQVAGPVPLPTERSFYTIIRATHKYKDSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KRL+ II PT +TVDALMKLD+ +GVNV IKL
Sbjct: 63  EQFEMRTHKRLIDIINPTQKTVDALMKLDLPSGVNVEIKL 102


>gi|189183950|ref|YP_001937735.1| 30S ribosomal protein S10 [Orientia tsutsugamushi str. Ikeda]
 gi|189180721|dbj|BAG40501.1| 30S ribosomal protein S10 [Orientia tsutsugamushi str. Ikeda]
          Length = 101

 Score =  104 bits (260), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 74/102 (72%), Gaps = 2/102 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M+S++IRI   LK+FD  +LD +  EIV   K +G+++ G +P PR I+ FT N+SPH+ 
Sbjct: 1   MSSKDIRIR--LKSFDHALLDRTTFEIVRLAKSAGAKVKGAVPLPRRIQYFTFNKSPHIY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVI 102
           KKSR+Q E+R +KRL+ I   TPQT++ALMK+ +A GV+V I
Sbjct: 59  KKSREQFEIRTHKRLIVIASSTPQTIEALMKMTLAPGVDVQI 100


>gi|229917359|ref|YP_002886005.1| 30S ribosomal protein S10 [Exiguobacterium sp. AT1b]
 gi|259494593|sp|C4KZP7|RS10_EXISA RecName: Full=30S ribosomal protein S10
 gi|229468788|gb|ACQ70560.1| ribosomal protein S10 [Exiguobacterium sp. AT1b]
          Length = 102

 Score =  104 bits (260), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 73/100 (73%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA+D R+LD S  +IV T K+SG+++ GPIP P     +T+ R+ H  K +R
Sbjct: 3   NEKIRIRLKAYDHRVLDQSAEKIVDTAKRSGAKVSGPIPLPTEKSIYTILRAVHKYKDAR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KRL+ I+ PTP+TVDALM+L++ +GV++ IKL
Sbjct: 63  EQFEMRTHKRLIDIVNPTPKTVDALMRLELPSGVDIEIKL 102


>gi|116490657|ref|YP_810201.1| SSU ribosomal protein S10P [Oenococcus oeni PSU-1]
 gi|118586993|ref|ZP_01544425.1| ribosomal protein S10 [Oenococcus oeni ATCC BAA-1163]
 gi|290890073|ref|ZP_06553156.1| hypothetical protein AWRIB429_0546 [Oenococcus oeni AWRIB429]
 gi|122277159|sp|Q04G86|RS10_OENOB RecName: Full=30S ribosomal protein S10
 gi|116091382|gb|ABJ56536.1| SSU ribosomal protein S10P [Oenococcus oeni PSU-1]
 gi|118432615|gb|EAV39349.1| ribosomal protein S10 [Oenococcus oeni ATCC BAA-1163]
 gi|290480264|gb|EFD88905.1| hypothetical protein AWRIB429_0546 [Oenococcus oeni AWRIB429]
          Length = 102

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 53/104 (50%), Positives = 73/104 (70%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  R IRI   LKA++ R +D+S  +IV T K++G+Q+VGPIP P     +T+ RSPH  
Sbjct: 1   MAERKIRIR--LKAYEYRTIDASAAKIVETAKRTGAQVVGPIPLPTERTIYTILRSPHKH 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+Q EMR +KRL+ ++ PT +TVD+L KLD+ AGV + IKL
Sbjct: 59  KDSREQFEMRTHKRLIDLVNPTDKTVDSLRKLDLPAGVAIEIKL 102


>gi|22299294|ref|NP_682541.1| 30S ribosomal protein S10 [Thermosynechococcus elongatus BP-1]
 gi|34222861|sp|Q8DI41|RS10_THEEB RecName: Full=30S ribosomal protein S10
 gi|22295477|dbj|BAC09303.1| 30S ribosomal protein S10 [Thermosynechococcus elongatus BP-1]
          Length = 104

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 53/104 (50%), Positives = 73/104 (70%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M +   +I I LKAFD R+LD+S   IV T K++G+  VGPIP P   R + V RSPHVD
Sbjct: 1   MAALQQKIRIRLKAFDHRLLDTSCDRIVDTAKRTGASPVGPIPLPTRRRIYCVLRSPHVD 60

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+  E R + R+L I +P+P+T+DAL+KLD+ AGV++ +KL
Sbjct: 61  KDSREHFETRTHCRILDIYQPSPKTIDALIKLDLPAGVDIEVKL 104


>gi|289579146|ref|YP_003477773.1| ribosomal protein S10 [Thermoanaerobacter italicus Ab9]
 gi|297545330|ref|YP_003677632.1| ribosomal protein S10 [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
 gi|289528859|gb|ADD03211.1| ribosomal protein S10 [Thermoanaerobacter italicus Ab9]
 gi|296843105|gb|ADH61621.1| ribosomal protein S10 [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
          Length = 102

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 72/98 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD  ILD S ++IV T K++G+++ GPIP P      T+ R+PH  K SR+Q
Sbjct: 5   KIRIRLKAFDHAILDQSAQKIVETAKRTGAEVSGPIPLPTERDIITILRAPHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRL+ I+ PTP+TVDALM+LD+ +GV++ IKL
Sbjct: 65  FEIRTHKRLIDILNPTPKTVDALMRLDLPSGVDIEIKL 102


>gi|167342346|gb|ABZ69130.1| 30S ribosomal protein S10 [Borrelia garinii]
          Length = 99

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 51/97 (52%), Positives = 71/97 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + L +FD +ILD S   IV   +K+ +QI GPIP P  I+++TV RSPHV+KKSR+Q
Sbjct: 2   KIRVKLFSFDVKILDQSAESIVKAVQKAKAQIKGPIPLPTKIKKYTVLRSPHVNKKSREQ 61

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            EMR +KRL+ I++PT   +D+LMKL++ AGV V IK
Sbjct: 62  FEMRTHKRLIDILEPTSALMDSLMKLELPAGVEVDIK 98


>gi|149179413|ref|ZP_01857967.1| 30S ribosomal protein S10 [Planctomyces maris DSM 8797]
 gi|148841724|gb|EDL56133.1| 30S ribosomal protein S10 [Planctomyces maris DSM 8797]
          Length = 110

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 49/97 (50%), Positives = 71/97 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I ++A+D  +LD S  +IV T K++G+ + GPIP P  I R+TV + PH+DKKSR+Q
Sbjct: 8   RIRIRMEAYDHSVLDQSAADIVDTAKRTGAIVHGPIPLPTRIERYTVLKGPHIDKKSREQ 67

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E+R +KRL+ I+ PT +T+DAL KL + AGV++ IK
Sbjct: 68  FEIRTHKRLVDILSPTGKTIDALNKLSLPAGVDIKIK 104


>gi|167342354|gb|ABZ69134.1| 30S ribosomal protein S10 [Borrelia garinii]
          Length = 100

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 51/97 (52%), Positives = 71/97 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + L +FD +ILD S   IV   +K+ +QI GPIP P  I+++TV RSPHV+KKSR+Q
Sbjct: 2   KIRVKLFSFDVKILDQSAESIVKAVQKAKAQIKGPIPLPTKIKKYTVLRSPHVNKKSREQ 61

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            EMR +KRL+ I++PT   +D+LMKL++ AGV V IK
Sbjct: 62  FEMRTHKRLIDILEPTSALMDSLMKLELPAGVEVDIK 98


>gi|50843319|ref|YP_056546.1| 30S ribosomal protein S10 [Propionibacterium acnes KPA171202]
 gi|282855209|ref|ZP_06264541.1| ribosomal protein S10 [Propionibacterium acnes J139]
 gi|289424814|ref|ZP_06426596.1| ribosomal protein S10 [Propionibacterium acnes SK187]
 gi|289427734|ref|ZP_06429446.1| ribosomal protein S10 [Propionibacterium acnes J165]
 gi|295131388|ref|YP_003582051.1| ribosomal protein S10 [Propionibacterium acnes SK137]
 gi|54036336|sp|Q6A6M5|RS10_PROAC RecName: Full=30S ribosomal protein S10
 gi|50840921|gb|AAT83588.1| 30S ribosomal protein S10 [Propionibacterium acnes KPA171202]
 gi|282581797|gb|EFB87182.1| ribosomal protein S10 [Propionibacterium acnes J139]
 gi|289154777|gb|EFD03460.1| ribosomal protein S10 [Propionibacterium acnes SK187]
 gi|289159225|gb|EFD07417.1| ribosomal protein S10 [Propionibacterium acnes J165]
 gi|291376546|gb|ADE00401.1| ribosomal protein S10 [Propionibacterium acnes SK137]
 gi|313763239|gb|EFS34603.1| ribosomal protein S10 [Propionibacterium acnes HL013PA1]
 gi|313793257|gb|EFS41315.1| ribosomal protein S10 [Propionibacterium acnes HL110PA1]
 gi|313801099|gb|EFS42367.1| ribosomal protein S10 [Propionibacterium acnes HL110PA2]
 gi|313808840|gb|EFS47294.1| ribosomal protein S10 [Propionibacterium acnes HL087PA2]
 gi|313810366|gb|EFS48080.1| ribosomal protein S10 [Propionibacterium acnes HL083PA1]
 gi|313812298|gb|EFS50012.1| ribosomal protein S10 [Propionibacterium acnes HL025PA1]
 gi|313816575|gb|EFS54289.1| ribosomal protein S10 [Propionibacterium acnes HL059PA1]
 gi|313818020|gb|EFS55734.1| ribosomal protein S10 [Propionibacterium acnes HL046PA2]
 gi|313819933|gb|EFS57647.1| ribosomal protein S10 [Propionibacterium acnes HL036PA1]
 gi|313823423|gb|EFS61137.1| ribosomal protein S10 [Propionibacterium acnes HL036PA2]
 gi|313824895|gb|EFS62609.1| ribosomal protein S10 [Propionibacterium acnes HL063PA1]
 gi|313828363|gb|EFS66077.1| ribosomal protein S10 [Propionibacterium acnes HL063PA2]
 gi|313836020|gb|EFS73734.1| ribosomal protein S10 [Propionibacterium acnes HL037PA2]
 gi|313837948|gb|EFS75662.1| ribosomal protein S10 [Propionibacterium acnes HL086PA1]
 gi|314914331|gb|EFS78162.1| ribosomal protein S10 [Propionibacterium acnes HL005PA4]
 gi|314917651|gb|EFS81482.1| ribosomal protein S10 [Propionibacterium acnes HL050PA1]
 gi|314919617|gb|EFS83448.1| ribosomal protein S10 [Propionibacterium acnes HL050PA3]
 gi|314924186|gb|EFS88017.1| ribosomal protein S10 [Propionibacterium acnes HL001PA1]
 gi|314925789|gb|EFS89620.1| ribosomal protein S10 [Propionibacterium acnes HL036PA3]
 gi|314929559|gb|EFS93390.1| ribosomal protein S10 [Propionibacterium acnes HL044PA1]
 gi|314930208|gb|EFS94039.1| ribosomal protein S10 [Propionibacterium acnes HL067PA1]
 gi|314957185|gb|EFT01289.1| ribosomal protein S10 [Propionibacterium acnes HL027PA1]
 gi|314957761|gb|EFT01864.1| ribosomal protein S10 [Propionibacterium acnes HL002PA1]
 gi|314960869|gb|EFT04970.1| ribosomal protein S10 [Propionibacterium acnes HL002PA2]
 gi|314963543|gb|EFT07643.1| ribosomal protein S10 [Propionibacterium acnes HL082PA1]
 gi|314969874|gb|EFT13972.1| ribosomal protein S10 [Propionibacterium acnes HL037PA1]
 gi|314970556|gb|EFT14654.1| ribosomal protein S10 [Propionibacterium acnes HL037PA3]
 gi|314982250|gb|EFT26343.1| ribosomal protein S10 [Propionibacterium acnes HL110PA3]
 gi|314986052|gb|EFT30144.1| ribosomal protein S10 [Propionibacterium acnes HL005PA2]
 gi|314988668|gb|EFT32759.1| ribosomal protein S10 [Propionibacterium acnes HL005PA3]
 gi|315077166|gb|EFT49233.1| ribosomal protein S10 [Propionibacterium acnes HL053PA2]
 gi|315079851|gb|EFT51827.1| ribosomal protein S10 [Propionibacterium acnes HL078PA1]
 gi|315083219|gb|EFT55195.1| ribosomal protein S10 [Propionibacterium acnes HL027PA2]
 gi|315086827|gb|EFT58803.1| ribosomal protein S10 [Propionibacterium acnes HL002PA3]
 gi|315090437|gb|EFT62413.1| ribosomal protein S10 [Propionibacterium acnes HL110PA4]
 gi|315093672|gb|EFT65648.1| ribosomal protein S10 [Propionibacterium acnes HL060PA1]
 gi|315097986|gb|EFT69962.1| ribosomal protein S10 [Propionibacterium acnes HL059PA2]
 gi|315100629|gb|EFT72605.1| ribosomal protein S10 [Propionibacterium acnes HL046PA1]
 gi|315103966|gb|EFT75942.1| ribosomal protein S10 [Propionibacterium acnes HL050PA2]
 gi|315106074|gb|EFT78050.1| ribosomal protein S10 [Propionibacterium acnes HL030PA1]
 gi|315109233|gb|EFT81209.1| ribosomal protein S10 [Propionibacterium acnes HL030PA2]
 gi|327325172|gb|EGE66978.1| ribosomal protein S10 [Propionibacterium acnes HL096PA3]
 gi|327326713|gb|EGE68499.1| ribosomal protein S10 [Propionibacterium acnes HL103PA1]
 gi|327449373|gb|EGE96027.1| ribosomal protein S10 [Propionibacterium acnes HL013PA2]
 gi|327451420|gb|EGE98074.1| ribosomal protein S10 [Propionibacterium acnes HL087PA3]
 gi|327451605|gb|EGE98259.1| ribosomal protein S10 [Propionibacterium acnes HL092PA1]
 gi|327451892|gb|EGE98546.1| ribosomal protein S10 [Propionibacterium acnes HL083PA2]
 gi|328752106|gb|EGF65722.1| ribosomal protein S10 [Propionibacterium acnes HL087PA1]
 gi|328755498|gb|EGF69114.1| ribosomal protein S10 [Propionibacterium acnes HL025PA2]
 gi|328756282|gb|EGF69898.1| ribosomal protein S10 [Propionibacterium acnes HL020PA1]
 gi|328906231|gb|EGG26006.1| 30S ribosomal protein S10 [Propionibacterium sp. P08]
          Length = 103

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 74/104 (71%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   L+A+D  ++DSS R+IV T  ++G+++ GP+P P     F V RSPH  
Sbjct: 1   MAGQKIRIR--LRAYDHEVIDSSARKIVDTVTRTGAKVAGPVPLPTEKNVFCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+  EMR +KRL+ I++PTP+TVD+LM+LD+ AGV++ IKL
Sbjct: 59  KDSREHFEMRTHKRLIDILEPTPKTVDSLMRLDLPAGVDIEIKL 102


>gi|324990003|gb|EGC21944.1| 30S ribosomal protein S10 [Streptococcus sanguinis SK353]
          Length = 102

 Score =  104 bits (259), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 71/100 (71%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA++ R LD++  +IV T  ++G+++ GPIP P     +T+ R+ H  K SR
Sbjct: 3   NKKIRIRLKAYEHRTLDTAAAKIVETATRTGAEVAGPIPLPTERSLYTIIRATHEYKDSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KRL+ II PT +TVDALMKLD+ +GVNV IKL
Sbjct: 63  EQFEMRTHKRLIDIINPTQKTVDALMKLDLPSGVNVEIKL 102


>gi|296272639|ref|YP_003655270.1| 30S ribosomal protein S10 [Arcobacter nitrofigilis DSM 7299]
 gi|296096813|gb|ADG92763.1| ribosomal protein S10 [Arcobacter nitrofigilis DSM 7299]
          Length = 104

 Score =  104 bits (259), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 72/97 (74%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + LKA+D R+LD S+  IV   K++G+++ GPIP P  IRR+TV + PHV+K SR+Q
Sbjct: 3   KIRLKLKAYDHRVLDRSVASIVEAVKRTGAELRGPIPLPTKIRRYTVIKGPHVNKDSREQ 62

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E+R++ R++ I+  TP TVD+LMKLD+A  V+V ++
Sbjct: 63  FEIRVHSRMIDIVSATPDTVDSLMKLDLAPEVDVEVR 99


>gi|325108614|ref|YP_004269682.1| 30S ribosomal protein S10P [Planctomyces brasiliensis DSM 5305]
 gi|324968882|gb|ADY59660.1| SSU ribosomal protein S10P [Planctomyces brasiliensis DSM 5305]
          Length = 107

 Score =  104 bits (259), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 73/97 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I ++A+D  +LD S  +IV T K++G+ + GPIP P  I R+TV RSPH+D+KSR+Q
Sbjct: 8   KIRIRMEAYDHSVLDQSAGDIVDTAKRTGAIVHGPIPLPTRIERYTVLRSPHIDRKSREQ 67

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E+R +KR++ I++PT +T+DAL KL + AGV++ IK
Sbjct: 68  FEIRTHKRVIDIVQPTGKTIDALNKLSLPAGVDIKIK 104


>gi|73667229|ref|YP_303245.1| 30S ribosomal protein S10 [Ehrlichia canis str. Jake]
 gi|108884794|sp|Q3YRK8|RS10_EHRCJ RecName: Full=30S ribosomal protein S10
 gi|72394370|gb|AAZ68647.1| SSU ribosomal protein S10P [Ehrlichia canis str. Jake]
          Length = 108

 Score =  104 bits (259), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFDS +LD S R I+LT K+SG+++ GPI FPR + +F VNRS HVDKKSR+Q
Sbjct: 5   KIYIELKAFDSCLLDRSARSIILTAKRSGARVNGPIFFPRKVMKFIVNRSTHVDKKSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRL+ + +     + ALM L + AGV+V +K+
Sbjct: 65  FEIRTHKRLISLPRANSTIIQALMSLQLPAGVDVKVKV 102


>gi|218961434|ref|YP_001741209.1| 30S ribosomal subunit protein S10 [Candidatus Cloacamonas
           acidaminovorans]
 gi|167730091|emb|CAO81003.1| 30S ribosomal subunit protein S10 [Candidatus Cloacamonas
           acidaminovorans]
          Length = 97

 Score =  104 bits (259), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 69/92 (75%)

Query: 12  LKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQLEMRI 71
           +KA+D R+LD S+ EIV +T+ +G+++VGPIP P     +T+ RSPH DKKS+DQ +M +
Sbjct: 1   MKAYDHRLLDKSVAEIVKSTRNTGAKVVGPIPLPTDRTIYTILRSPHADKKSQDQFQMLV 60

Query: 72  YKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           +KRL+ I+ PT QT +AL KL + AGV+V IK
Sbjct: 61  HKRLIDIVNPTQQTTNALKKLSLPAGVHVEIK 92


>gi|302336385|ref|YP_003801592.1| SSU ribosomal protein S10P [Olsenella uli DSM 7084]
 gi|301320225|gb|ADK68712.1| SSU ribosomal protein S10P [Olsenella uli DSM 7084]
          Length = 102

 Score =  104 bits (259), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 74/104 (71%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M+S+ IRI   LK +D  I+D S + IV T +K+G+++ GP+P P     +TV RSPH D
Sbjct: 1   MSSQKIRIR--LKGYDHEIVDQSSKLIVDTAQKTGARVSGPVPLPTERNLYTVIRSPHKD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+Q EMR +KRL+ I+ P+  TVD+LM+LD+ AGV++ IKL
Sbjct: 59  KDSREQFEMRTHKRLIDILDPSSSTVDSLMRLDLPAGVDIEIKL 102


>gi|304315939|ref|YP_003851084.1| ribosomal protein S10 [Thermoanaerobacterium thermosaccharolyticum
           DSM 571]
 gi|323706449|ref|ZP_08118010.1| ribosomal protein S10 [Thermoanaerobacterium xylanolyticum LX-11]
 gi|302777441|gb|ADL68000.1| ribosomal protein S10 [Thermoanaerobacterium thermosaccharolyticum
           DSM 571]
 gi|323534169|gb|EGB23959.1| ribosomal protein S10 [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 102

 Score =  104 bits (259), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD  +LD S  +IV T K++G+++ GPIP P      T+ R+PH  K SR+Q
Sbjct: 5   KIRIRLKAFDHMVLDQSAEKIVETAKRTGAEVSGPIPLPTERDVITILRAPHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R +KRL+ I+ PTP+TVDALM+LD+ AGV++ IKL
Sbjct: 65  FETRTHKRLIDILSPTPKTVDALMRLDLPAGVDIEIKL 102


>gi|15594822|ref|NP_212611.1| 30S ribosomal protein S10 [Borrelia burgdorferi B31]
 gi|51598731|ref|YP_072919.1| 30S ribosomal protein S10 [Borrelia garinii PBi]
 gi|111115306|ref|YP_709924.1| 30S ribosomal protein S10 [Borrelia afzelii PKo]
 gi|195941614|ref|ZP_03086996.1| 30S ribosomal protein S10 [Borrelia burgdorferi 80a]
 gi|216263648|ref|ZP_03435643.1| ribosomal protein S10 [Borrelia afzelii ACA-1]
 gi|216264727|ref|ZP_03436719.1| ribosomal protein S10 [Borrelia burgdorferi 156a]
 gi|218249238|ref|YP_002374987.1| ribosomal protein S10 [Borrelia burgdorferi ZS7]
 gi|221218056|ref|ZP_03589522.1| ribosomal protein S10 [Borrelia burgdorferi 72a]
 gi|223889043|ref|ZP_03623634.1| ribosomal protein S10 [Borrelia burgdorferi 64b]
 gi|224531700|ref|ZP_03672332.1| ribosomal protein S10 [Borrelia valaisiana VS116]
 gi|224532499|ref|ZP_03673124.1| ribosomal protein S10 [Borrelia burgdorferi WI91-23]
 gi|224533592|ref|ZP_03674181.1| ribosomal protein S10 [Borrelia burgdorferi CA-11.2a]
 gi|224534726|ref|ZP_03675298.1| ribosomal protein S10 [Borrelia spielmanii A14S]
 gi|225548695|ref|ZP_03769742.1| ribosomal protein S10 [Borrelia burgdorferi 94a]
 gi|225549520|ref|ZP_03770486.1| ribosomal protein S10 [Borrelia burgdorferi 118a]
 gi|225551907|ref|ZP_03772847.1| ribosomal protein S10 [Borrelia sp. SV1]
 gi|226321109|ref|ZP_03796651.1| ribosomal protein S10 [Borrelia burgdorferi 29805]
 gi|226321787|ref|ZP_03797313.1| ribosomal protein S10 [Borrelia burgdorferi Bol26]
 gi|2500431|sp|P94266|RS10_BORBU RecName: Full=30S ribosomal protein S10
 gi|81609969|sp|Q661E4|RS10_BORGA RecName: Full=30S ribosomal protein S10
 gi|123341336|sp|Q0SN30|RS10_BORAP RecName: Full=30S ribosomal protein S10
 gi|226705403|sp|B7J242|RS10_BORBZ RecName: Full=30S ribosomal protein S10
 gi|1685370|gb|AAB36821.1| ribosomal protein S10 [Borrelia burgdorferi]
 gi|2688414|gb|AAC66865.1| ribosomal protein S10 (rpsJ) [Borrelia burgdorferi B31]
 gi|51573302|gb|AAU07327.1| ribosomal protein S10 [Borrelia garinii PBi]
 gi|110890580|gb|ABH01748.1| ribosomal protein S10 [Borrelia afzelii PKo]
 gi|215980492|gb|EEC21313.1| ribosomal protein S10 [Borrelia afzelii ACA-1]
 gi|215981200|gb|EEC22007.1| ribosomal protein S10 [Borrelia burgdorferi 156a]
 gi|218164426|gb|ACK74487.1| ribosomal protein S10 [Borrelia burgdorferi ZS7]
 gi|221192004|gb|EEE18225.1| ribosomal protein S10 [Borrelia burgdorferi 72a]
 gi|223885859|gb|EEF56958.1| ribosomal protein S10 [Borrelia burgdorferi 64b]
 gi|224511165|gb|EEF81571.1| ribosomal protein S10 [Borrelia valaisiana VS116]
 gi|224512571|gb|EEF82947.1| ribosomal protein S10 [Borrelia burgdorferi WI91-23]
 gi|224513265|gb|EEF83627.1| ribosomal protein S10 [Borrelia burgdorferi CA-11.2a]
 gi|224513974|gb|EEF84296.1| ribosomal protein S10 [Borrelia spielmanii A14S]
 gi|225369797|gb|EEG99244.1| ribosomal protein S10 [Borrelia burgdorferi 118a]
 gi|225370725|gb|EEH00161.1| ribosomal protein S10 [Borrelia burgdorferi 94a]
 gi|225370905|gb|EEH00335.1| ribosomal protein S10 [Borrelia sp. SV1]
 gi|226232976|gb|EEH31729.1| ribosomal protein S10 [Borrelia burgdorferi Bol26]
 gi|226233519|gb|EEH32258.1| ribosomal protein S10 [Borrelia burgdorferi 29805]
 gi|312148275|gb|ADQ30934.1| ribosomal protein S10 [Borrelia burgdorferi JD1]
 gi|312149054|gb|ADQ29125.1| ribosomal protein S10 [Borrelia burgdorferi N40]
          Length = 103

 Score =  104 bits (259), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 51/97 (52%), Positives = 71/97 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + L +FD +ILD S   IV   +K+ +QI GPIP P  I+++TV RSPHV+KKSR+Q
Sbjct: 6   KIRVRLFSFDVKILDQSAESIVKAVQKAKAQIKGPIPLPTKIKKYTVLRSPHVNKKSREQ 65

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            EMR +KRL+ I++PT   +D+LMKL++ AGV V IK
Sbjct: 66  FEMRTHKRLIDILEPTSALMDSLMKLELPAGVEVDIK 102


>gi|153952860|ref|YP_001393625.1| 30S ribosomal protein S10 [Clostridium kluyveri DSM 555]
 gi|219853525|ref|YP_002470647.1| hypothetical protein CKR_0182 [Clostridium kluyveri NBRC 12016]
 gi|300857247|ref|YP_003782231.1| 30S ribosomal protein S10 [Clostridium ljungdahlii DSM 13528]
 gi|189040367|sp|A5N4P6|RS10_CLOK5 RecName: Full=30S ribosomal protein S10
 gi|254809595|sp|B9DYA8|RS10_CLOK1 RecName: Full=30S ribosomal protein S10
 gi|146345741|gb|EDK32277.1| RpsJ [Clostridium kluyveri DSM 555]
 gi|219567249|dbj|BAH05233.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
 gi|300437362|gb|ADK17129.1| 30S ribosomal protein S10 [Clostridium ljungdahlii DSM 13528]
          Length = 102

 Score =  104 bits (259), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD  ILD S  +IV T K +G+++ GP+P P      T+ R+PH  K SR+Q
Sbjct: 5   KIRIRLKAFDHTILDQSSEKIVETAKSTGAKVAGPVPLPTEKDVVTILRAPHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRL+ II P+P+TVDALM+LD+ AGV++ IKL
Sbjct: 65  FEIRTHKRLIDIISPSPKTVDALMRLDLPAGVDIEIKL 102


>gi|152964656|ref|YP_001360440.1| 30S ribosomal protein S10 [Kineococcus radiotolerans SRS30216]
 gi|189040376|sp|A6W5T7|RS10_KINRD RecName: Full=30S ribosomal protein S10
 gi|151359173|gb|ABS02176.1| ribosomal protein S10 [Kineococcus radiotolerans SRS30216]
          Length = 102

 Score =  104 bits (259), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 72/104 (69%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LKA+D  ++DSS R+IV T  ++G+ + GP+P P     + V RSPH  
Sbjct: 1   MAGQKIRIR--LKAYDHEVIDSSARKIVDTVTRTGASVAGPVPLPTEKNVYCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+  EMR +KRL+ II PTP+TVD+LM+LD+ AGV++ IKL
Sbjct: 59  KDSREHFEMRTHKRLIDIIDPTPKTVDSLMRLDLPAGVDIEIKL 102


>gi|269128517|ref|YP_003301887.1| 30S ribosomal protein S10 [Thermomonospora curvata DSM 43183]
 gi|268313475|gb|ACY99849.1| ribosomal protein S10 [Thermomonospora curvata DSM 43183]
          Length = 102

 Score =  104 bits (259), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 73/104 (70%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LKA+D  ++DSS ++IV T  ++G+++ GP+P P     + V RSPH  
Sbjct: 1   MAGQKIRIR--LKAYDHEVIDSSAKKIVETVTRTGAKVAGPVPLPTEKNVYCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+  EMR +KRL+ II PTP+TVD+LM+LD+ AGV++ IKL
Sbjct: 59  KDSREHFEMRTHKRLIDIIDPTPKTVDSLMRLDLPAGVDIEIKL 102


>gi|322386355|ref|ZP_08059985.1| 30S ribosomal protein S10 [Streptococcus cristatus ATCC 51100]
 gi|321269579|gb|EFX52509.1| 30S ribosomal protein S10 [Streptococcus cristatus ATCC 51100]
          Length = 102

 Score =  104 bits (259), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 71/100 (71%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA++ R LD++  +IV T  ++G+++ GPIP P     +T+ R+ H  K SR
Sbjct: 3   NKKIRIRLKAYEHRTLDTAAAKIVETAARTGAEVAGPIPLPTERSLYTIIRATHKYKDSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KRL+ II PT +TVDALMKLD+ +GVNV IKL
Sbjct: 63  EQFEMRTHKRLIDIINPTQKTVDALMKLDLPSGVNVEIKL 102


>gi|167342362|gb|ABZ69138.1| 30S ribosomal protein S10 [Borrelia burgdorferi]
          Length = 100

 Score =  104 bits (259), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 51/97 (52%), Positives = 71/97 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + L +FD +ILD S   IV   +K+ +QI GPIP P  I+++TV RSPHV+KKSR+Q
Sbjct: 2   KIRVRLFSFDVKILDQSAESIVKAVQKAKAQIKGPIPLPTKIKKYTVLRSPHVNKKSREQ 61

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            EMR +KRL+ I++PT   +D+LMKL++ AGV V IK
Sbjct: 62  FEMRTHKRLIDILEPTSALMDSLMKLELPAGVEVDIK 98


>gi|167342352|gb|ABZ69133.1| 30S ribosomal protein S10 [Borrelia afzelii]
          Length = 99

 Score =  104 bits (259), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 51/97 (52%), Positives = 71/97 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + L +FD +ILD S   IV   +K+ +QI GPIP P  I+++TV RSPHV+KKSR+Q
Sbjct: 2   KIRVRLFSFDVKILDQSAESIVKAVQKAKAQIKGPIPLPTKIKKYTVLRSPHVNKKSREQ 61

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            EMR +KRL+ I++PT   +D+LMKL++ AGV V IK
Sbjct: 62  FEMRTHKRLIDILEPTSALMDSLMKLELPAGVEVDIK 98


>gi|258646054|ref|ZP_05733523.1| ribosomal protein S10 [Dialister invisus DSM 15470]
 gi|260403424|gb|EEW96971.1| ribosomal protein S10 [Dialister invisus DSM 15470]
          Length = 103

 Score =  104 bits (259), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 73/102 (71%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           S+  +I I LK +D + +D S  +IV T K++GS + GPIP P     +T+ RSPHV+K 
Sbjct: 2   SKQEKIRIRLKGYDHKAIDQSAAKIVETAKRTGSTVSGPIPLPTEKNVYTILRSPHVNKD 61

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           SR+Q EMRI+KRL+ I+ P+ +T DALM+L++ AGV++ IK+
Sbjct: 62  SREQFEMRIHKRLIDILDPSKKTADALMRLELPAGVSIEIKV 103


>gi|125716984|ref|YP_001034117.1| 30S ribosomal protein S10 [Streptococcus sanguinis SK36]
 gi|157150655|ref|YP_001451236.1| 30S ribosomal protein S10 [Streptococcus gordonii str. Challis
           substr. CH1]
 gi|262283584|ref|ZP_06061349.1| 30S ribosomal protein S10 [Streptococcus sp. 2_1_36FAA]
 gi|315222822|ref|ZP_07864708.1| ribosomal protein S10 [Streptococcus anginosus F0211]
 gi|319940061|ref|ZP_08014415.1| 30S ribosomal protein S10 [Streptococcus anginosus 1_2_62CV]
 gi|323350939|ref|ZP_08086597.1| 30S ribosomal protein S10 [Streptococcus sanguinis VMC66]
 gi|166231788|sp|A3CK62|RS10_STRSV RecName: Full=30S ribosomal protein S10
 gi|189040397|sp|A8AZM6|RS10_STRGC RecName: Full=30S ribosomal protein S10
 gi|125496901|gb|ABN43567.1| 30S ribosomal protein S10, putative [Streptococcus sanguinis SK36]
 gi|157075449|gb|ABV10132.1| ribosomal protein S10 [Streptococcus gordonii str. Challis substr.
           CH1]
 gi|262260641|gb|EEY79342.1| 30S ribosomal protein S10 [Streptococcus sp. 2_1_36FAA]
 gi|315188125|gb|EFU21854.1| ribosomal protein S10 [Streptococcus anginosus F0211]
 gi|319810775|gb|EFW07102.1| 30S ribosomal protein S10 [Streptococcus anginosus 1_2_62CV]
 gi|322122921|gb|EFX94627.1| 30S ribosomal protein S10 [Streptococcus sanguinis VMC66]
 gi|324991814|gb|EGC23739.1| 30S ribosomal protein S10 [Streptococcus sanguinis SK405]
 gi|324996296|gb|EGC28204.1| 30S ribosomal protein S10 [Streptococcus sanguinis SK678]
 gi|325686404|gb|EGD28434.1| 30S ribosomal protein S10 [Streptococcus sanguinis SK72]
 gi|325689232|gb|EGD31238.1| 30S ribosomal protein S10 [Streptococcus sanguinis SK115]
 gi|325695811|gb|EGD37708.1| 30S ribosomal protein S10 [Streptococcus sanguinis SK150]
 gi|325697975|gb|EGD39858.1| 30S ribosomal protein S10 [Streptococcus sanguinis SK160]
 gi|327458430|gb|EGF04786.1| 30S ribosomal protein S10 [Streptococcus sanguinis SK1]
 gi|327463724|gb|EGF10040.1| 30S ribosomal protein S10 [Streptococcus sanguinis SK1057]
 gi|327471743|gb|EGF17184.1| 30S ribosomal protein S10 [Streptococcus sanguinis SK408]
 gi|327490464|gb|EGF22246.1| 30S ribosomal protein S10 [Streptococcus sanguinis SK1058]
 gi|328945218|gb|EGG39372.1| 30S ribosomal protein S10 [Streptococcus sanguinis SK1087]
          Length = 102

 Score =  104 bits (259), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 71/100 (71%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA++ R LD++  +IV T  ++G+++ GPIP P     +T+ R+ H  K SR
Sbjct: 3   NKKIRIRLKAYEHRTLDTAAAKIVETATRTGAEVAGPIPLPTERSLYTIIRATHKYKDSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KRL+ II PT +TVDALMKLD+ +GVNV IKL
Sbjct: 63  EQFEMRTHKRLIDIINPTQKTVDALMKLDLPSGVNVEIKL 102


>gi|271962631|ref|YP_003336827.1| 30S ribosomal protein S10 [Streptosporangium roseum DSM 43021]
 gi|270505806|gb|ACZ84084.1| 30S ribosomal protein S10 [Streptosporangium roseum DSM 43021]
          Length = 102

 Score =  104 bits (259), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 73/104 (70%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LKA+D  ++DSS ++IV T  ++G+++ GP+P P     + V RSPH  
Sbjct: 1   MAGQKIRIR--LKAYDHEVIDSSAKKIVETVTRTGAKVAGPVPLPTEKNVYCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+  EMR +KRL+ II PTP+TVD+LM+LD+ AGV++ IKL
Sbjct: 59  KDSREHFEMRTHKRLIDIIDPTPKTVDSLMRLDLPAGVDISIKL 102


>gi|167342340|gb|ABZ69127.1| 30S ribosomal protein S10 [Borrelia burgdorferi]
 gi|167342344|gb|ABZ69129.1| 30S ribosomal protein S10 [Borrelia afzelii ACA-1]
 gi|167342348|gb|ABZ69131.1| 30S ribosomal protein S10 [Borrelia burgdorferi]
          Length = 99

 Score =  104 bits (259), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 51/97 (52%), Positives = 71/97 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + L +FD +ILD S   IV   +K+ +QI GPIP P  I+++TV RSPHV+KKSR+Q
Sbjct: 2   KIRVRLFSFDVKILDQSAESIVKAVQKAKAQIKGPIPLPTKIKKYTVLRSPHVNKKSREQ 61

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            EMR +KRL+ I++PT   +D+LMKL++ AGV V IK
Sbjct: 62  FEMRTHKRLIDILEPTSALMDSLMKLELPAGVEVDIK 98


>gi|1350917|sp|P48851|RS10_NEIGO RecName: Full=30S ribosomal protein S10
 gi|790860|gb|AAB41518.1| RpsJ [Neisseria gonorrhoeae]
          Length = 103

 Score =  104 bits (259), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 72/98 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D  ++D S +EIV T K++G+ + GPIP P  I RF + RSPH++K SR+Q
Sbjct: 5   KIRIRLKAYDYALIDRSAQEIVETAKRTGAVVKGPIPLPTKIERFNILRSPHMNKTSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           LE+R + RL+ I+  T +T DALMKLD+ AGV+V IK+
Sbjct: 65  LEIRTHLRLMDIVDWTDKTTDALMKLDLPAGVDVEIKV 102


>gi|319938508|ref|ZP_08012902.1| 30S ribosomal protein S10 [Coprobacillus sp. 29_1]
 gi|319806424|gb|EFW03091.1| 30S ribosomal protein S10 [Coprobacillus sp. 29_1]
          Length = 102

 Score =  104 bits (259), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 72/100 (72%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LK+FD +ILD+S  +IV   KKSG+Q+VGP+P P     +T+ R+ H  K SR
Sbjct: 3   NNKIRIRLKSFDHKILDASAEKIVAAAKKSGAQVVGPVPLPTEKEVYTILRAVHKYKDSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q E+R +KRL+ I+ PTP+TVD L +L++ +GV++ IKL
Sbjct: 63  EQFEIRTHKRLIDIVNPTPETVDVLTRLELPSGVDIEIKL 102


>gi|167342338|gb|ABZ69126.1| 30S ribosomal protein S10 [Borrelia valaisiana]
          Length = 98

 Score =  103 bits (258), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 51/97 (52%), Positives = 71/97 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + L +FD +ILD S   IV   +K+ +QI GPIP P  I+++TV RSPHV+KKSR+Q
Sbjct: 2   KIRVRLFSFDVKILDQSAESIVKAVQKAKAQIKGPIPLPTKIKKYTVLRSPHVNKKSREQ 61

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            EMR +KRL+ I++PT   +D+LMKL++ AGV V IK
Sbjct: 62  FEMRTHKRLIDILEPTSALMDSLMKLELPAGVEVDIK 98


>gi|297625781|ref|YP_003687544.1| 30S ribosomal protein S10 [Propionibacterium freudenreichii subsp.
           shermanii CIRM-BIA1]
 gi|296921546|emb|CBL56100.1| 30S ribosomal protein S10 [Propionibacterium freudenreichii subsp.
           shermanii CIRM-BIA1]
          Length = 103

 Score =  103 bits (258), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 74/104 (71%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   L+A+D  ++DSS R+IV T  ++G+++ GP+P P     + V RSPH  
Sbjct: 1   MAGQKIRIR--LRAYDHEVIDSSARKIVDTVTRTGAKVAGPVPLPTEKNVWCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+Q EMR +KRL+ I+ PTP+TVD+LM+LD+ AGV++ IKL
Sbjct: 59  KDSREQFEMRTHKRLIDILDPTPKTVDSLMRLDLPAGVDIEIKL 102


>gi|256390139|ref|YP_003111703.1| 30S ribosomal protein S10 [Catenulispora acidiphila DSM 44928]
 gi|256356365|gb|ACU69862.1| ribosomal protein S10 [Catenulispora acidiphila DSM 44928]
 gi|311896571|dbj|BAJ28979.1| putative ribosomal protein S10 [Kitasatospora setae KM-6054]
          Length = 102

 Score =  103 bits (258), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 73/104 (70%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LKA+D  ++DSS ++IV T  ++G+Q+ GP+P P     + V RSPH  
Sbjct: 1   MAGQKIRIR--LKAYDHEVIDSSAKKIVETVIRTGAQVAGPVPLPTEKNVYCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+  EMR +KRL+ I+ PTP+TVD+LM+LD+ AGV++ IKL
Sbjct: 59  KDSREHFEMRTHKRLIDILDPTPKTVDSLMRLDLPAGVDIEIKL 102


>gi|313606519|gb|EFR83350.1| ribosomal protein S10 [Listeria monocytogenes FSL F2-208]
          Length = 92

 Score =  103 bits (258), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 67/92 (72%)

Query: 13  KAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQLEMRIY 72
           KA+D RILD S  +IV T K+SG+ + GPIP P     +TV R+ H  K SR+Q EMR +
Sbjct: 1   KAYDHRILDQSAEKIVETAKRSGASVSGPIPLPTEKSIYTVLRAVHKYKDSREQFEMRTH 60

Query: 73  KRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KRL+ I+ PTPQTVD+LM+LD+ +GV++ IKL
Sbjct: 61  KRLIDIVNPTPQTVDSLMRLDLPSGVDIEIKL 92


>gi|297748566|gb|ADI51112.1| SSU ribosomal protein S10P [Chlamydia trachomatis D-EC]
 gi|297749446|gb|ADI52124.1| SSU ribosomal protein S10P [Chlamydia trachomatis D-LC]
          Length = 112

 Score =  103 bits (258), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 70/103 (67%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +  RI I LK FD   LD S   IV T K++G+++VGPIP P     +TV RSPHVD
Sbjct: 8   MKQQKQRIRIRLKGFDQGQLDQSTANIVETAKRTGARVVGPIPLPTKREVYTVLRSPHVD 67

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           KKSR+Q E+R +KRL+ I+ PT +T+DAL  L + AGV++ IK
Sbjct: 68  KKSREQFEIRTHKRLIDILDPTGKTIDALKMLSLPAGVDIKIK 110


>gi|32266876|ref|NP_860908.1| 30S ribosomal protein S10 [Helicobacter hepaticus ATCC 51449]
 gi|44888422|sp|Q7VGE5|RS10_HELHP RecName: Full=30S ribosomal protein S10
 gi|32262928|gb|AAP77974.1| ribosomal protein S10 [Helicobacter hepaticus ATCC 51449]
          Length = 103

 Score =  103 bits (258), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 71/96 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI + LKA+D R+LD S+  IV   K++GS+I GP+P P   +R+TV RSPH++K SR+Q
Sbjct: 3   RIRLRLKAYDHRVLDRSVASIVEAVKRTGSEIRGPVPLPTKKKRYTVLRSPHINKDSREQ 62

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVI 102
            E+R++ R++ I+  TP TVD+LMKLD+A  V+V +
Sbjct: 63  FEIRVHHRIIDIMSATPDTVDSLMKLDLAPEVDVEV 98


>gi|296875405|ref|ZP_06899479.1| 30S ribosomal protein S10 [Streptococcus parasanguinis ATCC 15912]
 gi|312866992|ref|ZP_07727203.1| ribosomal protein S10 [Streptococcus parasanguinis F0405]
 gi|319945836|ref|ZP_08020086.1| 30S ribosomal protein S10 [Streptococcus australis ATCC 700641]
 gi|322390659|ref|ZP_08064173.1| 30S ribosomal protein S10 [Streptococcus parasanguinis ATCC 903]
 gi|296433598|gb|EFH19371.1| 30S ribosomal protein S10 [Streptococcus parasanguinis ATCC 15912]
 gi|311097474|gb|EFQ55707.1| ribosomal protein S10 [Streptococcus parasanguinis F0405]
 gi|319747901|gb|EFW00145.1| 30S ribosomal protein S10 [Streptococcus australis ATCC 700641]
 gi|321142632|gb|EFX38096.1| 30S ribosomal protein S10 [Streptococcus parasanguinis ATCC 903]
          Length = 102

 Score =  103 bits (258), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 71/100 (71%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA++ R LD++  +IV +  ++G+Q+ GPIP P     +T+ R+ H  K SR
Sbjct: 3   NKKIRIRLKAYEHRTLDTAAAKIVESATRTGAQVAGPIPLPTERSLYTIIRATHKYKDSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KRL+ II PT +TVDALMKLD+ +GVNV IKL
Sbjct: 63  EQFEMRTHKRLIDIINPTQKTVDALMKLDLPSGVNVEIKL 102


>gi|182626937|ref|ZP_02954670.1| ribosomal protein S10 [Clostridium perfringens D str. JGS1721]
 gi|177907727|gb|EDT70342.1| ribosomal protein S10 [Clostridium perfringens D str. JGS1721]
          Length = 102

 Score =  103 bits (258), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 74/104 (71%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M+ + IRI   LKAFD  ILD S  +IV T K +G+++VGP+P P      T+ R+ H D
Sbjct: 1   MSKQKIRIR--LKAFDHTILDQSAEKIVETAKSTGAKVVGPVPLPTEKDVITILRAVHKD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+Q E+R +KRL+ I+ P+P+TVDALM+L++ AGV++ IKL
Sbjct: 59  KDSREQFEVRTHKRLIDIVNPSPKTVDALMRLNLPAGVDIEIKL 102


>gi|229821624|ref|YP_002883150.1| ribosomal protein S10 [Beutenbergia cavernae DSM 12333]
 gi|259494583|sp|C5C0J2|RS10_BEUC1 RecName: Full=30S ribosomal protein S10
 gi|229567537|gb|ACQ81388.1| ribosomal protein S10 [Beutenbergia cavernae DSM 12333]
          Length = 102

 Score =  103 bits (258), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 53/104 (50%), Positives = 71/104 (68%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LK++D  ++DSS R+IV T  ++G+ +VGP+P P     F V RSPH  
Sbjct: 1   MAGQKIRIR--LKSYDHEVIDSSARKIVDTVTRAGATVVGPVPLPTEKNVFCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SRD  EMR +KRL+ II PTP+ VD+LM+LD+ A VN+ IKL
Sbjct: 59  KDSRDHFEMRTHKRLIDIIDPTPKAVDSLMRLDLPADVNIEIKL 102


>gi|15605163|ref|NP_219948.1| 30S ribosomal protein S10 [Chlamydia trachomatis D/UW-3/CX]
 gi|15835335|ref|NP_297094.1| 30S ribosomal protein S10 [Chlamydia muridarum Nigg]
 gi|76789170|ref|YP_328256.1| 30S ribosomal protein S10 [Chlamydia trachomatis A/HAR-13]
 gi|166154649|ref|YP_001654767.1| 30S ribosomal protein S10 [Chlamydia trachomatis 434/Bu]
 gi|166155524|ref|YP_001653779.1| 30S ribosomal protein S10 [Chlamydia trachomatis
           L2b/UCH-1/proctitis]
 gi|255311245|ref|ZP_05353815.1| 30S ribosomal protein S10 [Chlamydia trachomatis 6276]
 gi|255317547|ref|ZP_05358793.1| 30S ribosomal protein S10 [Chlamydia trachomatis 6276s]
 gi|255348804|ref|ZP_05380811.1| 30S ribosomal protein S10 [Chlamydia trachomatis 70]
 gi|255503344|ref|ZP_05381734.1| 30S ribosomal protein S10 [Chlamydia trachomatis 70s]
 gi|255507023|ref|ZP_05382662.1| 30S ribosomal protein S10 [Chlamydia trachomatis D(s)2923]
 gi|270285506|ref|ZP_06194900.1| 30S ribosomal protein S10 [Chlamydia muridarum Nigg]
 gi|270289517|ref|ZP_06195819.1| 30S ribosomal protein S10 [Chlamydia muridarum Weiss]
 gi|301335917|ref|ZP_07224161.1| 30S ribosomal protein S10 [Chlamydia trachomatis L2tet1]
 gi|301336903|ref|ZP_07225105.1| 30S ribosomal protein S10 [Chlamydia muridarum MopnTet14]
 gi|61236786|sp|P0A4A2|RS10_CHLMU RecName: Full=30S ribosomal protein S10
 gi|115305615|sp|Q3KLR4|RS10_CHLTA RecName: Full=30S ribosomal protein S10
 gi|226705420|sp|B0B808|RS10_CHLT2 RecName: Full=30S ribosomal protein S10
 gi|226705422|sp|B0BC73|RS10_CHLTB RecName: Full=30S ribosomal protein S10
 gi|290463294|sp|P0CE02|RS10_CHLTR RecName: Full=30S ribosomal protein S10
 gi|3328867|gb|AAC68035.1| S10 Ribosomal Protein [Chlamydia trachomatis D/UW-3/CX]
 gi|7190749|gb|AAF39531.1| ribosomal protein S10 [Chlamydia muridarum Nigg]
 gi|76167700|gb|AAX50708.1| SSU ribosomal protein S10P [Chlamydia trachomatis A/HAR-13]
 gi|165930637|emb|CAP04134.1| SSU ribosomal protein S10P [Chlamydia trachomatis 434/Bu]
 gi|165931512|emb|CAP07088.1| SSU ribosomal protein S10P [Chlamydia trachomatis
           L2b/UCH-1/proctitis]
 gi|289525480|emb|CBJ14957.1| SSU ribosomal protein S10P [Chlamydia trachomatis Sweden2]
 gi|296435033|gb|ADH17211.1| 30S ribosomal protein S10 [Chlamydia trachomatis E/150]
 gi|296435960|gb|ADH18134.1| 30S ribosomal protein S10 [Chlamydia trachomatis G/9768]
 gi|296436887|gb|ADH19057.1| 30S ribosomal protein S10 [Chlamydia trachomatis G/11222]
 gi|296437821|gb|ADH19982.1| 30S ribosomal protein S10 [Chlamydia trachomatis G/11074]
 gi|296438753|gb|ADH20906.1| 30S ribosomal protein S10 [Chlamydia trachomatis E/11023]
 gi|297140321|gb|ADH97079.1| 30S ribosomal protein S10 [Chlamydia trachomatis G/9301]
          Length = 105

 Score =  103 bits (258), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 70/103 (67%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +  RI I LK FD   LD S   IV T K++G+++VGPIP P     +TV RSPHVD
Sbjct: 1   MKQQKQRIRIRLKGFDQGQLDQSTANIVETAKRTGARVVGPIPLPTKREVYTVLRSPHVD 60

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           KKSR+Q E+R +KRL+ I+ PT +T+DAL  L + AGV++ IK
Sbjct: 61  KKSREQFEIRTHKRLIDILDPTGKTIDALKMLSLPAGVDIKIK 103


>gi|282857363|ref|ZP_06266600.1| ribosomal protein S10 [Pyramidobacter piscolens W5455]
 gi|282584863|gb|EFB90194.1| ribosomal protein S10 [Pyramidobacter piscolens W5455]
          Length = 101

 Score =  103 bits (258), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 47/98 (47%), Positives = 72/98 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD R+LD+S  +I  T  +SG+++ GPIP P  I +F +  SPHV+K +R+ 
Sbjct: 4   KIRIRLKAFDHRVLDTSAAQIAETAARSGAKVAGPIPLPTEINKFCILTSPHVNKDAREH 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PT +T++ALM+L++ +GV++ IKL
Sbjct: 64  YEMRTHKRLIDILDPTQKTMEALMQLNLPSGVDIQIKL 101


>gi|154507865|ref|ZP_02043507.1| hypothetical protein ACTODO_00347 [Actinomyces odontolyticus ATCC
           17982]
 gi|293190260|ref|ZP_06608756.1| ribosomal protein S10 [Actinomyces odontolyticus F0309]
 gi|315605898|ref|ZP_07880929.1| 30S ribosomal protein S10 [Actinomyces sp. oral taxon 180 str.
           F0310]
 gi|153797499|gb|EDN79919.1| hypothetical protein ACTODO_00347 [Actinomyces odontolyticus ATCC
           17982]
 gi|292821076|gb|EFF80029.1| ribosomal protein S10 [Actinomyces odontolyticus F0309]
 gi|315312180|gb|EFU60266.1| 30S ribosomal protein S10 [Actinomyces sp. oral taxon 180 str.
           F0310]
          Length = 102

 Score =  103 bits (258), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++DSS R+IV T +++G+ +VGP+P P     F V RSPH  K SR+ 
Sbjct: 5   KIRIRLKSYDHEVIDSSARKIVDTVQRAGATVVGPVPLPTEKNVFVVIRSPHKYKDSREH 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ II PTP+ VD+LM+LD+ A VN+ IKL
Sbjct: 65  FEMRTHKRLIDIIDPTPKAVDSLMRLDLPADVNIEIKL 102


>gi|156743949|ref|YP_001434078.1| 30S ribosomal protein S10 [Roseiflexus castenholzii DSM 13941]
 gi|189040386|sp|A7NR64|RS10_ROSCS RecName: Full=30S ribosomal protein S10
 gi|156235277|gb|ABU60060.1| ribosomal protein S10 [Roseiflexus castenholzii DSM 13941]
          Length = 102

 Score =  103 bits (258), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 45/98 (45%), Positives = 74/98 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           ++ I LKA+D +ILD S R+IV   +++G+ + GP+P P  I +++V RSP +DK S++Q
Sbjct: 5   KVRIRLKAYDHKILDQSARQIVEAAERTGALVAGPVPLPTKIEKYSVIRSPFIDKDSQEQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRL+ ++ P+ QT++ALMKL++ AGV++ IKL
Sbjct: 65  FEIRTHKRLIDVLDPSQQTINALMKLNLPAGVDIEIKL 102


>gi|224542237|ref|ZP_03682776.1| hypothetical protein CATMIT_01412 [Catenibacterium mitsuokai DSM
           15897]
 gi|224524779|gb|EEF93884.1| hypothetical protein CATMIT_01412 [Catenibacterium mitsuokai DSM
           15897]
          Length = 102

 Score =  103 bits (258), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 72/100 (72%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LK+FD +ILD+S  +IV   KKSG+Q+VGP+P P     +T+ R+ H  K SR
Sbjct: 3   NNKIRIRLKSFDHKILDASAEKIVAAAKKSGAQVVGPVPLPTEKEIYTILRAVHKYKDSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q E+R +KRL+ ++ PTP+TVD L +L++ +GV++ IKL
Sbjct: 63  EQFEIRTHKRLIDVVNPTPETVDVLTRLEVPSGVDIEIKL 102


>gi|241895188|ref|ZP_04782484.1| ribosomal protein S10 [Weissella paramesenteroides ATCC 33313]
 gi|241871494|gb|EER75245.1| ribosomal protein S10 [Weissella paramesenteroides ATCC 33313]
          Length = 110

 Score =  103 bits (258), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 73/100 (73%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA++ +ILDSS  +IV T K++G++I GPIP P     +TV  SPH  K +R
Sbjct: 11  NKKIRIRLKAYEHKILDSSAEKIVETAKRTGAEISGPIPLPTERTIYTVLSSPHKHKDAR 70

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q E+R +KRL+ I+KPT +TVDAL KL++ +GV++ IKL
Sbjct: 71  EQFELRTHKRLIDIMKPTAKTVDALSKLELPSGVDIEIKL 110


>gi|119718126|ref|YP_925091.1| 30S ribosomal protein S10 [Nocardioides sp. JS614]
 gi|326332190|ref|ZP_08198470.1| ribosomal protein S10 [Nocardioidaceae bacterium Broad-1]
 gi|166231302|sp|A1SNL9|RS10_NOCSJ RecName: Full=30S ribosomal protein S10
 gi|119538787|gb|ABL83404.1| SSU ribosomal protein S10P [Nocardioides sp. JS614]
 gi|325949896|gb|EGD41956.1| ribosomal protein S10 [Nocardioidaceae bacterium Broad-1]
          Length = 102

 Score =  103 bits (258), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 73/104 (70%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LKA+D  ++D+S R+IV T  ++G+++ GP+P P     + V RSPH  
Sbjct: 1   MAGQKIRIR--LKAYDHEVIDTSARKIVDTVTRTGAKVAGPVPLPTEKNVYCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+  EMR +KRL+ II PTP+TVD+LM+LD+ AGV++ IKL
Sbjct: 59  KDSREHFEMRTHKRLIDIIDPTPKTVDSLMRLDLPAGVDIEIKL 102


>gi|251812046|ref|ZP_04826519.1| 30S ribosomal protein S10 [Staphylococcus epidermidis BCM-HMP0060]
 gi|282875341|ref|ZP_06284214.1| ribosomal protein S10 [Staphylococcus epidermidis SK135]
 gi|251804380|gb|EES57037.1| 30S ribosomal protein S10 [Staphylococcus epidermidis BCM-HMP0060]
 gi|281296106|gb|EFA88627.1| ribosomal protein S10 [Staphylococcus epidermidis SK135]
 gi|329736511|gb|EGG72779.1| ribosomal protein S10 [Staphylococcus epidermidis VCU028]
          Length = 102

 Score =  103 bits (258), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D R++D S  +IV T K+SG+ + GPIP P     +T+ R+ H DK SR+Q
Sbjct: 5   KIRIRLKAYDHRVIDQSAEKIVETAKRSGADVSGPIPLPTEKSVYTIIRAVHKDKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R +KRL+ I+ PTP+TVDALM L++ +GV++ IKL
Sbjct: 65  FEQRTHKRLIDIVNPTPKTVDALMGLNLPSGVDIEIKL 102


>gi|288904272|ref|YP_003429493.1| ribosomal protein S10 [Streptococcus gallolyticus UCN34]
 gi|306830301|ref|ZP_07463472.1| 30S ribosomal protein S10 [Streptococcus gallolyticus subsp.
           gallolyticus TX20005]
 gi|325977251|ref|YP_004286967.1| 30S ribosomal protein S10 [Streptococcus gallolyticus subsp.
           gallolyticus ATCC BAA-2069]
 gi|288730997|emb|CBI12541.1| ribosomal protein S10 [Streptococcus gallolyticus UCN34]
 gi|304427548|gb|EFM30649.1| 30S ribosomal protein S10 [Streptococcus gallolyticus subsp.
           gallolyticus TX20005]
 gi|325177179|emb|CBZ47223.1| 30S ribosomal protein S10 [Streptococcus gallolyticus subsp.
           gallolyticus ATCC BAA-2069]
          Length = 102

 Score =  103 bits (257), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 70/100 (70%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA++ R LD++  +IV T  ++G+ + GP+P P     +TV R+ H  K SR
Sbjct: 3   NKKIRIRLKAYEHRTLDTAAEKIVETATRTGATVAGPVPLPTERSLYTVIRATHKYKDSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KRL+ II PT +TVDALMKLD+ +GVNV IKL
Sbjct: 63  EQFEMRTHKRLIDIINPTQKTVDALMKLDLPSGVNVEIKL 102


>gi|154148252|ref|YP_001405696.1| 30S ribosomal protein S10 [Campylobacter hominis ATCC BAA-381]
 gi|166231255|sp|A7HZK5|RS10_CAMHC RecName: Full=30S ribosomal protein S10
 gi|153804261|gb|ABS51268.1| ribosomal protein S10 [Campylobacter hominis ATCC BAA-381]
          Length = 103

 Score =  103 bits (257), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 72/97 (74%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + LKA+D R+LD ++  IV   K++G+ + GP+P P  ++R+TV +SPH++K SR+Q
Sbjct: 3   KIRLKLKAYDHRVLDRTVAAIVEAVKRTGADVRGPVPMPTKVKRYTVLKSPHINKDSREQ 62

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            EM+I+ R+L I+  TP+TVD+L KLD+A  VNV ++
Sbjct: 63  FEMKIHGRMLDIVAATPETVDSLTKLDLAPEVNVEVR 99


>gi|237751237|ref|ZP_04581717.1| ribosomal protein S10 [Helicobacter bilis ATCC 43879]
 gi|229372603|gb|EEO22994.1| ribosomal protein S10 [Helicobacter bilis ATCC 43879]
          Length = 103

 Score =  103 bits (257), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 72/96 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + LKA+D R+LD S+  IV   K++GS+I+GP+P P   RR+TV RSPH++K SR+Q
Sbjct: 3   KIRLKLKAYDHRVLDRSIAAIVSAVKRTGSEIIGPVPLPTRKRRYTVLRSPHINKDSREQ 62

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVI 102
            E+RI+ R++ I+  T +TVD+LMKLD+A  V+V +
Sbjct: 63  FEIRIHSRIIDIMSATGETVDSLMKLDLAPEVDVEV 98


>gi|157737002|ref|YP_001489685.1| 30S ribosomal protein S10 [Arcobacter butzleri RM4018]
 gi|315636194|ref|ZP_07891448.1| 30S ribosomal protein S10 [Arcobacter butzleri JV22]
 gi|166991564|sp|A8ESU2|RS10_ARCB4 RecName: Full=30S ribosomal protein S10
 gi|157698856|gb|ABV67016.1| 30S ribosomal protein S10 [Arcobacter butzleri RM4018]
 gi|315479555|gb|EFU70234.1| 30S ribosomal protein S10 [Arcobacter butzleri JV22]
          Length = 104

 Score =  103 bits (257), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 72/97 (74%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + LKA+D R+LD S+  IV   K++G+ + GPIP P  IRR+TV + PHV+K SR+Q
Sbjct: 3   KIRLKLKAYDHRVLDRSVASIVEAVKRTGADLRGPIPLPTKIRRYTVIKGPHVNKDSREQ 62

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E+R++ R++ II  TP+TVD+LMKLD+A  V+V ++
Sbjct: 63  FEIRVHSRIIDIIVATPETVDSLMKLDLAPEVDVEVR 99


>gi|78776486|ref|YP_392801.1| 30S ribosomal protein S10 [Sulfurimonas denitrificans DSM 1251]
 gi|118597338|sp|Q30TW5|RS10_SULDN RecName: Full=30S ribosomal protein S10
 gi|78497026|gb|ABB43566.1| SSU ribosomal protein S10P [Sulfurimonas denitrificans DSM 1251]
          Length = 103

 Score =  103 bits (257), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 73/97 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + LKA+D R+LD S+  IV   K++G+ I GPIP P  IR++TV +SPHV+K SR+Q
Sbjct: 3   KIRLKLKAYDHRVLDRSVASIVEAVKRTGAVIRGPIPLPTKIRKYTVIKSPHVNKSSREQ 62

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E+R++ R++ I+  TP+TVD+LMKLD+A  V+V ++
Sbjct: 63  FEIRMHARVIDIVSATPETVDSLMKLDLAPEVDVEVR 99


>gi|146317730|ref|YP_001197442.1| ribosomal protein S10 [Streptococcus suis 05ZYH33]
 gi|145688536|gb|ABP89042.1| ribosomal protein S10 [Streptococcus suis 05ZYH33]
          Length = 176

 Score =  103 bits (257), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 71/100 (71%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA++ R LD++  +IV T  ++G+Q+ GP+P P     +T+ R+ H  K SR
Sbjct: 77  NKKIRIRLKAYEHRTLDTAAAKIVETATRTGAQVAGPVPLPTERSFYTIIRATHKYKDSR 136

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KRL+ II PT +TVDALMKLD+ +GVNV IKL
Sbjct: 137 EQFEMRTHKRLIDIINPTQKTVDALMKLDLPSGVNVEIKL 176


>gi|94987674|ref|YP_595775.1| 30S ribosomal protein S10 [Streptococcus pyogenes MGAS9429]
 gi|94991543|ref|YP_599642.1| 30S ribosomal protein S10 [Streptococcus pyogenes MGAS2096]
 gi|118597326|sp|Q1JE60|RS10_STRPB RecName: Full=30S ribosomal protein S10
 gi|118597327|sp|Q1JP18|RS10_STRPC RecName: Full=30S ribosomal protein S10
 gi|94541182|gb|ABF31231.1| SSU ribosomal protein S10P [Streptococcus pyogenes MGAS9429]
 gi|94545051|gb|ABF35098.1| SSU ribosomal protein S10P [Streptococcus pyogenes MGAS2096]
          Length = 102

 Score =  103 bits (257), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 71/100 (71%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA++ R LD++  +IV T  ++G+++ GP+P P     +T+ R+ H  K SR
Sbjct: 3   NKKIRIRLKAYEHRTLDTAAEKIVETATRTGAKVAGPVPLPTERSLYTIIRATHKYKDSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KRL+ II PT +TVDALMKLD+ +GVNV IKL
Sbjct: 63  EQFEMRTHKRLVDIINPTQKTVDALMKLDLPSGVNVEIKL 102


>gi|330718973|ref|ZP_08313573.1| 30S ribosomal protein S10 [Leuconostoc fallax KCTC 3537]
          Length = 102

 Score =  103 bits (257), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 72/104 (69%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LKA++ RILD S  +IV T K++G++I GPIP P     +T+ RSPH  
Sbjct: 1   MAQKKIRIR--LKAYEHRILDQSAEKIVETAKRTGAEIAGPIPLPTERTLYTILRSPHKH 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+Q EMR +KRL+ I+ PT +TVD+L KL++ +GV + IKL
Sbjct: 59  KDSREQFEMRTHKRLIDIVNPTDKTVDSLRKLELPSGVAIEIKL 102


>gi|297620549|ref|YP_003708686.1| 30S ribosomal protein S10 [Waddlia chondrophila WSU 86-1044]
 gi|297375850|gb|ADI37680.1| 30S ribosomal protein S10 [Waddlia chondrophila WSU 86-1044]
          Length = 108

 Score =  103 bits (257), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 50/97 (51%), Positives = 70/97 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK +D R+LD S  +IV T +++G+ +VGPIP P    +FTV RSPHVD+KSR+Q
Sbjct: 11  KIRIRLKGYDQRLLDRSTLDIVETAQRTGATVVGPIPLPTRCEKFTVLRSPHVDRKSREQ 70

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E+R +KRL+ I  PT +T+DAL  L + AGV++ IK
Sbjct: 71  FEIRTHKRLIDIQNPTGKTIDALKTLTLPAGVDIKIK 107


>gi|15900144|ref|NP_344748.1| 30S ribosomal protein S10 [Streptococcus pneumoniae TIGR4]
 gi|15902231|ref|NP_357781.1| 30S ribosomal protein S10 [Streptococcus pneumoniae R6]
 gi|111658802|ref|ZP_01409433.1| hypothetical protein SpneT_02000099 [Streptococcus pneumoniae
           TIGR4]
 gi|116516663|ref|YP_815711.1| 30S ribosomal protein S10 [Streptococcus pneumoniae D39]
 gi|148983606|ref|ZP_01816925.1| 30S ribosomal protein S10 [Streptococcus pneumoniae SP3-BS71]
 gi|148987944|ref|ZP_01819407.1| 30S ribosomal protein S10 [Streptococcus pneumoniae SP6-BS73]
 gi|148992784|ref|ZP_01822427.1| 30S ribosomal protein S10 [Streptococcus pneumoniae SP9-BS68]
 gi|148996629|ref|ZP_01824347.1| 30S ribosomal protein S10 [Streptococcus pneumoniae SP11-BS70]
 gi|149001687|ref|ZP_01826660.1| ribosomal protein S10 [Streptococcus pneumoniae SP14-BS69]
 gi|149005957|ref|ZP_01829686.1| 30S ribosomal protein S10 [Streptococcus pneumoniae SP18-BS74]
 gi|149011076|ref|ZP_01832381.1| 30S ribosomal protein S10 [Streptococcus pneumoniae SP19-BS75]
 gi|149017896|ref|ZP_01834355.1| 30S ribosomal protein S10 [Streptococcus pneumoniae SP23-BS72]
 gi|168483844|ref|ZP_02708796.1| ribosomal protein S10 [Streptococcus pneumoniae CDC1873-00]
 gi|168489685|ref|ZP_02713884.1| ribosomal protein S10 [Streptococcus pneumoniae SP195]
 gi|168492161|ref|ZP_02716304.1| ribosomal protein S10 [Streptococcus pneumoniae CDC0288-04]
 gi|168493901|ref|ZP_02718044.1| ribosomal protein S10 [Streptococcus pneumoniae CDC3059-06]
 gi|168576365|ref|ZP_02722248.1| ribosomal protein S10 [Streptococcus pneumoniae MLV-016]
 gi|169834149|ref|YP_001693740.1| 30S ribosomal protein S10 [Streptococcus pneumoniae Hungary19A-6]
 gi|182683187|ref|YP_001834934.1| 30S ribosomal protein S10 [Streptococcus pneumoniae CGSP14]
 gi|194397584|ref|YP_002036909.1| 30S ribosomal protein S10 [Streptococcus pneumoniae G54]
 gi|221231112|ref|YP_002510264.1| 30S ribosomal protein S10 [Streptococcus pneumoniae ATCC 700669]
 gi|225853814|ref|YP_002735326.1| 30S ribosomal protein S10 [Streptococcus pneumoniae JJA]
 gi|225855973|ref|YP_002737484.1| 30S ribosomal protein S10 [Streptococcus pneumoniae P1031]
 gi|225858062|ref|YP_002739572.1| 30S ribosomal protein S10 [Streptococcus pneumoniae 70585]
 gi|237649724|ref|ZP_04523976.1| 30S ribosomal protein S10 [Streptococcus pneumoniae CCRI 1974]
 gi|237821422|ref|ZP_04597267.1| 30S ribosomal protein S10 [Streptococcus pneumoniae CCRI 1974M2]
 gi|270291999|ref|ZP_06198214.1| ribosomal protein S10 [Streptococcus sp. M143]
 gi|293364348|ref|ZP_06611074.1| 30S ribosomal protein S10 [Streptococcus oralis ATCC 35037]
 gi|298230365|ref|ZP_06964046.1| 30S ribosomal protein S10 [Streptococcus pneumoniae str. Canada
           MDR_19F]
 gi|298255986|ref|ZP_06979572.1| 30S ribosomal protein S10 [Streptococcus pneumoniae str. Canada
           MDR_19A]
 gi|298502022|ref|YP_003723962.1| 30S ribosomal protein S10 [Streptococcus pneumoniae TCH8431/19A]
 gi|303255096|ref|ZP_07341172.1| 30S ribosomal protein S10 [Streptococcus pneumoniae BS455]
 gi|303259260|ref|ZP_07345238.1| 30S ribosomal protein S10 [Streptococcus pneumoniae SP-BS293]
 gi|303261015|ref|ZP_07346964.1| 30S ribosomal protein S10 [Streptococcus pneumoniae SP14-BS292]
 gi|303263343|ref|ZP_07349266.1| 30S ribosomal protein S10 [Streptococcus pneumoniae BS397]
 gi|303265508|ref|ZP_07351408.1| 30S ribosomal protein S10 [Streptococcus pneumoniae BS457]
 gi|303267934|ref|ZP_07353736.1| 30S ribosomal protein S10 [Streptococcus pneumoniae BS458]
 gi|306825987|ref|ZP_07459323.1| 30S ribosomal protein S10 [Streptococcus sp. oral taxon 071 str.
           73H25AP]
 gi|306828782|ref|ZP_07461974.1| 30S ribosomal protein S10 [Streptococcus mitis ATCC 6249]
 gi|307066885|ref|YP_003875851.1| hypothetical protein SPAP_0256 [Streptococcus pneumoniae AP200]
 gi|307126428|ref|YP_003878459.1| 30S ribosomal protein S10 [Streptococcus pneumoniae 670-6B]
 gi|307702685|ref|ZP_07639637.1| ribosomal protein S10 [Streptococcus oralis ATCC 35037]
 gi|307704064|ref|ZP_07640993.1| ribosomal protein S10 [Streptococcus mitis SK597]
 gi|307708059|ref|ZP_07644527.1| ribosomal protein S10 [Streptococcus mitis NCTC 12261]
 gi|307709909|ref|ZP_07646356.1| ribosomal protein S10 [Streptococcus mitis SK564]
 gi|307711055|ref|ZP_07647477.1| ribosomal protein S10 [Streptococcus mitis SK321]
 gi|309799057|ref|ZP_07693310.1| ribosomal protein S10 [Streptococcus infantis SK1302]
 gi|315612331|ref|ZP_07887244.1| 30S ribosomal protein S10 [Streptococcus sanguinis ATCC 49296]
 gi|322375040|ref|ZP_08049554.1| ribosomal protein S10 [Streptococcus sp. C300]
 gi|322377231|ref|ZP_08051723.1| ribosomal protein S10 [Streptococcus sp. M334]
 gi|322391198|ref|ZP_08064670.1| 30S ribosomal protein S10 [Streptococcus peroris ATCC 700780]
 gi|331267137|ref|YP_004326767.1| 30S ribosomal protein S10 [Streptococcus oralis Uo5]
 gi|54039323|sp|P66340|RS10_STRR6 RecName: Full=30S ribosomal protein S10
 gi|54042103|sp|P66339|RS10_STRPN RecName: Full=30S ribosomal protein S10
 gi|122279403|sp|Q04MN7|RS10_STRP2 RecName: Full=30S ribosomal protein S10
 gi|226705631|sp|B5E6F4|RS10_STRP4 RecName: Full=30S ribosomal protein S10
 gi|226705632|sp|B1I8J7|RS10_STRPI RecName: Full=30S ribosomal protein S10
 gi|226705633|sp|B2IS39|RS10_STRPS RecName: Full=30S ribosomal protein S10
 gi|254765348|sp|C1CAL1|RS10_STRP7 RecName: Full=30S ribosomal protein S10
 gi|254765349|sp|B8ZKF6|RS10_STRPJ RecName: Full=30S ribosomal protein S10
 gi|254765351|sp|C1CC05|RS10_STRZJ RecName: Full=30S ribosomal protein S10
 gi|254765352|sp|C1CI96|RS10_STRZP RecName: Full=30S ribosomal protein S10
 gi|14971676|gb|AAK74388.1| ribosomal protein S10 [Streptococcus pneumoniae TIGR4]
 gi|15457731|gb|AAK98991.1| 30S Ribosomal protein S10 [Streptococcus pneumoniae R6]
 gi|116077239|gb|ABJ54959.1| ribosomal protein S10 [Streptococcus pneumoniae D39]
 gi|147757204|gb|EDK64243.1| 30S ribosomal protein S10 [Streptococcus pneumoniae SP11-BS70]
 gi|147760145|gb|EDK67134.1| ribosomal protein S10 [Streptococcus pneumoniae SP14-BS69]
 gi|147762313|gb|EDK69274.1| 30S ribosomal protein S10 [Streptococcus pneumoniae SP18-BS74]
 gi|147764712|gb|EDK71642.1| 30S ribosomal protein S10 [Streptococcus pneumoniae SP19-BS75]
 gi|147923753|gb|EDK74865.1| 30S ribosomal protein S10 [Streptococcus pneumoniae SP3-BS71]
 gi|147926408|gb|EDK77481.1| 30S ribosomal protein S10 [Streptococcus pneumoniae SP6-BS73]
 gi|147928510|gb|EDK79525.1| 30S ribosomal protein S10 [Streptococcus pneumoniae SP9-BS68]
 gi|147931460|gb|EDK82438.1| 30S ribosomal protein S10 [Streptococcus pneumoniae SP23-BS72]
 gi|168996651|gb|ACA37263.1| ribosomal protein S10 [Streptococcus pneumoniae Hungary19A-6]
 gi|172042863|gb|EDT50909.1| ribosomal protein S10 [Streptococcus pneumoniae CDC1873-00]
 gi|182628521|gb|ACB89469.1| 30S ribosomal protein S10 [Streptococcus pneumoniae CGSP14]
 gi|183571870|gb|EDT92398.1| ribosomal protein S10 [Streptococcus pneumoniae SP195]
 gi|183573643|gb|EDT94171.1| ribosomal protein S10 [Streptococcus pneumoniae CDC0288-04]
 gi|183576069|gb|EDT96597.1| ribosomal protein S10 [Streptococcus pneumoniae CDC3059-06]
 gi|183577812|gb|EDT98340.1| ribosomal protein S10 [Streptococcus pneumoniae MLV-016]
 gi|194357251|gb|ACF55699.1| 30S ribosomal protein S10 [Streptococcus pneumoniae G54]
 gi|220673572|emb|CAR68058.1| 30S ribosomal protein S10 [Streptococcus pneumoniae ATCC 700669]
 gi|225721984|gb|ACO17838.1| ribosomal protein S10 [Streptococcus pneumoniae 70585]
 gi|225723346|gb|ACO19199.1| ribosomal protein S10 [Streptococcus pneumoniae JJA]
 gi|225726217|gb|ACO22069.1| ribosomal protein S10 [Streptococcus pneumoniae P1031]
 gi|270279527|gb|EFA25369.1| ribosomal protein S10 [Streptococcus sp. M143]
 gi|291317194|gb|EFE57621.1| 30S ribosomal protein S10 [Streptococcus oralis ATCC 35037]
 gi|298237617|gb|ADI68748.1| 30S ribosomal protein S10 [Streptococcus pneumoniae TCH8431/19A]
 gi|301793481|emb|CBW35854.1| 30S ribosomal protein S10 [Streptococcus pneumoniae INV104]
 gi|301799357|emb|CBW31892.1| 30S ribosomal protein S10 [Streptococcus pneumoniae OXC141]
 gi|301801152|emb|CBW33825.1| 30S ribosomal protein S10 [Streptococcus pneumoniae INV200]
 gi|302597926|gb|EFL64996.1| 30S ribosomal protein S10 [Streptococcus pneumoniae BS455]
 gi|302637852|gb|EFL68338.1| 30S ribosomal protein S10 [Streptococcus pneumoniae SP14-BS292]
 gi|302639678|gb|EFL70135.1| 30S ribosomal protein S10 [Streptococcus pneumoniae SP-BS293]
 gi|302642630|gb|EFL72975.1| 30S ribosomal protein S10 [Streptococcus pneumoniae BS458]
 gi|302644948|gb|EFL75195.1| 30S ribosomal protein S10 [Streptococcus pneumoniae BS457]
 gi|302647116|gb|EFL77340.1| 30S ribosomal protein S10 [Streptococcus pneumoniae BS397]
 gi|304428960|gb|EFM32048.1| 30S ribosomal protein S10 [Streptococcus mitis ATCC 6249]
 gi|304431703|gb|EFM34683.1| 30S ribosomal protein S10 [Streptococcus sp. oral taxon 071 str.
           73H25AP]
 gi|306408422|gb|ADM83849.1| hypothetical protein SPAP_0256 [Streptococcus pneumoniae AP200]
 gi|306483490|gb|ADM90359.1| ribosomal protein S10 [Streptococcus pneumoniae 670-6B]
 gi|307615844|gb|EFN95049.1| ribosomal protein S10 [Streptococcus mitis NCTC 12261]
 gi|307617017|gb|EFN96195.1| ribosomal protein S10 [Streptococcus mitis SK321]
 gi|307619280|gb|EFN98409.1| ribosomal protein S10 [Streptococcus mitis SK564]
 gi|307622354|gb|EFO01362.1| ribosomal protein S10 [Streptococcus mitis SK597]
 gi|307623801|gb|EFO02786.1| ribosomal protein S10 [Streptococcus oralis ATCC 35037]
 gi|308117292|gb|EFO54715.1| ribosomal protein S10 [Streptococcus infantis SK1302]
 gi|315315312|gb|EFU63351.1| 30S ribosomal protein S10 [Streptococcus sanguinis ATCC 49296]
 gi|321145951|gb|EFX41340.1| 30S ribosomal protein S10 [Streptococcus peroris ATCC 700780]
 gi|321280540|gb|EFX57579.1| ribosomal protein S10 [Streptococcus sp. C300]
 gi|321281944|gb|EFX58952.1| ribosomal protein S10 [Streptococcus sp. M334]
 gi|326683809|emb|CBZ01427.1| 30S ribosomal protein S10 [Streptococcus oralis Uo5]
 gi|327390627|gb|EGE88967.1| ribosomal protein S10 [Streptococcus pneumoniae GA04375]
 gi|332075873|gb|EGI86340.1| ribosomal protein S10 [Streptococcus pneumoniae GA17570]
 gi|332077509|gb|EGI87970.1| ribosomal protein S10 [Streptococcus pneumoniae GA41301]
          Length = 102

 Score =  103 bits (257), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 71/100 (71%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA++ R LD++  +IV +  ++G+Q+ GPIP P     +T+ R+ H  K SR
Sbjct: 3   NKKIRIRLKAYEHRTLDTAAAKIVESATRTGAQVAGPIPLPTERSLYTIIRATHKYKDSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KRL+ I+ PT +TVDALMKLD+ +GVNV IKL
Sbjct: 63  EQFEMRTHKRLIDIVNPTQKTVDALMKLDLPSGVNVEIKL 102


>gi|290581290|ref|YP_003485682.1| ribosomal protein S10 [Streptococcus mutans NN2025]
 gi|1350920|sp|P48853|RS10_STRMU RecName: Full=30S ribosomal protein S10
 gi|467321|gb|AAB46363.1| S10 ribosomal protein [Streptococcus mutans]
 gi|254998189|dbj|BAH88790.1| ribosomal protein S10 [Streptococcus mutans NN2025]
          Length = 102

 Score =  103 bits (257), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 70/100 (70%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA++ R LD++  +IV T  ++G+ + GP+P P     +TV R+ H  K SR
Sbjct: 3   NKKIRIRLKAYEHRTLDTAAEKIVETATRTGASVAGPVPLPTERSLYTVIRATHKYKDSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KRL+ I+ PT +TVDALMKLD+ +GVNV IKL
Sbjct: 63  EQFEMRTHKRLIDIVNPTQKTVDALMKLDLPSGVNVEIKL 102


>gi|225849549|ref|YP_002729714.1| 30S ribosomal protein S10 [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225643442|gb|ACN98492.1| ribosomal protein S10 [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 102

 Score =  103 bits (257), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD R+LD S+++IV T K+ G  + GPIP P   + + V+RSPH  ++SR+ 
Sbjct: 4   KIRIKLKAFDHRVLDQSVKQIVDTVKRGGGLLKGPIPLPTERKVWCVHRSPHKFEQSREH 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMRI+KRL+ I   TPQT++ALM +++ AGV+V IKL
Sbjct: 64  FEMRIHKRLIEIENATPQTIEALMDINLPAGVDVEIKL 101


>gi|224437282|ref|ZP_03658254.1| 30S ribosomal protein S10 [Helicobacter cinaedi CCUG 18818]
 gi|313143737|ref|ZP_07805930.1| 30S ribosomal protein S10 [Helicobacter cinaedi CCUG 18818]
 gi|313128768|gb|EFR46385.1| 30S ribosomal protein S10 [Helicobacter cinaedi CCUG 18818]
          Length = 103

 Score =  103 bits (257), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 71/96 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI + LKA+D R+LD S+  I+   K++GS+I GP+P P   +R+TV RSPH++K SR+Q
Sbjct: 3   RIRLRLKAYDHRVLDRSVASIIEAVKRTGSEIRGPVPLPTKKKRYTVLRSPHINKDSREQ 62

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVI 102
            E+R++ R++ I+  TP TVD+LMKLD+A  V+V +
Sbjct: 63  FEIRVHHRIIDIMSATPDTVDSLMKLDLAPEVDVEV 98


>gi|46445840|ref|YP_007205.1| 30S ribosomal protein S10 [Candidatus Protochlamydia amoebophila
           UWE25]
 gi|54036363|sp|Q6MER9|RS10_PARUW RecName: Full=30S ribosomal protein S10
 gi|46399481|emb|CAF22930.1| probable 30S ribosomal protein S10 [Candidatus Protochlamydia
           amoebophila UWE25]
          Length = 111

 Score =  103 bits (257), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 49/97 (50%), Positives = 71/97 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK +D R+LD S  +IV T K++G+ I GPIP P S  +FTV RSP++D+KSR+Q
Sbjct: 14  KIRIRLKGYDQRLLDRSTGDIVETAKRTGAAIAGPIPLPTSCEKFTVLRSPNIDRKSREQ 73

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E+R ++RL+ I+ PT +T+DAL  L + AGV++ IK
Sbjct: 74  FEIRTHRRLIDILNPTSKTIDALKTLTLPAGVDIKIK 110


>gi|255326841|ref|ZP_05367917.1| ribosomal protein S10 [Rothia mucilaginosa ATCC 25296]
 gi|283457541|ref|YP_003362124.1| 30S ribosomal protein S10 [Rothia mucilaginosa DY-18]
 gi|300742058|ref|ZP_07072079.1| ribosomal protein S10 [Rothia dentocariosa M567]
 gi|311111974|ref|YP_003983196.1| 30S ribosomal protein S10 [Rothia dentocariosa ATCC 17931]
 gi|255296058|gb|EET75399.1| ribosomal protein S10 [Rothia mucilaginosa ATCC 25296]
 gi|283133539|dbj|BAI64304.1| ribosomal protein S10 [Rothia mucilaginosa DY-18]
 gi|300381243|gb|EFJ77805.1| ribosomal protein S10 [Rothia dentocariosa M567]
 gi|310943468|gb|ADP39762.1| 30S ribosomal protein S10 [Rothia dentocariosa ATCC 17931]
          Length = 102

 Score =  103 bits (256), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 71/104 (68%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LK++D  ++DSS R+IV T K +G+ +VGP+P P     + V RSPH  
Sbjct: 1   MAGQKIRIR--LKSYDHEVIDSSARKIVETVKGAGATVVGPVPLPTEKNVYCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+  EMR +KRL+ ++ PTP+ VDALM+LD+ A VN+ IKL
Sbjct: 59  KDSREHFEMRTHKRLIDVVDPTPKAVDALMRLDLPADVNIEIKL 102


>gi|150392161|ref|YP_001322210.1| ribosomal protein S10 [Alkaliphilus metalliredigens QYMF]
 gi|166991562|sp|A6TWI3|RS10_ALKMQ RecName: Full=30S ribosomal protein S10
 gi|149952023|gb|ABR50551.1| ribosomal protein S10 [Alkaliphilus metalliredigens QYMF]
          Length = 104

 Score =  103 bits (256), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 72/104 (69%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M+  N +I I LK +D + +D S  +IV T KKSG+++ GPIP P   +  T+ R+ H  
Sbjct: 1   MSKANQKIRIRLKGYDHKAVDQSAEKIVATAKKSGAEVSGPIPLPTEKQIITILRAVHKY 60

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K +R+Q EMR +KRL+ I+ PTP+TVD LM+LD+ AGV++ IKL
Sbjct: 61  KDAREQFEMRTHKRLIDILSPTPKTVDLLMRLDLPAGVDIEIKL 104


>gi|320094581|ref|ZP_08026347.1| 30S ribosomal protein S10 [Actinomyces sp. oral taxon 178 str.
           F0338]
 gi|319978496|gb|EFW10073.1| 30S ribosomal protein S10 [Actinomyces sp. oral taxon 178 str.
           F0338]
          Length = 102

 Score =  103 bits (256), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++DSS R+IV T +++G+ +VGP+P P     F V RSPH  K SR+ 
Sbjct: 5   KIRIRLKSYDHEVIDSSARKIVETVQRAGATVVGPVPLPTEKNVFVVIRSPHKYKDSREH 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ II PTP+ VD+LM++D+ A VN+ IKL
Sbjct: 65  FEMRTHKRLIDIIDPTPKAVDSLMRIDLPADVNIEIKL 102


>gi|332076654|gb|EGI87116.1| ribosomal protein S10 [Streptococcus pneumoniae GA17545]
          Length = 102

 Score =  103 bits (256), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 71/100 (71%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA++ R LD++  +IV +  ++G+Q+ GPIP P     +T+ R+ H  K SR
Sbjct: 3   NKKIRIRLKAYEHRTLDTAAAKIVESATRTGAQVAGPIPLPTERSLYTIIRATHKYKYSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KRL+ I+ PT +TVDALMKLD+ +GVNV IKL
Sbjct: 63  EQFEMRTHKRLIDIVNPTQKTVDALMKLDLPSGVNVEIKL 102


>gi|302388711|ref|YP_003824532.1| SSU ribosomal protein S10P [Thermosediminibacter oceani DSM 16646]
 gi|302199339|gb|ADL06909.1| SSU ribosomal protein S10P [Thermosediminibacter oceani DSM 16646]
          Length = 102

 Score =  103 bits (256), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 72/98 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++DS ILD S ++IV T K++G+++ GPIP P      T+ R+PH  K SR+Q
Sbjct: 5   KIRIRLKSYDSGILDQSAQKIVETAKRTGAKVSGPIPLPTDRTLITILRAPHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R +KRL+ I +PTP+TVDALM+LD+ AGV++ IKL
Sbjct: 65  FETRTHKRLIDIHEPTPKTVDALMRLDLPAGVDIEIKL 102


>gi|228472123|ref|ZP_04056889.1| ribosomal protein S10 [Capnocytophaga gingivalis ATCC 33624]
 gi|326334546|ref|ZP_08200757.1| 30S ribosomal protein S10 [Capnocytophaga sp. oral taxon 338 str.
           F0234]
 gi|228276326|gb|EEK15050.1| ribosomal protein S10 [Capnocytophaga gingivalis ATCC 33624]
 gi|325693315|gb|EGD35243.1| 30S ribosomal protein S10 [Capnocytophaga sp. oral taxon 338 str.
           F0234]
          Length = 101

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++D S  +IV T K +G+ +VGPIP P   + FTV RSPHV+KK+R+Q
Sbjct: 4   KIRIKLKSYDHNLVDKSAEKIVKTVKSTGAGVVGPIPLPTHKKLFTVLRSPHVNKKAREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            ++  YKRLL I   +P+T+DALMKL++ +GV V IK+
Sbjct: 64  FQLSSYKRLLDIYSSSPKTIDALMKLELPSGVEVEIKV 101


>gi|237804785|ref|YP_002888939.1| 30S ribosomal protein S10 [Chlamydia trachomatis B/TZ1A828/OT]
 gi|231273085|emb|CAX09998.1| SSU ribosomal protein S10P [Chlamydia trachomatis B/TZ1A828/OT]
          Length = 105

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 70/103 (67%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +  RI I LK FD   LD S   IV T K++G+++VGPIP P     +TV RSPHVD
Sbjct: 1   MKQQKQRIRIRLKGFDQGQLDRSTANIVETAKRTGARVVGPIPLPTKREVYTVLRSPHVD 60

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           KKSR+Q E+R +KRL+ I+ PT +T+DAL  L + AGV++ IK
Sbjct: 61  KKSREQFEIRTHKRLVDILDPTGKTIDALKMLSLPAGVDIKIK 103


>gi|171778374|ref|ZP_02919553.1| hypothetical protein STRINF_00404 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171282905|gb|EDT48329.1| hypothetical protein STRINF_00404 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 102

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 70/100 (70%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA++ R LD++  +IV T  ++G+ + GP+P P     +T+ R+ H  K SR
Sbjct: 3   NKKIRIRLKAYEHRTLDTAAEKIVETATRTGASVAGPVPLPTERSLYTIIRATHKYKDSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KRL+ II PT +TVDALMKLD+ +GVNV IKL
Sbjct: 63  EQFEMRTHKRLIDIINPTQKTVDALMKLDLPSGVNVEIKL 102


>gi|298243969|ref|ZP_06967776.1| ribosomal protein S10 [Ktedonobacter racemifer DSM 44963]
 gi|297557023|gb|EFH90887.1| ribosomal protein S10 [Ktedonobacter racemifer DSM 44963]
          Length = 105

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 50/103 (48%), Positives = 72/103 (69%)

Query: 2   TSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDK 61
           T    RI I LKAFD RILD S  +IV   +++G+++ GP+P P  I ++TV RSP +DK
Sbjct: 3   TGSKQRIRIRLKAFDHRILDQSAMQIVDAAQRTGARVSGPVPLPTKIEKYTVMRSPFIDK 62

Query: 62  KSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            +RDQ E+R +KRL+ I+  T +TV+AL  L++ AGV++ IKL
Sbjct: 63  DARDQFEIRTHKRLIDIVDHTNKTVEALTHLNLPAGVDIEIKL 105


>gi|45644692|gb|AAS73080.1| predicted ribosomal protein S10 [uncultured marine gamma
           proteobacterium EBAC20E09]
          Length = 104

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 55/99 (55%), Positives = 70/99 (70%)

Query: 4   RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
            N  I I LKAFD R++D+S + IV T KK+G+ I GPIP P    R TV  SPH DK +
Sbjct: 2   ENQSIRIRLKAFDYRLIDASAKLIVETVKKTGAIINGPIPLPVKKERTTVLISPHKDKDA 61

Query: 64  RDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVI 102
           RDQ E+  YKRL+ I+KPT +TVDALMKLD+++ V+V I
Sbjct: 62  RDQYEIVTYKRLMDIVKPTDKTVDALMKLDLSSAVDVQI 100


>gi|194099919|ref|YP_002003057.1| 30S ribosomal protein S10 [Neisseria gonorrhoeae NCCP11945]
 gi|226705598|sp|B4RQX4|RS10_NEIG2 RecName: Full=30S ribosomal protein S10
 gi|193935209|gb|ACF31033.1| 30S ribosomal protein S10 [Neisseria gonorrhoeae NCCP11945]
          Length = 103

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 72/100 (72%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA+D  ++D   +EIV T K++G+ + GPIP P  I RF + RSPH++K SR
Sbjct: 3   NQKIRIRLKAYDYALIDRFAQEIVETAKRTGAVVKGPIPLPTKIERFNILRSPHMNKTSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +QLE+R + RL+ I+  T +T DALMKLD+ AGV+V IK+
Sbjct: 63  EQLEIRTHLRLMDIVDWTDKTTDALMKLDLPAGVDVEIKV 102


>gi|15674082|ref|NP_268257.1| 30S ribosomal protein S10 [Lactococcus lactis subsp. lactis Il1403]
 gi|116513054|ref|YP_811961.1| 30S ribosomal protein S10 [Lactococcus lactis subsp. cremoris SK11]
 gi|125625144|ref|YP_001033627.1| 30S ribosomal protein S10 [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|281492760|ref|YP_003354740.1| 50S ribosomal protein S10P [Lactococcus lactis subsp. lactis KF147]
 gi|17865591|sp|Q9CDW1|RS10_LACLA RecName: Full=30S ribosomal protein S10
 gi|122939917|sp|Q02W24|RS10_LACLS RecName: Full=30S ribosomal protein S10
 gi|166231280|sp|A2RNQ6|RS10_LACLM RecName: Full=30S ribosomal protein S10
 gi|12725154|gb|AAK06198.1|AE006438_12 30S ribosomal protein S10 [Lactococcus lactis subsp. lactis Il1403]
 gi|116108708|gb|ABJ73848.1| SSU ribosomal protein S10P [Lactococcus lactis subsp. cremoris
           SK11]
 gi|124493952|emb|CAL98947.1| 30S ribosomal protein S10 [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|281376412|gb|ADA65898.1| SSU ribosomal protein S10P [Lactococcus lactis subsp. lactis KF147]
 gi|300071952|gb|ADJ61352.1| 30S ribosomal protein S10 [Lactococcus lactis subsp. cremoris
           NZ9000]
 gi|326407633|gb|ADZ64704.1| 30S ribosomal protein S10 [Lactococcus lactis subsp. lactis CV56]
          Length = 102

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 75/104 (72%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M ++ IRI   LKA++ RILD++  +IV T K++ +++ GPIP P     +TV R+ H  
Sbjct: 1   MATKKIRIR--LKAYEHRILDAAAEKIVETAKRTNAEVSGPIPLPTDRSVYTVIRATHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+Q EMR +KRL+ II+PT +TVD+LMKLD+ +GVN+ IKL
Sbjct: 59  KDSREQFEMRTHKRLIDIIEPTQKTVDSLMKLDLPSGVNIEIKL 102


>gi|153952248|ref|YP_001398987.1| 30S ribosomal protein S10 [Campylobacter jejuni subsp. doylei
           269.97]
 gi|166231256|sp|A7H657|RS10_CAMJD RecName: Full=30S ribosomal protein S10
 gi|152939694|gb|ABS44435.1| ribosomal protein S10 [Campylobacter jejuni subsp. doylei 269.97]
          Length = 103

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 49/97 (50%), Positives = 71/97 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI + LKA+D R+LD ++  IV   K++G+ I GPIP P  I+R+TV +SPH++K SR+Q
Sbjct: 3   RIRLKLKAYDHRVLDRTVAAIVEAVKRTGADIRGPIPMPTKIKRYTVLKSPHINKDSREQ 62

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E+RI+ R+L II  TP TVD+L KLD+A  V+V ++
Sbjct: 63  FEIRIHARMLDIIAATPDTVDSLTKLDLAPEVSVEVR 99


>gi|55821906|ref|YP_140348.1| 30S ribosomal protein S10 [Streptococcus thermophilus LMG 18311]
 gi|228477976|ref|ZP_04062587.1| ribosomal protein S10 [Streptococcus salivarius SK126]
 gi|306832546|ref|ZP_07465686.1| 30S ribosomal protein S10 [Streptococcus bovis ATCC 700338]
 gi|312862388|ref|ZP_07722631.1| ribosomal protein S10 [Streptococcus vestibularis F0396]
 gi|322374044|ref|ZP_08048578.1| ribosomal protein S10 [Streptococcus sp. C150]
 gi|322515866|ref|ZP_08068808.1| 30S ribosomal protein S10 [Streptococcus vestibularis ATCC 49124]
 gi|81560054|sp|Q5M2B2|RS10_STRT2 RecName: Full=30S ribosomal protein S10
 gi|55737891|gb|AAV61533.1| 30S ribosomal protein S10 [Streptococcus thermophilus LMG 18311]
 gi|228250156|gb|EEK09409.1| ribosomal protein S10 [Streptococcus salivarius SK126]
 gi|304425304|gb|EFM28430.1| 30S ribosomal protein S10 [Streptococcus bovis ATCC 700338]
 gi|311102031|gb|EFQ60231.1| ribosomal protein S10 [Streptococcus vestibularis F0396]
 gi|321277010|gb|EFX54081.1| ribosomal protein S10 [Streptococcus sp. C150]
 gi|322125653|gb|EFX96980.1| 30S ribosomal protein S10 [Streptococcus vestibularis ATCC 49124]
          Length = 102

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 70/100 (70%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA++ R LD++  +IV T  ++G+ + GP+P P     +T+ R+ H  K SR
Sbjct: 3   NKKIRIRLKAYEHRTLDTAAEKIVETATRTGATVAGPVPLPTERSLYTIIRATHKYKDSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KRL+ II PT +TVDALMKLD+ +GVNV IKL
Sbjct: 63  EQFEMRTHKRLIDIINPTQKTVDALMKLDLPSGVNVEIKL 102


>gi|320160413|ref|YP_004173637.1| 30S ribosomal protein S10 [Anaerolinea thermophila UNI-1]
 gi|319994266|dbj|BAJ63037.1| 30S ribosomal protein S10 [Anaerolinea thermophila UNI-1]
          Length = 102

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 47/98 (47%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I LKAFD R+LD S + IV T ++SG+++VGP+P P  I R+TV RS  +DK S + 
Sbjct: 5   RIRIRLKAFDHRVLDQSAKRIVETAERSGARVVGPVPLPTKIERYTVRRSTFIDKDSHEH 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R + RL+ +I P  +T+D LM+L++ AGV++ IK+
Sbjct: 65  FEIRTHNRLIDVIDPDAKTIDMLMRLNLPAGVDIEIKI 102


>gi|308233845|ref|ZP_07664582.1| ribosomal protein S10 [Atopobium vaginae DSM 15829]
 gi|328943554|ref|ZP_08241019.1| 30S ribosomal protein S10 [Atopobium vaginae DSM 15829]
 gi|327491523|gb|EGF23297.1| 30S ribosomal protein S10 [Atopobium vaginae DSM 15829]
          Length = 102

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 75/104 (72%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M+S+ IRI   LK +D  ++D S + IV T +K+G+++ GPIP P   + +TV RSPH D
Sbjct: 1   MSSQKIRIR--LKGYDHEVVDQSSKLIVDTAQKTGARVSGPIPLPTERKLYTVIRSPHKD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR++ EMR +KRL+ I+ P+  TVD+LM++D+ AGV++ IKL
Sbjct: 59  KDSREEFEMRTHKRLIDILDPSSSTVDSLMRMDLPAGVDIDIKL 102


>gi|15674286|ref|NP_268459.1| 30S ribosomal protein S10 [Streptococcus pyogenes M1 GAS]
 gi|19745240|ref|NP_606376.1| 30S ribosomal protein S10 [Streptococcus pyogenes MGAS8232]
 gi|21909575|ref|NP_663843.1| 30S ribosomal protein S10 [Streptococcus pyogenes MGAS315]
 gi|22536242|ref|NP_687093.1| 30S ribosomal protein S10 [Streptococcus agalactiae 2603V/R]
 gi|25010132|ref|NP_734527.1| 30S ribosomal protein S10 [Streptococcus agalactiae NEM316]
 gi|28894952|ref|NP_801302.1| 30S ribosomal protein S10 [Streptococcus pyogenes SSI-1]
 gi|50913438|ref|YP_059410.1| 30S ribosomal protein S10 [Streptococcus pyogenes MGAS10394]
 gi|71902708|ref|YP_279511.1| 30S ribosomal protein S10 [Streptococcus pyogenes MGAS6180]
 gi|71909857|ref|YP_281407.1| 30S ribosomal protein S10 [Streptococcus pyogenes MGAS5005]
 gi|76788080|ref|YP_328783.1| 30S ribosomal protein S10 [Streptococcus agalactiae A909]
 gi|76798227|ref|ZP_00780477.1| ribosomal protein S10 [Streptococcus agalactiae 18RS21]
 gi|77406991|ref|ZP_00784006.1| ribosomal protein S10 [Streptococcus agalactiae H36B]
 gi|77412290|ref|ZP_00788606.1| ribosomal protein S10 [Streptococcus agalactiae CJB111]
 gi|94989554|ref|YP_597654.1| 30S ribosomal protein S10 [Streptococcus pyogenes MGAS10270]
 gi|94993440|ref|YP_601538.1| 30S ribosomal protein S10 [Streptococcus pyogenes MGAS10750]
 gi|139472926|ref|YP_001127641.1| 30S ribosomal protein S10 [Streptococcus pyogenes str. Manfredo]
 gi|209558626|ref|YP_002285098.1| 30S ribosomal protein S10 [Streptococcus pyogenes NZ131]
 gi|306828261|ref|ZP_07461521.1| 30S ribosomal protein S10 [Streptococcus pyogenes ATCC 10782]
 gi|54039324|sp|P66342|RS10_STRP3 RecName: Full=30S ribosomal protein S10
 gi|54039325|sp|P66343|RS10_STRP8 RecName: Full=30S ribosomal protein S10
 gi|54039326|sp|P66344|RS10_STRA3 RecName: Full=30S ribosomal protein S10
 gi|54039327|sp|P66345|RS10_STRA5 RecName: Full=30S ribosomal protein S10
 gi|54042104|sp|P66341|RS10_STRP1 RecName: Full=30S ribosomal protein S10
 gi|73917910|sp|Q5XED6|RS10_STRP6 RecName: Full=30S ribosomal protein S10
 gi|109915157|sp|Q3K3X0|RS10_STRA1 RecName: Full=30S ribosomal protein S10
 gi|118597328|sp|Q1JJ63|RS10_STRPD RecName: Full=30S ribosomal protein S10
 gi|118597329|sp|Q1J917|RS10_STRPF RecName: Full=30S ribosomal protein S10
 gi|118597330|sp|Q48VV0|RS10_STRPM RecName: Full=30S ribosomal protein S10
 gi|166231786|sp|A2RC13|RS10_STRPG RecName: Full=30S ribosomal protein S10
 gi|226705634|sp|B5XJ35|RS10_STRPZ RecName: Full=30S ribosomal protein S10
 gi|22533062|gb|AAM98965.1|AE014194_10 ribosomal protein S10 [Streptococcus agalactiae 2603V/R]
 gi|13621366|gb|AAK33181.1| 30S ribosomal protein S10 [Streptococcus pyogenes M1 GAS]
 gi|19747334|gb|AAL96875.1| 30S ribosomal protein S10 [Streptococcus pyogenes MGAS8232]
 gi|21903756|gb|AAM78646.1| 30S ribosomal protein S10 [Streptococcus pyogenes MGAS315]
 gi|23094483|emb|CAD45702.1| ribosomal protein S10 [Streptococcus agalactiae NEM316]
 gi|28810197|dbj|BAC63135.1| 30S ribosomal protein S10 [Streptococcus pyogenes SSI-1]
 gi|50902512|gb|AAT86227.1| SSU ribosomal protein S10P [Streptococcus pyogenes MGAS10394]
 gi|71801803|gb|AAX71156.1| SSU ribosomal protein S10P [Streptococcus pyogenes MGAS6180]
 gi|71852639|gb|AAZ50662.1| SSU ribosomal protein S10P [Streptococcus pyogenes MGAS5005]
 gi|76563137|gb|ABA45721.1| ribosomal protein S10 [Streptococcus agalactiae A909]
 gi|76586436|gb|EAO62944.1| ribosomal protein S10 [Streptococcus agalactiae 18RS21]
 gi|77161680|gb|EAO72675.1| ribosomal protein S10 [Streptococcus agalactiae CJB111]
 gi|77174396|gb|EAO77250.1| ribosomal protein S10 [Streptococcus agalactiae H36B]
 gi|94543062|gb|ABF33110.1| SSU ribosomal protein S10P [Streptococcus pyogenes MGAS10270]
 gi|94546948|gb|ABF36994.1| SSU ribosomal protein S10P [Streptococcus pyogenes MGAS10750]
 gi|134271172|emb|CAM29385.1| 30S ribosomal protein S10 [Streptococcus pyogenes str. Manfredo]
 gi|209539827|gb|ACI60403.1| SSU ribosomal protein S10p (S20e) [Streptococcus pyogenes NZ131]
 gi|304429572|gb|EFM32621.1| 30S ribosomal protein S10 [Streptococcus pyogenes ATCC 10782]
 gi|319743996|gb|EFV96376.1| 30S ribosomal protein S10 [Streptococcus agalactiae ATCC 13813]
          Length = 102

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 70/100 (70%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA++ R LD++  +IV T  ++G+ + GP+P P     +T+ R+ H  K SR
Sbjct: 3   NKKIRIRLKAYEHRTLDTAAEKIVETATRTGATVAGPVPLPTERSLYTIIRATHKYKDSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KRL+ II PT +TVDALMKLD+ +GVNV IKL
Sbjct: 63  EQFEMRTHKRLVDIINPTQKTVDALMKLDLPSGVNVEIKL 102


>gi|303232428|ref|ZP_07319120.1| ribosomal protein S10 [Atopobium vaginae PB189-T1-4]
 gi|302481512|gb|EFL44580.1| ribosomal protein S10 [Atopobium vaginae PB189-T1-4]
          Length = 102

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 74/104 (71%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M+S+ IRI   LK +D  ++D S + IV T +K+G+++ GP+P P     +TV RSPH D
Sbjct: 1   MSSQKIRIR--LKGYDHEVVDQSSKLIVDTAQKTGARVSGPVPLPTERNLYTVIRSPHKD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR++ EMR +KRL+ I+ P+  TVDALM++D+ AGV++ IKL
Sbjct: 59  KDSREEFEMRTHKRLIDILDPSSSTVDALMRMDLPAGVDINIKL 102


>gi|330444213|ref|YP_004377199.1| 30S ribosomal protein S10 [Chlamydophila pecorum E58]
 gi|328807323|gb|AEB41496.1| ribosomal protein S10 [Chlamydophila pecorum E58]
          Length = 105

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 71/103 (68%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +  +I I LK FD   LD S  +IV T K++G+++VGPIP P     +TV RSPHVD
Sbjct: 1   MKQQKQKIRIRLKGFDQGQLDRSTADIVETAKRTGARVVGPIPLPTKREVYTVLRSPHVD 60

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           KKSR+Q E+R +KRL+ I+ PT +T+DAL  L + AGV++ IK
Sbjct: 61  KKSREQFEIRTHKRLVDILDPTGKTIDALKMLSLPAGVDIKIK 103


>gi|320548056|ref|ZP_08042336.1| 30S ribosomal protein S10 [Streptococcus equinus ATCC 9812]
 gi|320447298|gb|EFW88061.1| 30S ribosomal protein S10 [Streptococcus equinus ATCC 9812]
          Length = 102

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 70/100 (70%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA++ R LD++  +IV T  ++G+ + GP+P P     +T+ R+ H  K SR
Sbjct: 3   NKKIRIRLKAYEHRTLDTAAEKIVETATRTGASVAGPVPLPTERSLYTIIRATHKYKDSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KRL+ I+ PT +TVDALMKLD+ +GVNV IKL
Sbjct: 63  EQFEMRTHKRLIDIVNPTQKTVDALMKLDLPSGVNVEIKL 102


>gi|188584835|ref|YP_001916380.1| SSU ribosomal protein S10P [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|226705597|sp|B2A4D8|RS10_NATTJ RecName: Full=30S ribosomal protein S10
 gi|179349522|gb|ACB83792.1| SSU ribosomal protein S10P [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 103

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD  ILD S  +IV T K++G+ + GP+P P     +TV R+PH  K SR+Q
Sbjct: 6   KIRIRLKAFDHMILDQSAEKIVETAKRTGANVSGPVPLPTDKNVYTVIRAPHKFKDSREQ 65

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PT +TVD+LM+LD+ +GV++ IKL
Sbjct: 66  FEMRTHKRLIDILDPTSKTVDSLMRLDLPSGVDIEIKL 103


>gi|119485457|ref|ZP_01619785.1| 30S ribosomal protein S10 [Lyngbya sp. PCC 8106]
 gi|119457213|gb|EAW38339.1| 30S ribosomal protein S10 [Lyngbya sp. PCC 8106]
          Length = 133

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD R+LD+S  +IV T  ++G+  +GPIP P   R + V RSPHVDK SR+ 
Sbjct: 36  KIRIRLKAFDRRLLDTSCEKIVDTANRTGATAIGPIPLPTKRRIYCVLRSPHVDKDSREH 95

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R ++R++ I +P+ +T+DALMKLD+ AGV++ +KL
Sbjct: 96  FETRTHRRIIDIYQPSSKTIDALMKLDLPAGVDIEVKL 133


>gi|254973730|ref|ZP_05270202.1| 30S ribosomal protein S10 [Clostridium difficile QCD-66c26]
 gi|255091119|ref|ZP_05320597.1| 30S ribosomal protein S10 [Clostridium difficile CIP 107932]
 gi|255099231|ref|ZP_05328208.1| 30S ribosomal protein S10 [Clostridium difficile QCD-63q42]
 gi|255305014|ref|ZP_05349186.1| 30S ribosomal protein S10 [Clostridium difficile ATCC 43255]
 gi|255312774|ref|ZP_05354357.1| 30S ribosomal protein S10 [Clostridium difficile QCD-76w55]
 gi|255515533|ref|ZP_05383209.1| 30S ribosomal protein S10 [Clostridium difficile QCD-97b34]
 gi|255648628|ref|ZP_05395530.1| 30S ribosomal protein S10 [Clostridium difficile QCD-37x79]
 gi|260681845|ref|YP_003213130.1| 30S ribosomal protein S10 [Clostridium difficile CD196]
 gi|260685443|ref|YP_003216576.1| 30S ribosomal protein S10 [Clostridium difficile R20291]
 gi|296449800|ref|ZP_06891569.1| 30S ribosomal protein S10 [Clostridium difficile NAP08]
 gi|296877864|ref|ZP_06901886.1| 30S ribosomal protein S10 [Clostridium difficile NAP07]
 gi|306518751|ref|ZP_07405098.1| 30S ribosomal protein S10 [Clostridium difficile QCD-32g58]
 gi|260208008|emb|CBA60185.1| 30S ribosomal protein S10 [Clostridium difficile CD196]
 gi|260211459|emb|CBE01577.1| 30S ribosomal protein S10 [Clostridium difficile R20291]
 gi|296261398|gb|EFH08224.1| 30S ribosomal protein S10 [Clostridium difficile NAP08]
 gi|296431164|gb|EFH16989.1| 30S ribosomal protein S10 [Clostridium difficile NAP07]
          Length = 103

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 74/102 (72%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           ++N +I I LK++D ++LD S  +IV T KK+GSQ+ GP+P P   +  T+ R+ H  K 
Sbjct: 2   AKNEKIRIRLKSYDHKLLDFSAGKIVETAKKAGSQVSGPVPLPTEKQVVTILRAVHKYKD 61

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           SR+Q E+R +KRL+ I  PTP+TVD+LM+LD+ AGV++ IKL
Sbjct: 62  SREQFEIRTHKRLIDIANPTPKTVDSLMRLDLPAGVDIEIKL 103


>gi|322388402|ref|ZP_08062005.1| 30S ribosomal protein S10 [Streptococcus infantis ATCC 700779]
 gi|321140715|gb|EFX36217.1| 30S ribosomal protein S10 [Streptococcus infantis ATCC 700779]
          Length = 102

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 71/100 (71%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA++ R LD++  +IV +  ++G+++ GPIP P     +T+ R+ H  K SR
Sbjct: 3   NKKIRIRLKAYEHRTLDTAAAKIVESATRTGAEVAGPIPLPTERSLYTIIRATHKYKDSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KRL+ II PT +TVDALMKLD+ +GVNV IKL
Sbjct: 63  EQFEMRTHKRLIDIINPTQKTVDALMKLDLPSGVNVEIKL 102


>gi|148655338|ref|YP_001275543.1| 30S ribosomal protein S10 [Roseiflexus sp. RS-1]
 gi|166231774|sp|A5USJ0|RS10_ROSS1 RecName: Full=30S ribosomal protein S10
 gi|148567448|gb|ABQ89593.1| SSU ribosomal protein S10P [Roseiflexus sp. RS-1]
          Length = 102

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 45/98 (45%), Positives = 73/98 (74%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           ++ I LKA+D +ILD S R+IV   +++G+ + GP+P P  I + +V RSP +DK S++Q
Sbjct: 5   KVRIRLKAYDHKILDQSARQIVEAAERTGALVAGPVPLPTKIEKHSVIRSPFIDKDSQEQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRL+ ++ P+ QT++ALMKL++ AGV++ IKL
Sbjct: 65  FEIRTHKRLIDVLDPSQQTINALMKLNLPAGVDIEIKL 102


>gi|313884528|ref|ZP_07818289.1| ribosomal protein S10 [Eremococcus coleocola ACS-139-V-Col8]
 gi|312620312|gb|EFR31740.1| ribosomal protein S10 [Eremococcus coleocola ACS-139-V-Col8]
          Length = 102

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA++ R LD S  +IV + +++G++  GPIP P     +TV RSPH  K SR+Q
Sbjct: 5   KIRIRLKAYEHRALDVSANKIVESAQRTGAKTAGPIPLPTERSVYTVIRSPHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ II PT +TVDALMKLD+ +GV+V IKL
Sbjct: 65  FEMRTHKRLIDIIDPTAKTVDALMKLDLPSGVDVEIKL 102


>gi|313889566|ref|ZP_07823211.1| ribosomal protein S10 [Streptococcus pseudoporcinus SPIN 20026]
 gi|313122075|gb|EFR45169.1| ribosomal protein S10 [Streptococcus pseudoporcinus SPIN 20026]
          Length = 102

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 70/100 (70%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA++ R LD++  +IV T  ++G+ + GP+P P     +T+ R+ H  K SR
Sbjct: 3   NKKIRIRLKAYEHRTLDTAAEKIVETATRTGAAVAGPVPLPTERSLYTIIRATHKYKDSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KRL+ I+ PT +TVDALMKLD+ +GVNV IKL
Sbjct: 63  EQFEMRTHKRLIDIVNPTQKTVDALMKLDLPSGVNVEIKL 102


>gi|24213438|ref|NP_710919.1| 30S ribosomal protein S10 [Leptospira interrogans serovar Lai str.
           56601]
 gi|45658704|ref|YP_002790.1| 30S ribosomal protein S10 [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|116327223|ref|YP_796943.1| 30S ribosomal protein S10 [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116327263|ref|YP_796983.1| 30S ribosomal protein S10 [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116332123|ref|YP_801841.1| 30S ribosomal protein S10 [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|7388116|sp|Q9XD37|RS10_LEPIN RecName: Full=30S ribosomal protein S10
 gi|54036377|sp|Q72NG0|RS10_LEPIC RecName: Full=30S ribosomal protein S10
 gi|122280147|sp|Q04PT7|RS10_LEPBJ RecName: Full=30S ribosomal protein S10
 gi|5163203|gb|AAD40582.1|AF115283_1 ribosomal protein S10 [Leptospira interrogans]
 gi|24194208|gb|AAN47937.1| 30S ribosomal protein S10 [Leptospira interrogans serovar Lai str.
           56601]
 gi|45601948|gb|AAS71427.1| 30S ribosomal protein S10 [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|116119967|gb|ABJ78010.1| 30S Ribosomal protein S10 [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116120007|gb|ABJ78050.1| 30S Ribosomal protein S10 [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116125812|gb|ABJ77083.1| 30S Ribosomal protein S10 [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 102

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 50/97 (51%), Positives = 69/97 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + LKAFD R++D S  EIV T K++G+ + GPIP P     +TV RSPHV+KKSR+Q
Sbjct: 5   KIRVKLKAFDHRLIDQSTYEIVATAKRTGATVSGPIPLPTKKEIYTVLRSPHVNKKSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E++ +KRL+ I+     TV+ALMKL + AGV+V IK
Sbjct: 65  FELKTHKRLIDILDTNEDTVEALMKLQLPAGVSVDIK 101


>gi|164686526|ref|ZP_02210554.1| hypothetical protein CLOBAR_00093 [Clostridium bartlettii DSM
           16795]
 gi|164604395|gb|EDQ97860.1| hypothetical protein CLOBAR_00093 [Clostridium bartlettii DSM
           16795]
          Length = 103

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 74/102 (72%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           ++N +I I LK++D ++LD S  +IV T KK+GSQ+ GP+P P   +  T+ R+ H  K 
Sbjct: 2   AKNEKIRIRLKSYDHKLLDFSAGKIVETAKKAGSQVSGPVPLPTEKQVVTILRAVHKYKD 61

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           SR+Q E+R +KRL+ I  PTP+TVD+LM+LD+ AGV++ IKL
Sbjct: 62  SREQFEIRTHKRLIDITSPTPKTVDSLMRLDLPAGVDIEIKL 103


>gi|296130496|ref|YP_003637746.1| ribosomal protein S10 [Cellulomonas flavigena DSM 20109]
 gi|296022311|gb|ADG75547.1| ribosomal protein S10 [Cellulomonas flavigena DSM 20109]
          Length = 102

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 71/104 (68%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LK++D  ++DSS R+IV T  ++G+ +VGP+P P     F V RSPH  
Sbjct: 1   MAGQKIRIR--LKSYDHEVIDSSARKIVDTVTRAGASVVGPVPLPTEKNVFCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+  EMR +KRL+ II PTP+ VD+LM+LD+ A VN+ IKL
Sbjct: 59  KDSREHFEMRTHKRLIDIIDPTPKAVDSLMRLDLPADVNIEIKL 102


>gi|222152264|ref|YP_002561439.1| 30S ribosomal protein S10 [Streptococcus uberis 0140J]
 gi|225867664|ref|YP_002743612.1| 30S ribosomal protein S10 [Streptococcus equi subsp. zooepidemicus]
 gi|225869535|ref|YP_002745482.1| 30S ribosomal protein S10 [Streptococcus equi subsp. equi 4047]
 gi|251781514|ref|YP_002995815.1| 30S ribosomal protein S10 [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
 gi|329115727|ref|ZP_08244444.1| ribosomal protein S10 [Streptococcus parauberis NCFD 2020]
 gi|254765350|sp|B9DSU9|RS10_STRU0 RecName: Full=30S ribosomal protein S10
 gi|254809986|sp|C0MBW5|RS10_STRE4 RecName: Full=30S ribosomal protein S10
 gi|259494604|sp|C0MCA9|RS10_STRS7 RecName: Full=30S ribosomal protein S10
 gi|222113075|emb|CAR40438.1| 30S ribosomal protein S10 [Streptococcus uberis 0140J]
 gi|225698939|emb|CAW91965.1| 30S ribosomal protein S10 [Streptococcus equi subsp. equi 4047]
 gi|225700940|emb|CAW97643.1| 30S ribosomal protein S10 [Streptococcus equi subsp. zooepidemicus]
 gi|242390142|dbj|BAH80601.1| 30S ribosomal protein S10 [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
 gi|322410857|gb|EFY01765.1| 30S ribosomal protein S10 [Streptococcus dysgalactiae subsp.
           dysgalactiae ATCC 27957]
 gi|323126310|gb|ADX23607.1| 30S ribosomal protein S10 [Streptococcus dysgalactiae subsp.
           equisimilis ATCC 12394]
 gi|326906132|gb|EGE53046.1| ribosomal protein S10 [Streptococcus parauberis NCFD 2020]
          Length = 102

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 70/100 (70%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA++ R LD++  +IV T  ++G+ + GP+P P     +T+ R+ H  K SR
Sbjct: 3   NKKIRIRLKAYEHRTLDTAAEKIVETATRTGATVAGPVPLPTERSLYTIIRATHKYKDSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KRL+ I+ PT +TVDALMKLD+ +GVNV IKL
Sbjct: 63  EQFEMRTHKRLIDIVNPTQKTVDALMKLDLPSGVNVEIKL 102


>gi|118443189|ref|YP_877197.1| 30S ribosomal protein S10 [Clostridium novyi NT]
 gi|168187815|ref|ZP_02622450.1| ribosomal protein S10 [Clostridium botulinum C str. Eklund]
 gi|166231264|sp|A0PXU5|RS10_CLONN RecName: Full=30S ribosomal protein S10
 gi|118133645|gb|ABK60689.1| ribosomal protein S10 [Clostridium novyi NT]
 gi|169294365|gb|EDS76498.1| ribosomal protein S10 [Clostridium botulinum C str. Eklund]
          Length = 102

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 70/100 (70%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKAFD  ILD S  +IV T K +G+++ GP+P P      T+ R+ H  K SR
Sbjct: 3   NQKIRIRLKAFDHNILDQSAEKIVETAKNTGAKVAGPVPLPTEKDVVTILRATHKYKDSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q E+R +KRL+ I+ P+P+TVDALM+LD+ AGV++ IKL
Sbjct: 63  EQFEIRTHKRLIDILSPSPKTVDALMRLDLPAGVDIEIKL 102


>gi|57236893|ref|YP_179846.1| 30S ribosomal protein S10 [Campylobacter jejuni RM1221]
 gi|57504572|ref|ZP_00370684.1| ribosomal protein S10 [Campylobacter coli RM2228]
 gi|121613565|ref|YP_001001352.1| 30S ribosomal protein S10 [Campylobacter jejuni subsp. jejuni
           81-176]
 gi|148926799|ref|ZP_01810478.1| 30S ribosomal protein S10 [Campylobacter jejuni subsp. jejuni
           CG8486]
 gi|157415930|ref|YP_001483186.1| 30S ribosomal protein S10 [Campylobacter jejuni subsp. jejuni
           81116]
 gi|167006241|ref|ZP_02271999.1| ribosomal protein S10p/S20e [Campylobacter jejuni subsp. jejuni
           81-176]
 gi|205355722|ref|ZP_03222492.1| 30S ribosomal protein S10 [Campylobacter jejuni subsp. jejuni
           CG8421]
 gi|218563294|ref|YP_002345074.1| 30S ribosomal protein S10 [Campylobacter jejuni subsp. jejuni NCTC
           11168]
 gi|283953681|ref|ZP_06371212.1| 30S ribosomal protein S10 [Campylobacter jejuni subsp. jejuni 414]
 gi|283956164|ref|ZP_06373649.1| 30S ribosomal protein S10 [Campylobacter jejuni subsp. jejuni 1336]
 gi|305432597|ref|ZP_07401758.1| 30S ribosomal protein S10 [Campylobacter coli JV20]
 gi|17865604|sp|Q9PLX0|RS10_CAMJE RecName: Full=30S ribosomal protein S10
 gi|81557379|sp|Q5HS89|RS10_CAMJR RecName: Full=30S ribosomal protein S10
 gi|166231257|sp|A1W1W1|RS10_CAMJJ RecName: Full=30S ribosomal protein S10
 gi|172047271|sp|A8FP22|RS10_CAMJ8 RecName: Full=30S ribosomal protein S10
 gi|57019467|gb|EAL56161.1| ribosomal protein S10 [Campylobacter coli RM2228]
 gi|57165697|gb|AAW34476.1| ribosomal protein S10 [Campylobacter jejuni RM1221]
 gi|87249044|gb|EAQ72006.1| ribosomal protein S10 [Campylobacter jejuni subsp. jejuni 81-176]
 gi|112361001|emb|CAL35802.1| 30S ribosomal protein S10 [Campylobacter jejuni subsp. jejuni NCTC
           11168]
 gi|145844524|gb|EDK21631.1| 30S ribosomal protein S10 [Campylobacter jejuni subsp. jejuni
           CG8486]
 gi|157386894|gb|ABV53209.1| 30S ribosomal protein S10 [Campylobacter jejuni subsp. jejuni
           81116]
 gi|205346499|gb|EDZ33132.1| 30S ribosomal protein S10 [Campylobacter jejuni subsp. jejuni
           CG8421]
 gi|283792318|gb|EFC31102.1| 30S ribosomal protein S10 [Campylobacter jejuni subsp. jejuni 1336]
 gi|283794722|gb|EFC33460.1| 30S ribosomal protein S10 [Campylobacter jejuni subsp. jejuni 414]
 gi|284926899|gb|ADC29251.1| 30S ribosomal protein S10 [Campylobacter jejuni subsp. jejuni
           IA3902]
 gi|304444308|gb|EFM36960.1| 30S ribosomal protein S10 [Campylobacter coli JV20]
 gi|307748568|gb|ADN91838.1| 30S ribosomal protein S10 [Campylobacter jejuni subsp. jejuni M1]
 gi|315059154|gb|ADT73483.1| SSU ribosomal protein S10p [Campylobacter jejuni subsp. jejuni S3]
 gi|315930643|gb|EFV09665.1| ribosomal protein S10 [Campylobacter jejuni subsp. jejuni 305]
          Length = 103

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 71/97 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI + LKA+D R+LD ++  IV   K++G+ I GPIP P  I+R+TV +SPH++K SR+Q
Sbjct: 3   RIRLKLKAYDHRVLDRTVAAIVEAVKRTGADIRGPIPMPTKIKRYTVLKSPHINKDSREQ 62

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E+RI+ R+L I+  TP TVD+L KLD+A  V+V ++
Sbjct: 63  FEIRIHARMLDIVAATPDTVDSLTKLDLAPEVSVEVR 99


>gi|167342342|gb|ABZ69128.1| 30S ribosomal protein S10 [Borrelia valaisiana VS116]
          Length = 97

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 70/96 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + L +FD +ILD S   IV   +K+ +QI GPIP P  I+++TV RSPHV+KKSR+Q
Sbjct: 2   KIRVRLFSFDVKILDQSAESIVKAVQKAKAQIKGPIPLPTKIKKYTVLRSPHVNKKSREQ 61

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVI 102
            EMR +KRL+ I++PT   +D+LMKL++ AGV V I
Sbjct: 62  FEMRTHKRLIDILEPTSALMDSLMKLELPAGVEVDI 97


>gi|146297286|ref|YP_001181057.1| ribosomal protein S10 [Caldicellulosiruptor saccharolyticus DSM
           8903]
 gi|166231253|sp|A4XLT1|RS10_CALS8 RecName: Full=30S ribosomal protein S10
 gi|145410862|gb|ABP67866.1| SSU ribosomal protein S10P [Caldicellulosiruptor saccharolyticus
           DSM 8903]
          Length = 106

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 74/102 (72%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           S+  R+ I LK+FD ++LD S R+IV T K +G+++ GP+P P      T+ R+PH  K 
Sbjct: 2   SKAQRMRIKLKSFDYKLLDQSARKIVETAKSTGAEVSGPVPLPTDREVITIIRAPHKYKD 61

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           SR+Q E++ +KRL+ IIKPT +TVDALM++++ AGV++ IKL
Sbjct: 62  SREQFEIKTHKRLIDIIKPTQKTVDALMRVELPAGVDIEIKL 103


>gi|15618460|ref|NP_224745.1| 30S ribosomal protein S10 [Chlamydophila pneumoniae CWL029]
 gi|15836080|ref|NP_300604.1| 30S ribosomal protein S10 [Chlamydophila pneumoniae J138]
 gi|16752492|ref|NP_444754.1| 30S ribosomal protein S10 [Chlamydophila pneumoniae AR39]
 gi|161484686|ref|NP_876842.2| 30S ribosomal protein S10 [Chlamydophila pneumoniae TW-183]
 gi|7388120|sp|Q9Z803|RS10_CHLPN RecName: Full=30S ribosomal protein S10
 gi|4376840|gb|AAD18689.1| S10 Ribosomal Protein [Chlamydophila pneumoniae CWL029]
 gi|7189134|gb|AAF38075.1| ribosomal protein S10 [Chlamydophila pneumoniae AR39]
 gi|8978920|dbj|BAA98755.1| S10 ribosomal protein [Chlamydophila pneumoniae J138]
 gi|269303424|gb|ACZ33524.1| ribosomal protein S10 [Chlamydophila pneumoniae LPCoLN]
          Length = 105

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 71/103 (68%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +  +I I LK FD   LD S  +IV T K++G+++VGPIP P     +TV RSPHVD
Sbjct: 1   MKQQKQKIRIRLKGFDQGQLDRSTADIVETAKRTGARVVGPIPLPTKREVYTVLRSPHVD 60

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           KKSR+Q E+R +KRL+ I+ PT +T+DAL  L + AGV++ IK
Sbjct: 61  KKSREQFEIRTHKRLVDILDPTGKTIDALKMLALPAGVDIKIK 103


>gi|291277269|ref|YP_003517041.1| 30S ribosomal protein S10 [Helicobacter mustelae 12198]
 gi|290964463|emb|CBG40313.1| 30S ribosomal protein S10 [Helicobacter mustelae 12198]
          Length = 103

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 70/96 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + LKA+D R+LD S+  I+   K++GS I GPIP P   RR+TV RSPH++K SR+Q
Sbjct: 3   KIRLKLKAYDHRVLDRSVVSIIEAVKRTGSDIKGPIPLPTKNRRYTVLRSPHINKDSREQ 62

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVI 102
            E+R++ R++ I+  TP TVD+LMKLD+A  V+V +
Sbjct: 63  FEIRVHSRIIDIMSATPDTVDSLMKLDLAPEVDVEV 98


>gi|167342350|gb|ABZ69132.1| 30S ribosomal protein S10 [Borrelia afzelii]
 gi|167342356|gb|ABZ69135.1| 30S ribosomal protein S10 [Borrelia valaisiana]
 gi|167342360|gb|ABZ69137.1| 30S ribosomal protein S10 [Borrelia garinii]
          Length = 96

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 69/94 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + L +FD +ILD S   IV   +K+ +QI GPIP P  I+++TV RSPHV+KKSR+Q
Sbjct: 2   KIRVRLFSFDVKILDQSAESIVKAVQKAKAQIKGPIPLPTKIKKYTVLRSPHVNKKSREQ 61

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNV 100
            EMR +KRL+ I++PT   +D+LMKL++ AGV V
Sbjct: 62  FEMRTHKRLIDILEPTSALMDSLMKLELPAGVEV 95


>gi|289450508|ref|YP_003475785.1| 30S ribosomal protein S10 [Clostridiales genomosp. BVAB3 str.
           UPII9-5]
 gi|289185055|gb|ADC91480.1| ribosomal protein S10 [Clostridiales genomosp. BVAB3 str. UPII9-5]
          Length = 103

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 68/100 (68%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKAFD  +LD S   IV T K +G+ + GPIP P      T+ RSPH  K +R
Sbjct: 4   NQKIRIRLKAFDHNLLDQSAARIVDTAKGTGASVSGPIPLPTEKEITTILRSPHKHKDAR 63

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q E+RI+KRL+ ++ P  +TV++LMKLDI AGVN+ IKL
Sbjct: 64  EQFELRIHKRLIDVLAPNQKTVESLMKLDIPAGVNIEIKL 103


>gi|313891538|ref|ZP_07825148.1| ribosomal protein S10 [Dialister microaerophilus UPII 345-E]
 gi|329121827|ref|ZP_08250442.1| 30S ribosomal protein S10 [Dialister micraerophilus DSM 19965]
 gi|313119997|gb|EFR43179.1| ribosomal protein S10 [Dialister microaerophilus UPII 345-E]
 gi|327467765|gb|EGF13257.1| 30S ribosomal protein S10 [Dialister micraerophilus DSM 19965]
          Length = 103

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 47/101 (46%), Positives = 72/101 (71%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           S+  +I I LK +D + +D S  +I  T K++GS++ GPIP P     +T+ RSPHV+K 
Sbjct: 2   SKQEKIRIRLKGYDHKAVDQSAAKIAETAKRTGSRVSGPIPLPTERNVYTILRSPHVNKD 61

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           SR+Q EMR++KRL+ I+ P+ +T DALM+L++ AGV++ IK
Sbjct: 62  SREQFEMRVHKRLIDILDPSKKTADALMRLELPAGVSIEIK 102


>gi|256831826|ref|YP_003160553.1| 30S ribosomal protein S10 [Jonesia denitrificans DSM 20603]
 gi|269796256|ref|YP_003315711.1| 30S ribosomal protein S10P [Sanguibacter keddieii DSM 10542]
 gi|256685357|gb|ACV08250.1| ribosomal protein S10 [Jonesia denitrificans DSM 20603]
 gi|269098441|gb|ACZ22877.1| SSU ribosomal protein S10P [Sanguibacter keddieii DSM 10542]
          Length = 102

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 71/104 (68%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LK++D  ++DSS R+IV T  ++G+ +VGP+P P     F V RSPH  
Sbjct: 1   MAGQKIRIR--LKSYDHEVIDSSARKIVDTVTRAGATVVGPVPLPTEKNVFCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+  EMR +KRL+ II PTP+ VD+LM+LD+ A VN+ IKL
Sbjct: 59  KDSREHFEMRTHKRLIDIIDPTPKAVDSLMRLDLPADVNIEIKL 102


>gi|225860250|ref|YP_002741759.1| 30S ribosomal protein S10 [Streptococcus pneumoniae Taiwan19F-14]
 gi|254765353|sp|C1CP87|RS10_STRZT RecName: Full=30S ribosomal protein S10
 gi|225727615|gb|ACO23466.1| ribosomal protein S10 [Streptococcus pneumoniae Taiwan19F-14]
          Length = 102

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 70/100 (70%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA+  R LD++  +IV +  ++G+Q+ GPIP P     +T+ R+ H  K SR
Sbjct: 3   NKKIRIRLKAYKHRTLDTAAAKIVESATRTGAQVAGPIPLPTERSLYTIIRATHKYKDSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KRL+ I+ PT +TVDALMKLD+ +GVNV IKL
Sbjct: 63  EQFEMRTHKRLIDIVNPTQKTVDALMKLDLPSGVNVEIKL 102


>gi|126697639|ref|YP_001086536.1| 30S ribosomal protein S10 [Clostridium difficile 630]
 gi|118597170|sp|Q18CF6|RS10_CLOD6 RecName: Full=30S ribosomal protein S10
 gi|115249076|emb|CAJ66887.1| 30S ribosomal protein S10 [Clostridium difficile]
          Length = 103

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 74/102 (72%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           ++N +I I LK++D ++LD S  +IV T KK+GSQ+ GP+P P   +  T+ R+ H  K 
Sbjct: 2   AKNEKIRIRLKSYDHKLLDFSAGKIVETAKKAGSQVSGPVPLPTEKQVVTILRAVHKYKY 61

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           SR+Q E+R +KRL+ I  PTP+TVD+LM+LD+ AGV++ IKL
Sbjct: 62  SREQFEIRTHKRLIDIANPTPKTVDSLMRLDLPAGVDIEIKL 103


>gi|331268412|ref|YP_004394904.1| 30S ribosomal protein S10 [Clostridium botulinum BKT015925]
 gi|329124962|gb|AEB74907.1| ribosomal protein S10 [Clostridium botulinum BKT015925]
          Length = 117

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 70/100 (70%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKAFD  ILD S  +IV T K +G+++ GP+P P      T+ R+ H  K SR
Sbjct: 18  NQKIRIRLKAFDHTILDQSAEKIVETAKNTGAKVAGPVPLPTEKDVVTILRATHKYKDSR 77

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q E+R +KRL+ I+ P+P+TVDALM+LD+ AGV++ IKL
Sbjct: 78  EQFEIRTHKRLIDILSPSPKTVDALMRLDLPAGVDIEIKL 117


>gi|195977207|ref|YP_002122451.1| 30S ribosomal protein S10 [Streptococcus equi subsp. zooepidemicus
           MGCS10565]
 gi|226705627|sp|B4U4Z9|RS10_STREM RecName: Full=30S ribosomal protein S10
 gi|195973912|gb|ACG61438.1| 30S ribosomal protein S10 [Streptococcus equi subsp. zooepidemicus
           MGCS10565]
          Length = 102

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 70/100 (70%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA++ R LD++  +IV T  ++G+ + GP+P P     +T+ R+ H  K SR
Sbjct: 3   NKKIRIRLKAYEHRTLDTAAEKIVETATRTGATVAGPVPLPTERSLYTIIRATHKYKDSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KRL+ I+ PT +TVDALMKLD+ +GVNV IKL
Sbjct: 63  EQFEMRTHKRLIDIVNPTQKTVDALMKLDLPSGVNVKIKL 102


>gi|157363441|ref|YP_001470208.1| 30S ribosomal protein S10 [Thermotoga lettingae TMO]
 gi|166991573|sp|A8F4R0|RS10_THELT RecName: Full=30S ribosomal protein S10
 gi|157314045|gb|ABV33144.1| ribosomal protein S10 [Thermotoga lettingae TMO]
          Length = 102

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D  +LD S ++IV   K + ++I GPIP P     + V RSPH  K SR+Q
Sbjct: 5   KIRIKLKAYDHEVLDESAKKIVEVAKSTNAKISGPIPLPTERALYVVLRSPHKHKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R++KRL+ II+P+P+T+DALMK+++ AGV+V IKL
Sbjct: 65  FEKRVHKRLIDIIEPSPKTIDALMKINLPAGVDVEIKL 102


>gi|254414607|ref|ZP_05028372.1| ribosomal protein S10 [Microcoleus chthonoplastes PCC 7420]
 gi|196178455|gb|EDX73454.1| ribosomal protein S10 [Microcoleus chthonoplastes PCC 7420]
          Length = 134

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD R+LD+S  +IV T  ++ +  VGPIP P   R + V RSPHVDK SR+ 
Sbjct: 37  KIRIRLKAFDRRLLDTSCEKIVDTANRTNAAAVGPIPLPTKRRIYCVLRSPHVDKDSREH 96

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R ++RL+ I +P+ +T+DALMKLD+ AGV++ +KL
Sbjct: 97  FETRTHRRLIDIYQPSSKTIDALMKLDLPAGVDIEVKL 134


>gi|70725802|ref|YP_252716.1| 30S ribosomal protein S10 [Staphylococcus haemolyticus JCSC1435]
 gi|82581611|sp|Q4L8B5|RS10_STAHJ RecName: Full=30S ribosomal protein S10
 gi|68446526|dbj|BAE04110.1| 30S ribosomal protein S10 [Staphylococcus haemolyticus JCSC1435]
          Length = 102

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D R++D S  +IV T K+SG+++ GPIP P     +T+ R+ H+ K SR+Q
Sbjct: 5   KIRIRLKAYDHRVIDQSAEKIVETAKRSGAEVSGPIPLPTEKSVYTIIRAVHMYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R +KRL+ I+ PTP+TVDALM L++ +GV++ IKL
Sbjct: 65  FEQRTHKRLIDIVNPTPKTVDALMGLNLPSGVDIEIKL 102


>gi|330831919|ref|YP_004400744.1| ribosomal protein S10 [Streptococcus suis ST3]
 gi|329306142|gb|AEB80558.1| ribosomal protein S10 [Streptococcus suis ST3]
          Length = 102

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 70/100 (70%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA++ R LD++  +IV T  ++G+Q+ GP+P P     +T+ R+ H  K SR
Sbjct: 3   NKKIRIRLKAYEHRTLDTAAAKIVETATRTGAQVAGPVPLPTERSLYTIIRATHKYKDSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KRL+ II PT +TVDALMKL + +GVNV IKL
Sbjct: 63  EQFEMRTHKRLIDIINPTQKTVDALMKLALPSGVNVEIKL 102


>gi|209527552|ref|ZP_03276054.1| ribosomal protein S10 [Arthrospira maxima CS-328]
 gi|284053269|ref|ZP_06383479.1| 30S ribosomal protein S10 [Arthrospira platensis str. Paraca]
 gi|1350919|sp|P48852|RS10_SPIPL RecName: Full=30S ribosomal protein S10
 gi|406274|emb|CAA79773.1| ribosomal protein S10 [Arthrospira platensis]
 gi|209492040|gb|EDZ92393.1| ribosomal protein S10 [Arthrospira maxima CS-328]
 gi|291569319|dbj|BAI91591.1| 30S ribosomal protein S10 [Arthrospira platensis NIES-39]
          Length = 105

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD R+LD+S  +IV T  ++G+  +GPIP P   R + V RSPHVDK SR+ 
Sbjct: 8   KIRIRLKAFDRRLLDTSCEKIVDTANRTGATALGPIPLPTKRRIYCVLRSPHVDKDSREH 67

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R ++R++ I +P+ +T+DALMKLD+ AGV++ +KL
Sbjct: 68  FETRTHRRIIDIYQPSSKTIDALMKLDLPAGVDIEVKL 105


>gi|57505357|ref|ZP_00371286.1| ribosomal protein S10 [Campylobacter upsaliensis RM3195]
 gi|57016493|gb|EAL53278.1| ribosomal protein S10 [Campylobacter upsaliensis RM3195]
          Length = 103

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 71/97 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI + LKA+D R+LD ++  IV   K++G+ I GP+P P  I+R+TV +SPH++K SR+Q
Sbjct: 3   RIRLKLKAYDHRVLDRTVAAIVEAVKRTGADIRGPVPMPTKIKRYTVLKSPHINKDSREQ 62

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E+RI+ R+L I+  TP TVD+L KLD+A  V+V ++
Sbjct: 63  FEIRIHARMLDIVAATPDTVDSLTKLDLAPEVSVEVR 99


>gi|253682574|ref|ZP_04863371.1| ribosomal protein S10 [Clostridium botulinum D str. 1873]
 gi|253562286|gb|EES91738.1| ribosomal protein S10 [Clostridium botulinum D str. 1873]
          Length = 102

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 70/100 (70%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKAFD  ILD S  +IV T K +G+++ GP+P P      T+ R+ H  K SR
Sbjct: 3   NQKIRIRLKAFDHTILDQSAEKIVETAKNTGAKVAGPVPLPTEKDVVTILRATHKYKDSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q E+R +KRL+ I+ P+P+TVDALM+LD+ AGV++ IKL
Sbjct: 63  EQFEIRTHKRLIDILSPSPKTVDALMRLDLPAGVDIEIKL 102


>gi|116628599|ref|YP_821218.1| 30S ribosomal protein S10 [Streptococcus thermophilus LMD-9]
 gi|122266807|sp|Q03IF0|RS10_STRTD RecName: Full=30S ribosomal protein S10
 gi|116101876|gb|ABJ67022.1| SSU ribosomal protein S10P [Streptococcus thermophilus LMD-9]
 gi|312279260|gb|ADQ63917.1| Orn/Lys/Arg decarboxylase, major region [Streptococcus thermophilus
           ND03]
          Length = 102

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 70/100 (70%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA++ R LD++  +IV T  ++G+ + GP+P P     +T+ R+ H  K SR
Sbjct: 3   NKKIRIRLKAYEHRTLDTAAGKIVETATRTGATVAGPVPLPTERSLYTIIRATHKYKDSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KRL+ II PT +TVDALMKLD+ +GVNV IKL
Sbjct: 63  EQFEMRTHKRLIDIINPTQKTVDALMKLDLPSGVNVEIKL 102


>gi|37523498|ref|NP_926875.1| 30S ribosomal protein S10 [Gloeobacter violaceus PCC 7421]
 gi|44888385|sp|Q7NEF1|RS10_GLOVI RecName: Full=30S ribosomal protein S10
 gi|35214502|dbj|BAC91870.1| 30S ribosomal protein S10 [Gloeobacter violaceus PCC 7421]
          Length = 104

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 73/104 (70%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           +T + IRI   L+AFD  +LD S  +IV T  ++ +  VGPIP P  IRR+ V RSPHVD
Sbjct: 3   LTQQKIRIR--LQAFDHGLLDQSCSKIVDTANRTNAAAVGPIPLPTRIRRYCVLRSPHVD 60

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+  E R ++R++ I +P+ +T+DALM+LD+ AGV++ +KL
Sbjct: 61  KDSREHFETRTHRRIIDIYQPSAKTIDALMRLDLPAGVDIEVKL 104


>gi|148284215|ref|YP_001248305.1| 30S ribosomal protein S10 [Orientia tsutsugamushi str. Boryong]
 gi|146739654|emb|CAM79443.1| 30S ribosomal protein S10 [Orientia tsutsugamushi str. Boryong]
          Length = 104

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 73/102 (71%), Gaps = 2/102 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M+S++IRI   LK+FD  +LD +  EIV   K +G+++ G +  PR I+ FT N+SPH+ 
Sbjct: 4   MSSKDIRIR--LKSFDHALLDRTTFEIVRLAKSAGAKVKGAVSLPRRIQYFTFNKSPHIY 61

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVI 102
           KKSR+Q E+R +KRL+ I   TPQT++ALMK+ +A GV+V I
Sbjct: 62  KKSREQFEIRTHKRLIVIASSTPQTIEALMKMTLAPGVDVQI 103


>gi|269955434|ref|YP_003325223.1| 30S ribosomal protein S10 [Xylanimonas cellulosilytica DSM 15894]
 gi|269304115|gb|ACZ29665.1| ribosomal protein S10 [Xylanimonas cellulosilytica DSM 15894]
          Length = 102

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 69/98 (70%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++DSS R+IV T  ++G+ +VGP+P P     F V RSPH  K SR+ 
Sbjct: 5   KIRIRLKSYDHEVIDSSARKIVDTVTRAGATVVGPVPLPTEKNVFVVIRSPHKYKDSREH 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ II PTP+ VD+LM++D+ A VN+ IKL
Sbjct: 65  FEMRTHKRLIDIIDPTPKAVDSLMRIDLPADVNIEIKL 102


>gi|33236411|gb|AAP98499.1| ribosomal protein S10 [Chlamydophila pneumoniae TW-183]
          Length = 112

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 71/103 (68%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +  +I I LK FD   LD S  +IV T K++G+++VGPIP P     +TV RSPHVD
Sbjct: 8   MKQQKQKIRIRLKGFDQGQLDRSTADIVETAKRTGARVVGPIPLPTKREVYTVLRSPHVD 67

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           KKSR+Q E+R +KRL+ I+ PT +T+DAL  L + AGV++ IK
Sbjct: 68  KKSREQFEIRTHKRLVDILDPTGKTIDALKMLALPAGVDIKIK 110


>gi|188996240|ref|YP_001930491.1| ribosomal protein S10 [Sulfurihydrogenibium sp. YO3AOP1]
 gi|237755895|ref|ZP_04584488.1| ribosomal protein S10 [Sulfurihydrogenibium yellowstonense SS-5]
 gi|254765354|sp|B2V7L4|RS10_SULSY RecName: Full=30S ribosomal protein S10
 gi|188931307|gb|ACD65937.1| ribosomal protein S10 [Sulfurihydrogenibium sp. YO3AOP1]
 gi|237691945|gb|EEP60960.1| ribosomal protein S10 [Sulfurihydrogenibium yellowstonense SS-5]
          Length = 102

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 69/98 (70%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD ++LD S+++IV T K+ G  + GPIP P   R + V+RSPH  ++SR+ 
Sbjct: 4   KIRIKLKAFDHKVLDQSVKQIVDTVKRGGGLVKGPIPLPTRRRVWCVHRSPHKFEQSREH 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMRI+KRL+ I   TPQT++ALM + + AGV V IKL
Sbjct: 64  FEMRIHKRLIEIENATPQTIEALMDISLPAGVEVEIKL 101


>gi|163847922|ref|YP_001635966.1| 30S ribosomal protein S10 [Chloroflexus aurantiacus J-10-fl]
 gi|219849888|ref|YP_002464321.1| 30S ribosomal protein S10 [Chloroflexus aggregans DSM 9485]
 gi|222525802|ref|YP_002570273.1| 30S ribosomal protein S10 [Chloroflexus sp. Y-400-fl]
 gi|189040364|sp|A9WH65|RS10_CHLAA RecName: Full=30S ribosomal protein S10
 gi|254809598|sp|B9LJD1|RS10_CHLSY RecName: Full=30S ribosomal protein S10
 gi|254809599|sp|B8G6S6|RS10_CHLAD RecName: Full=30S ribosomal protein S10
 gi|163669211|gb|ABY35577.1| ribosomal protein S10 [Chloroflexus aurantiacus J-10-fl]
 gi|219544147|gb|ACL25885.1| ribosomal protein S10 [Chloroflexus aggregans DSM 9485]
 gi|222449681|gb|ACM53947.1| ribosomal protein S10 [Chloroflexus sp. Y-400-fl]
          Length = 102

 Score =  102 bits (253), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 45/98 (45%), Positives = 73/98 (74%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           ++ I LKA+D +ILD S R+IV   +++G+ + GP+P P  I R++V RS  +DK S++Q
Sbjct: 5   KVRIRLKAYDHKILDQSARQIVEAAERTGALVAGPVPLPTKIERYSVIRSGFIDKDSQEQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRL+ ++ P+ QT++ALMKL++ AGV++ IKL
Sbjct: 65  FEIRTHKRLIDVLDPSQQTINALMKLNLPAGVDIEIKL 102


>gi|84494787|ref|ZP_00993906.1| 30S ribosomal protein S10 [Janibacter sp. HTCC2649]
 gi|317125873|ref|YP_004099985.1| 30S ribosomal protein S10P [Intrasporangium calvum DSM 43043]
 gi|84384280|gb|EAQ00160.1| 30S ribosomal protein S10 [Janibacter sp. HTCC2649]
 gi|315589961|gb|ADU49258.1| SSU ribosomal protein S10P [Intrasporangium calvum DSM 43043]
          Length = 102

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 69/98 (70%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++D+S R+IV T  ++G+ +VGP+P P     F V RSPH  K SR+ 
Sbjct: 5   KIRIRLKSYDHEVIDNSARKIVDTVTRAGATVVGPVPLPTEKNVFVVIRSPHKYKDSREH 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ II PTP+ VD+LM+LD+ A VN+ IKL
Sbjct: 65  FEMRTHKRLIDIIDPTPKAVDSLMRLDLPADVNIEIKL 102


>gi|256825887|ref|YP_003149847.1| 30S ribosomal protein S10P [Kytococcus sedentarius DSM 20547]
 gi|309812387|ref|ZP_07706142.1| ribosomal protein S10 [Dermacoccus sp. Ellin185]
 gi|256689280|gb|ACV07082.1| SSU ribosomal protein S10P [Kytococcus sedentarius DSM 20547]
 gi|308433692|gb|EFP57569.1| ribosomal protein S10 [Dermacoccus sp. Ellin185]
          Length = 102

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 71/104 (68%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LK++D  ++DSS R+IV T  ++G+ +VGP+P P     F V RSPH  
Sbjct: 1   MAGQKIRIR--LKSYDHEVIDSSARKIVDTVTRAGATVVGPVPLPTEKNVFCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+  EMR +KRL+ I+ PTP+ VD+LM+LD+ A VN+ IKL
Sbjct: 59  KDSREHFEMRTHKRLIDIVDPTPKAVDSLMRLDLPADVNIEIKL 102


>gi|328949278|ref|YP_004366615.1| 30S ribosomal protein S10 [Treponema succinifaciens DSM 2489]
 gi|328449602|gb|AEB15318.1| 30S ribosomal protein S10 [Treponema succinifaciens DSM 2489]
          Length = 102

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 73/99 (73%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I + L+AFD  ++D S ++IV   +K+G+++ GPIP P  I + TV RSP V+KKSR
Sbjct: 3   NGKIRVRLRAFDVALIDQSAKDIVQQVQKAGAKVSGPIPLPTRINKVTVLRSPFVNKKSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           +Q EMR +KRL+ I +P+ + +D+LMKL++ AGV+V IK
Sbjct: 63  EQFEMRTHKRLIDIFEPSSEVMDSLMKLELPAGVDVEIK 101


>gi|21223081|ref|NP_628860.1| 30S ribosomal protein S10 [Streptomyces coelicolor A3(2)]
 gi|29831468|ref|NP_826102.1| 30S ribosomal protein S10 [Streptomyces avermitilis MA-4680]
 gi|182436628|ref|YP_001824347.1| 30S ribosomal protein S10 [Streptomyces griseus subsp. griseus NBRC
           13350]
 gi|239929515|ref|ZP_04686468.1| 30S ribosomal protein S10 [Streptomyces ghanaensis ATCC 14672]
 gi|239943576|ref|ZP_04695513.1| 30S ribosomal protein S10 [Streptomyces roseosporus NRRL 15998]
 gi|239980057|ref|ZP_04702581.1| 30S ribosomal protein S10 [Streptomyces albus J1074]
 gi|239990029|ref|ZP_04710693.1| 30S ribosomal protein S10 [Streptomyces roseosporus NRRL 11379]
 gi|254383173|ref|ZP_04998527.1| 30S ribosomal protein S10 [Streptomyces sp. Mg1]
 gi|254391394|ref|ZP_05006597.1| 30S ribosomal protein S10 [Streptomyces clavuligerus ATCC 27064]
 gi|256785824|ref|ZP_05524255.1| 30S ribosomal protein S10 [Streptomyces lividans TK24]
 gi|282860809|ref|ZP_06269875.1| ribosomal protein S10 [Streptomyces sp. ACTE]
 gi|289769716|ref|ZP_06529094.1| 30S ribosomal protein S10 [Streptomyces lividans TK24]
 gi|290958152|ref|YP_003489334.1| 30S ribosomal protein S10 [Streptomyces scabiei 87.22]
 gi|291437840|ref|ZP_06577230.1| 30S ribosomal protein S10 [Streptomyces ghanaensis ATCC 14672]
 gi|291447043|ref|ZP_06586433.1| 30S ribosomal protein S10 [Streptomyces roseosporus NRRL 15998]
 gi|291451914|ref|ZP_06591304.1| 30S ribosomal protein S10 [Streptomyces albus J1074]
 gi|294630892|ref|ZP_06709452.1| 30S ribosomal protein S10 [Streptomyces sp. e14]
 gi|294814466|ref|ZP_06773109.1| 30S ribosomal protein S10 [Streptomyces clavuligerus ATCC 27064]
 gi|295838403|ref|ZP_06825336.1| ribosomal protein S10 [Streptomyces sp. SPB74]
 gi|297192704|ref|ZP_06910102.1| 30S ribosomal protein S10 [Streptomyces pristinaespiralis ATCC
           25486]
 gi|297201728|ref|ZP_06919125.1| ribosomal protein S10 [Streptomyces sviceus ATCC 29083]
 gi|302519662|ref|ZP_07272004.1| ribosomal protein S10 [Streptomyces sp. SPB78]
 gi|302536250|ref|ZP_07288592.1| ribosomal protein S10 [Streptomyces sp. C]
 gi|302543362|ref|ZP_07295704.1| ribosomal protein S10 [Streptomyces hygroscopicus ATCC 53653]
 gi|302553541|ref|ZP_07305883.1| ribosomal protein S10 [Streptomyces viridochromogenes DSM 40736]
 gi|302558995|ref|ZP_07311337.1| 30S ribosomal protein S10 [Streptomyces griseoflavus Tu4000]
 gi|318058129|ref|ZP_07976852.1| 30S ribosomal protein S10 [Streptomyces sp. SA3_actG]
 gi|318076018|ref|ZP_07983350.1| 30S ribosomal protein S10 [Streptomyces sp. SA3_actF]
 gi|326442855|ref|ZP_08217589.1| 30S ribosomal protein S10 [Streptomyces clavuligerus ATCC 27064]
 gi|326777250|ref|ZP_08236515.1| 30S ribosomal protein S10 [Streptomyces cf. griseus XylebKG-1]
 gi|329938233|ref|ZP_08287684.1| 30S ribosomal protein S10 [Streptomyces griseoaurantiacus M045]
 gi|54039322|sp|P66338|RS10_STRAW RecName: Full=30S ribosomal protein S10
 gi|54042102|sp|P66337|RS10_STRCO RecName: Full=30S ribosomal protein S10
 gi|226705628|sp|B1W408|RS10_STRGG RecName: Full=30S ribosomal protein S10
 gi|7321291|emb|CAB82069.1| 30S ribosomal protein S10 [Streptomyces coelicolor A3(2)]
 gi|29608583|dbj|BAC72637.1| putative ribosomal protein S10 [Streptomyces avermitilis MA-4680]
 gi|178465144|dbj|BAG19664.1| putative 30S ribosomal protein S10 [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|194342072|gb|EDX23038.1| 30S ribosomal protein S10 [Streptomyces sp. Mg1]
 gi|197695800|gb|EDY42733.1| ribosomal protein S10 [Streptomyces sp. SPB74]
 gi|197705084|gb|EDY50896.1| 30S ribosomal protein S10 [Streptomyces clavuligerus ATCC 27064]
 gi|197710897|gb|EDY54931.1| ribosomal protein S10 [Streptomyces sviceus ATCC 29083]
 gi|197721641|gb|EDY65549.1| 30S ribosomal protein S10 [Streptomyces pristinaespiralis ATCC
           25486]
 gi|260647678|emb|CBG70783.1| 30S ribosomal protein S10 [Streptomyces scabiei 87.22]
 gi|282564545|gb|EFB70081.1| ribosomal protein S10 [Streptomyces sp. ACTE]
 gi|289699915|gb|EFD67344.1| 30S ribosomal protein S10 [Streptomyces lividans TK24]
 gi|291340735|gb|EFE67691.1| 30S ribosomal protein S10 [Streptomyces ghanaensis ATCC 14672]
 gi|291349990|gb|EFE76894.1| 30S ribosomal protein S10 [Streptomyces roseosporus NRRL 15998]
 gi|291354863|gb|EFE81765.1| 30S ribosomal protein S10 [Streptomyces albus J1074]
 gi|292834225|gb|EFF92574.1| 30S ribosomal protein S10 [Streptomyces sp. e14]
 gi|294327065|gb|EFG08708.1| 30S ribosomal protein S10 [Streptomyces clavuligerus ATCC 27064]
 gi|297159596|gb|ADI09308.1| 30S ribosomal protein S10 [Streptomyces bingchenggensis BCW-1]
 gi|302428557|gb|EFL00373.1| ribosomal protein S10 [Streptomyces sp. SPB78]
 gi|302445145|gb|EFL16961.1| ribosomal protein S10 [Streptomyces sp. C]
 gi|302460980|gb|EFL24073.1| ribosomal protein S10 [Streptomyces himastatinicus ATCC 53653]
 gi|302471159|gb|EFL34252.1| ribosomal protein S10 [Streptomyces viridochromogenes DSM 40736]
 gi|302476613|gb|EFL39706.1| 30S ribosomal protein S10 [Streptomyces griseoflavus Tu4000]
 gi|320009103|gb|ADW03953.1| ribosomal protein S10 [Streptomyces flavogriseus ATCC 33331]
 gi|326657583|gb|EGE42429.1| 30S ribosomal protein S10 [Streptomyces cf. griseus XylebKG-1]
 gi|328884425|emb|CCA57664.1| SSU ribosomal protein S10p [Streptomyces venezuelae ATCC 10712]
 gi|329302722|gb|EGG46612.1| 30S ribosomal protein S10 [Streptomyces griseoaurantiacus M045]
          Length = 102

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 72/104 (69%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LKA+D  ++DSS ++IV T  ++G+ + GP+P P     + V +SPH  
Sbjct: 1   MAGQKIRIR--LKAYDHEVIDSSAKKIVETVTRTGASVAGPVPLPTEKNVYCVIKSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+  EMR +KRL+ I+ PTP+TVD+LM+LD+ AGV++ IKL
Sbjct: 59  KDSREHFEMRTHKRLIDILDPTPKTVDSLMRLDLPAGVDIEIKL 102


>gi|310829586|ref|YP_003961943.1| ribosomal protein S10 [Eubacterium limosum KIST612]
 gi|308741320|gb|ADO38980.1| ribosomal protein S10 [Eubacterium limosum KIST612]
          Length = 102

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD ++LD S  +IV T K++G+ + GPIP P      T+ R+ H  K SR+Q
Sbjct: 5   KIRIRLKAFDHQLLDQSAEKIVETAKRTGASVSGPIPLPTDKEIITILRAVHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTP+TVDALM+L++ AGV++ IKL
Sbjct: 65  FEMRTHKRLIDILNPTPKTVDALMRLNLPAGVDIEIKL 102


>gi|300779846|ref|ZP_07089702.1| 30S ribosomal protein S10 [Corynebacterium genitalium ATCC 33030]
 gi|300533956|gb|EFK55015.1| 30S ribosomal protein S10 [Corynebacterium genitalium ATCC 33030]
          Length = 101

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 70/97 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D   +D+S ++IV T  ++G+++VGP+P P     + V RSPH DK SR+ 
Sbjct: 5   KIRIRLKAYDHEAIDASAKKIVETVTRTGARVVGPVPLPTEKNVYAVIRSPHKDKDSREH 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            EMR +KRL+ I+ PTP+TVDALM++D+ A V+V I+
Sbjct: 65  FEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNIQ 101


>gi|307244779|ref|ZP_07526880.1| ribosomal protein S10 [Peptostreptococcus stomatis DSM 17678]
 gi|306491877|gb|EFM63929.1| ribosomal protein S10 [Peptostreptococcus stomatis DSM 17678]
          Length = 103

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 73/102 (71%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           ++N +I I LK++D ++LD S  +IV T KK+GS + GPIP P   +  T+ R+ H  K 
Sbjct: 2   AKNEKIRIRLKSYDHKLLDYSAVKIVDTAKKAGSLVAGPIPLPTEKKVVTILRAVHKYKD 61

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           SR+Q E+R +KRL+ I  PTP+TVD+LMKLD+ AGV++ IKL
Sbjct: 62  SREQFEIRTHKRLIDIANPTPKTVDSLMKLDLPAGVDIEIKL 103


>gi|319955855|ref|YP_004167118.1| SSU ribosomal protein s10p [Nitratifractor salsuginis DSM 16511]
 gi|319418259|gb|ADV45369.1| SSU ribosomal protein S10P [Nitratifractor salsuginis DSM 16511]
          Length = 103

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 72/97 (74%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + LKA+D R+LD S+  IV   +++G+++ GPIP P  I+R+TV RSPH++K SR+Q
Sbjct: 3   KIRLKLKAYDHRVLDRSVASIVDAVRRTGAELRGPIPMPTKIKRYTVLRSPHINKDSREQ 62

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E+RI+ R++ I+  T +T+D+LMKLD+A  V V I+
Sbjct: 63  FEIRIHSRMIDIVSATSETIDSLMKLDLAPEVEVEIR 99


>gi|255654161|ref|ZP_05399570.1| 30S ribosomal protein S10 [Clostridium difficile QCD-23m63]
          Length = 103

 Score =  101 bits (251), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 73/102 (71%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           ++N +I I LK++D ++LD S  +IV T KK+GSQ+ GP+P P   +  T+ R+ H  K 
Sbjct: 2   AKNEKIRIRLKSYDHKLLDFSAGKIVETAKKAGSQVSGPVPLPTEKQVVTILRAVHKYKD 61

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           SR+Q E+R +KRL+ I  PTP+TVD LM+LD+ AGV++ IKL
Sbjct: 62  SREQFEIRTHKRLIDIANPTPKTVDLLMRLDLPAGVDIEIKL 103


>gi|255526577|ref|ZP_05393484.1| ribosomal protein S10 [Clostridium carboxidivorans P7]
 gi|296187265|ref|ZP_06855661.1| ribosomal protein S10 [Clostridium carboxidivorans P7]
 gi|255509685|gb|EET86018.1| ribosomal protein S10 [Clostridium carboxidivorans P7]
 gi|296048136|gb|EFG87574.1| ribosomal protein S10 [Clostridium carboxidivorans P7]
          Length = 102

 Score =  101 bits (251), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 69/98 (70%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD  ILD S  +IV T K +G+++ GP+P P      TV R+ H  K SR+Q
Sbjct: 5   KIRIRLKAFDHNILDQSAEKIVETAKTTGAKVAGPVPLPTEKDVVTVLRAVHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRL+ II P+P+TVDALM+LD+ AGV++ IKL
Sbjct: 65  FEIRTHKRLIDIISPSPKTVDALMRLDLPAGVDIEIKL 102


>gi|169335628|ref|ZP_02862821.1| hypothetical protein ANASTE_02048 [Anaerofustis stercorihominis DSM
           17244]
 gi|169258366|gb|EDS72332.1| hypothetical protein ANASTE_02048 [Anaerofustis stercorihominis DSM
           17244]
          Length = 130

 Score =  101 bits (251), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 71/100 (71%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA+D  ++D S  +IV T K++G+++ GPIP P      T+ R+ H  K SR
Sbjct: 31  NQKIRIKLKAYDHAVIDKSATKIVDTAKRTGAEVSGPIPLPTQKEVVTIIRAVHKYKDSR 90

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KR++ I+ PTP+TV+ALMKLD+ AGV++ IKL
Sbjct: 91  EQFEMRTHKRMIDILNPTPKTVEALMKLDLPAGVDIEIKL 130


>gi|315639322|ref|ZP_07894484.1| 30S ribosomal protein S10 [Campylobacter upsaliensis JV21]
 gi|315480648|gb|EFU71290.1| 30S ribosomal protein S10 [Campylobacter upsaliensis JV21]
          Length = 129

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 71/97 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI + LKA+D R+LD ++  IV   K++G+ I GP+P P  I+R+TV +SPH++K SR+Q
Sbjct: 29  RIRLKLKAYDHRVLDRTVAAIVEAVKRTGADIRGPVPMPTKIKRYTVLKSPHINKDSREQ 88

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E+RI+ R+L I+  TP TVD+L KLD+A  V+V ++
Sbjct: 89  FEIRIHARMLDIVAATPDTVDSLTKLDLAPEVSVEVR 125


>gi|307720135|ref|YP_003891275.1| 30S ribosomal protein S10P [Sulfurimonas autotrophica DSM 16294]
 gi|306978228|gb|ADN08263.1| SSU ribosomal protein S10P [Sulfurimonas autotrophica DSM 16294]
          Length = 103

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 73/97 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + LKA+D R+LD S+  IV   K++G+ I GPIP P  IR++TV +S HV+KK+R+Q
Sbjct: 3   KIRLKLKAYDHRVLDRSVASIVEAVKRTGAVIRGPIPLPTKIRKYTVLKSVHVNKKAREQ 62

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E+R++ R++ I+  TP+TVD+LMKLD+A  V+V ++
Sbjct: 63  FEIRMHARMIDIVSATPETVDSLMKLDLAPEVDVEVR 99


>gi|282891049|ref|ZP_06299554.1| hypothetical protein pah_c045o061 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281499042|gb|EFB41356.1| hypothetical protein pah_c045o061 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 111

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 70/97 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK +D R+LD S  +IV T K++G+ + GPIP P    +FTV RSP++D+KSR+Q
Sbjct: 14  KIRIRLKGYDQRLLDRSTADIVETAKRTGAGVAGPIPLPTRCEKFTVLRSPNIDRKSREQ 73

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E+R +KRL+ I+ PT +T+DAL  L + AG+++ IK
Sbjct: 74  FEIRTHKRLIDILHPTGKTIDALKTLTLPAGIDIKIK 110


>gi|29839960|ref|NP_829066.1| 30S ribosomal protein S10 [Chlamydophila caviae GPIC]
 gi|161501895|ref|YP_219618.2| 30S ribosomal protein S10 [Chlamydophila abortus S26/3]
 gi|161611312|ref|YP_515731.2| 30S ribosomal protein S10 [Chlamydophila felis Fe/C-56]
 gi|329942514|ref|ZP_08291324.1| ribosomal protein S10 [Chlamydophila psittaci Cal10]
 gi|33301627|sp|Q824F9|RS10_CHLCV RecName: Full=30S ribosomal protein S10
 gi|118597167|sp|Q5L6S4|RS10_CHLAB RecName: Full=30S ribosomal protein S10
 gi|118597168|sp|Q253F2|RS10_CHLFF RecName: Full=30S ribosomal protein S10
 gi|29834307|gb|AAP04944.1| ribosomal protein S10 [Chlamydophila caviae GPIC]
 gi|328815424|gb|EGF85412.1| ribosomal protein S10 [Chlamydophila psittaci Cal10]
          Length = 105

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 51/103 (49%), Positives = 70/103 (67%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +  +I I LK FD   LD S  +IV T K++G+++ GPIP P     +TV RSPHVD
Sbjct: 1   MKQQKQKIRIRLKGFDQGQLDRSTADIVETAKRTGARVAGPIPLPTKREVYTVLRSPHVD 60

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           KKSR+Q E+R +KRL+ I+ PT +T+DAL  L + AGV++ IK
Sbjct: 61  KKSREQFEIRTHKRLIDILDPTGKTIDALKMLALPAGVDIKIK 103


>gi|257069509|ref|YP_003155764.1| 30S ribosomal protein S10P [Brachybacterium faecium DSM 4810]
 gi|256560327|gb|ACU86174.1| SSU ribosomal protein S10P [Brachybacterium faecium DSM 4810]
          Length = 102

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 70/104 (67%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LK++D  ++DSS R+IV T   +G+ +VGP+P P     F V RSPH  
Sbjct: 1   MAGQKIRIR--LKSYDHEVIDSSARKIVDTVTSAGATVVGPVPLPTEKNVFCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+  EMR +KRL+ I+ PTP+ VD+LM+LD+ A VN+ IKL
Sbjct: 59  KDSREHFEMRTHKRLIDIVDPTPKAVDSLMRLDLPADVNIEIKL 102


>gi|62147900|emb|CAH63647.1| 30S ribosomal protein s10 [Chlamydophila abortus S26/3]
 gi|313847743|emb|CBY16733.1| 30S ribosomal protein s10 [Chlamydophila psittaci RD1]
          Length = 112

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 51/103 (49%), Positives = 70/103 (67%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +  +I I LK FD   LD S  +IV T K++G+++ GPIP P     +TV RSPHVD
Sbjct: 8   MKQQKQKIRIRLKGFDQGQLDRSTADIVETAKRTGARVAGPIPLPTKREVYTVLRSPHVD 67

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           KKSR+Q E+R +KRL+ I+ PT +T+DAL  L + AGV++ IK
Sbjct: 68  KKSREQFEIRTHKRLIDILDPTGKTIDALKMLALPAGVDIKIK 110


>gi|222150444|ref|YP_002559597.1| 30S ribosomal protein S10 [Macrococcus caseolyticus JCSC5402]
 gi|254809970|sp|B9E9J0|RS10_MACCJ RecName: Full=30S ribosomal protein S10
 gi|222119566|dbj|BAH16901.1| 30S ribosomal protein S10 [Macrococcus caseolyticus JCSC5402]
          Length = 102

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D RI+D S  +IV T K+SG+++ GPIP P     +T+ R+ H  K SR+Q
Sbjct: 5   KIRIRLKAYDHRIIDQSAEKIVETAKRSGAEVSGPIPLPTEKTVYTIIRAVHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R +KRL+ I+ PTP+TVDALM L++ +GV++ IKL
Sbjct: 65  FEQRTHKRLIDIVNPTPKTVDALMGLNLPSGVDIEIKL 102


>gi|227494544|ref|ZP_03924860.1| ribosomal protein S10 [Actinomyces coleocanis DSM 15436]
 gi|226832278|gb|EEH64661.1| ribosomal protein S10 [Actinomyces coleocanis DSM 15436]
          Length = 102

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 69/98 (70%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++DSS R+IV T +++G+ +VGP+P P     F V RSPH  K SR+ 
Sbjct: 5   KIRIRLKSYDHEVIDSSARKIVETVQRAGATVVGPVPLPTEKNVFVVIRSPHKYKDSREH 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ II PTP+ VD+LM+LD+ A V + IKL
Sbjct: 65  FEMRTHKRLIDIIDPTPKAVDSLMRLDLPADVKIDIKL 102


>gi|148381422|ref|YP_001255963.1| ribosomal protein S10 [Clostridium botulinum A str. ATCC 3502]
 gi|153932353|ref|YP_001385797.1| 30S ribosomal protein S10 [Clostridium botulinum A str. ATCC 19397]
 gi|153936753|ref|YP_001389204.1| 30S ribosomal protein S10 [Clostridium botulinum A str. Hall]
 gi|153940556|ref|YP_001392835.1| 30S ribosomal protein S10 [Clostridium botulinum F str. Langeland]
 gi|168178831|ref|ZP_02613495.1| ribosomal protein S10 [Clostridium botulinum NCTC 2916]
 gi|168181863|ref|ZP_02616527.1| 30S ribosomal protein S10 [Clostridium botulinum Bf]
 gi|170756211|ref|YP_001783122.1| 30S ribosomal protein S10 [Clostridium botulinum B1 str. Okra]
 gi|170760583|ref|YP_001788822.1| 30S ribosomal protein S10 [Clostridium botulinum A3 str. Loch
           Maree]
 gi|187776575|ref|ZP_02993048.1| hypothetical protein CLOSPO_00089 [Clostridium sporogenes ATCC
           15579]
 gi|226950934|ref|YP_002806025.1| ribosomal protein S10 [Clostridium botulinum A2 str. Kyoto]
 gi|237796943|ref|YP_002864495.1| 30S ribosomal protein S10 [Clostridium botulinum Ba4 str. 657]
 gi|166231261|sp|A7FZ70|RS10_CLOB1 RecName: Full=30S ribosomal protein S10
 gi|166231262|sp|A5I7K7|RS10_CLOBH RecName: Full=30S ribosomal protein S10
 gi|166231263|sp|A7GJ75|RS10_CLOBL RecName: Full=30S ribosomal protein S10
 gi|226705425|sp|B1IGF5|RS10_CLOBK RecName: Full=30S ribosomal protein S10
 gi|226705426|sp|B1KSM6|RS10_CLOBM RecName: Full=30S ribosomal protein S10
 gi|254809597|sp|C1FMV2|RS10_CLOBJ RecName: Full=30S ribosomal protein S10
 gi|259494584|sp|C3KVQ2|RS10_CLOB6 RecName: Full=30S ribosomal protein S10
 gi|148290906|emb|CAL85042.1| 30S ribosomal protein S10 [Clostridium botulinum A str. ATCC 3502]
 gi|152928397|gb|ABS33897.1| 30S ribosomal protein S10 [Clostridium botulinum A str. ATCC 19397]
 gi|152932667|gb|ABS38166.1| 30S ribosomal protein S10 [Clostridium botulinum A str. Hall]
 gi|152936452|gb|ABS41950.1| 30S ribosomal protein S10 [Clostridium botulinum F str. Langeland]
 gi|169121423|gb|ACA45259.1| 30S ribosomal protein S10 [Clostridium botulinum B1 str. Okra]
 gi|169407572|gb|ACA55983.1| 30S ribosomal protein S10 [Clostridium botulinum A3 str. Loch
           Maree]
 gi|182669895|gb|EDT81871.1| ribosomal protein S10 [Clostridium botulinum NCTC 2916]
 gi|182674923|gb|EDT86884.1| 30S ribosomal protein S10 [Clostridium botulinum Bf]
 gi|187775234|gb|EDU39036.1| hypothetical protein CLOSPO_00089 [Clostridium sporogenes ATCC
           15579]
 gi|226841053|gb|ACO83719.1| ribosomal protein S10 [Clostridium botulinum A2 str. Kyoto]
 gi|229264146|gb|ACQ55179.1| 30S ribosomal protein S10 [Clostridium botulinum Ba4 str. 657]
 gi|295320815|gb|ADG01193.1| 30S ribosomal protein S10 [Clostridium botulinum F str. 230613]
 gi|322807807|emb|CBZ05382.1| SSU ribosomal protein S10p (S20e) [Clostridium botulinum H04402
           065]
          Length = 102

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD  +LD S  +IV T K +G+++ GP+P P      T+ R+PH  K +R+Q
Sbjct: 5   KIRIRLKAFDHSLLDQSALKIVETAKTTGAKVAGPVPLPTEKDIVTILRAPHKYKDAREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRL+ II P+P+TVDALM+LD+ AGV++ IKL
Sbjct: 65  FEIRTHKRLIDIISPSPKTVDALMRLDLPAGVDIEIKL 102


>gi|113474345|ref|YP_720406.1| 30S ribosomal protein S10 [Trichodesmium erythraeum IMS101]
 gi|123057099|sp|Q118Z1|RS10_TRIEI RecName: Full=30S ribosomal protein S10
 gi|110165393|gb|ABG49933.1| SSU ribosomal protein S10P [Trichodesmium erythraeum IMS101]
          Length = 105

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD R+LD+S  +IV T  ++G+  +GPIP P   R + + RSPHVDK SR+ 
Sbjct: 8   KIRIRLKAFDRRLLDTSCEKIVDTANRTGATAIGPIPLPTKRRIYCLLRSPHVDKDSREH 67

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R ++R++ I +P+ +T+DALMKLD+ AGV++ +KL
Sbjct: 68  FETRTHRRIVDIYQPSSKTIDALMKLDLPAGVDIEVKL 105


>gi|89331993|dbj|BAE81586.1| 30S ribosomal protein S10 [Chlamydophila felis Fe/C-56]
          Length = 123

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 51/103 (49%), Positives = 70/103 (67%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +  +I I LK FD   LD S  +IV T K++G+++ GPIP P     +TV RSPHVD
Sbjct: 19  MKQQKQKIRIRLKGFDQGQLDRSTADIVETAKRTGARVAGPIPLPTKREVYTVLRSPHVD 78

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           KKSR+Q E+R +KRL+ I+ PT +T+DAL  L + AGV++ IK
Sbjct: 79  KKSREQFEIRTHKRLIDILDPTGKTIDALKMLALPAGVDIKIK 121


>gi|309789668|ref|ZP_07684249.1| hypothetical protein OSCT_0200 [Oscillochloris trichoides DG6]
 gi|308228404|gb|EFO82051.1| hypothetical protein OSCT_0200 [Oscillochloris trichoides DG6]
          Length = 102

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 44/98 (44%), Positives = 73/98 (74%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           ++ I LKA+D +ILD S R+IV   +++G+ + GP+P P  I +++V RS  +DK S++Q
Sbjct: 5   KVRIRLKAYDHKILDQSARQIVEAAERTGALVAGPVPLPTKIEKYSVIRSGFIDKNSQEQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRL+ ++ P+ QT++ALMKL++ AGV++ IKL
Sbjct: 65  FEIRTHKRLIDVLDPSQQTINALMKLNLPAGVDIEIKL 102


>gi|300865134|ref|ZP_07109959.1| 30S ribosomal protein S10 [Oscillatoria sp. PCC 6506]
 gi|300336905|emb|CBN55109.1| 30S ribosomal protein S10 [Oscillatoria sp. PCC 6506]
          Length = 105

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD RILD+S  +IV T  ++ +  +GPIP P   R F + RSPHVDK SR+ 
Sbjct: 8   KIRIRLKAFDRRILDASCEKIVDTANRTAATAIGPIPLPTKRRIFCLLRSPHVDKDSREH 67

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R ++R++ I +P+ +T+DALMKLD+ AGV++ +KL
Sbjct: 68  FETRTHRRIIDIHQPSAKTIDALMKLDLPAGVDIEVKL 105


>gi|15925241|ref|NP_372775.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|57650835|ref|YP_187050.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus COL]
 gi|156980566|ref|YP_001442825.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus Mu3]
 gi|253317011|ref|ZP_04840224.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus str.
           CF-Marseille]
 gi|255007031|ref|ZP_05145632.2| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           Mu50-omega]
 gi|257426414|ref|ZP_05602816.1| ribosomal protein S10 [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257429053|ref|ZP_05605440.1| ribosomal protein S10 [Staphylococcus aureus subsp. aureus 68-397]
 gi|262052040|ref|ZP_06024251.1| 30S ribosomal protein S10 [Staphylococcus aureus 930918-3]
 gi|293497504|ref|ZP_06665358.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           58-424]
 gi|297243985|ref|ZP_06927875.1| 30S ribosomal protein S10 [Staphylococcus aureus A8796]
 gi|20140130|sp|Q931G5|RS10_STAAM RecName: Full=30S ribosomal protein S10
 gi|73917907|sp|Q5HDV7|RS10_STAAC RecName: Full=30S ribosomal protein S10
 gi|166231785|sp|A7X5G6|RS10_STAA1 RecName: Full=30S ribosomal protein S10
 gi|14248024|dbj|BAB58413.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|57285021|gb|AAW37115.1| ribosomal protein S10 [Staphylococcus aureus subsp. aureus COL]
 gi|156722701|dbj|BAF79118.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus Mu3]
 gi|257276045|gb|EEV07496.1| ribosomal protein S10 [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257279534|gb|EEV10121.1| ribosomal protein S10 [Staphylococcus aureus subsp. aureus 68-397]
 gi|259160095|gb|EEW45128.1| 30S ribosomal protein S10 [Staphylococcus aureus 930918-3]
 gi|291096435|gb|EFE26693.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           58-424]
 gi|297178763|gb|EFH38008.1| 30S ribosomal protein S10 [Staphylococcus aureus A8796]
 gi|330685176|gb|EGG96840.1| ribosomal protein S10 [Staphylococcus epidermidis VCU121]
          Length = 102

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D R++D S  +IV T K+SG+ + GPIP P     +T+ R+ H+ K SR+Q
Sbjct: 5   KIRIRLKAYDHRVIDQSAEKIVETAKRSGADVSGPIPLPTEKSVYTIIRAVHMYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R +KRL+ I+ PTP+TVDALM L++ +GV++ IKL
Sbjct: 65  FEQRTHKRLIDIVNPTPKTVDALMGLNLPSGVDIEIKL 102


>gi|258455392|ref|ZP_05703352.1| ribosomal protein S10 [Staphylococcus aureus A5937]
 gi|257862603|gb|EEV85371.1| ribosomal protein S10 [Staphylococcus aureus A5937]
          Length = 102

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D R++D S  +IV T K+SG+ + GPIP P     +T+ R+ H+ K SR+Q
Sbjct: 5   KIRIRLKAYDHRVIDQSAEKIVETAKRSGADVSGPIPLPTENSVYTIIRAVHMYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R +KRL+ I+ PTP+TVDALM L++ +GV++ IKL
Sbjct: 65  FEQRTHKRLIDIVNPTPKTVDALMGLNLPSGVDIEIKL 102


>gi|224477221|ref|YP_002634827.1| 30S ribosomal protein S10 [Staphylococcus carnosus subsp. carnosus
           TM300]
 gi|254809985|sp|B9DM20|RS10_STACT RecName: Full=30S ribosomal protein S10
 gi|222421828|emb|CAL28642.1| 30S ribosomal protein S10 [Staphylococcus carnosus subsp. carnosus
           TM300]
          Length = 102

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D R++D S  +IV T K+SG+++ GPIP P     +T+ R+ H  K SR+Q
Sbjct: 5   KIRIRLKAYDHRVIDQSAEKIVETAKRSGAEVSGPIPLPTEKSVYTIIRAVHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R +KRL+ I+ PTP+TVDALM L++ +GV++ IKL
Sbjct: 65  FEQRTHKRLIDIVNPTPKTVDALMGLNLPSGVDIEIKL 102


>gi|149195354|ref|ZP_01872440.1| 30S ribosomal protein S10 [Caminibacter mediatlanticus TB-2]
 gi|149134486|gb|EDM22976.1| 30S ribosomal protein S10 [Caminibacter mediatlanticus TB-2]
          Length = 102

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 72/97 (74%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I L+A+D R+LD ++  I    K++G+++ GPIP P  IRR+TV RSPH++K SR+Q
Sbjct: 3   KIRIKLQAYDHRVLDKAVSIITDAIKRTGAEVKGPIPLPTKIRRYTVLRSPHINKDSREQ 62

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E+RI++RL+ ++  +P TVD LMKL++A  V+V ++
Sbjct: 63  FEIRIHRRLIDVVNASPDTVDQLMKLELAPEVDVEVR 99


>gi|237753024|ref|ZP_04583504.1| 30S ribosomal protein S10 [Helicobacter winghamensis ATCC BAA-430]
 gi|229375291|gb|EEO25382.1| 30S ribosomal protein S10 [Helicobacter winghamensis ATCC BAA-430]
          Length = 103

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 71/97 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + LKA+D R+LD S+  IV   K++G++I GPIP P   RR+TV +SPH++K SR+Q
Sbjct: 3   KIRLKLKAYDHRVLDRSVVSIVEAVKRTGAEIRGPIPLPTKKRRYTVLKSPHINKDSREQ 62

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E+R++ R++ I+  TP+TVD L KLD+A  V+V ++
Sbjct: 63  FEIRVHTRIIDIVSATPETVDGLTKLDMAPEVDVEVR 99


>gi|206895502|ref|YP_002247335.1| ribosomal protein S10 [Coprothermobacter proteolyticus DSM 5265]
 gi|226705428|sp|B5Y988|RS10_COPPD RecName: Full=30S ribosomal protein S10
 gi|206738119|gb|ACI17197.1| ribosomal protein S10 [Coprothermobacter proteolyticus DSM 5265]
          Length = 102

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 46/98 (46%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I L+++D R+LD S + IV   K++G+++ GPIP P   R + V RSPH+DK SR+ 
Sbjct: 5   RIRIKLRSYDHRLLDQSAKRIVEVAKRTGAKVAGPIPLPTDRRVYCVTRSPHIDKDSREH 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E++++KRL+ II PT +TV  LM L++ AGV++ +KL
Sbjct: 65  FEIKMHKRLIDIIDPTQETVSNLMSLELPAGVDIHLKL 102


>gi|296268549|ref|YP_003651181.1| 30S ribosomal protein S10 [Thermobispora bispora DSM 43833]
 gi|296091336|gb|ADG87288.1| ribosomal protein S10 [Thermobispora bispora DSM 43833]
          Length = 102

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 72/104 (69%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LKA+D  ++DSS ++IV T  ++G+++ GP+P P     + V RSPH  
Sbjct: 1   MAGQKIRIR--LKAYDHEVIDSSAKKIVETVTRTGAKVAGPVPLPTEKNVYCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+   MR +KRL+ II PTP+TVD+LM+LD+ AGV++ IKL
Sbjct: 59  KDSREHFVMRTHKRLIDIIDPTPKTVDSLMRLDLPAGVDISIKL 102


>gi|307328029|ref|ZP_07607210.1| ribosomal protein S10 [Streptomyces violaceusniger Tu 4113]
 gi|306886334|gb|EFN17339.1| ribosomal protein S10 [Streptomyces violaceusniger Tu 4113]
          Length = 102

 Score =  100 bits (250), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 72/104 (69%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LKA+D  ++DSS ++IV T  ++G+ + GP+P P     + V +SPH  
Sbjct: 1   MAGQKIRIR--LKAYDHEVIDSSAKKIVETVTRTGASVAGPVPLPTEKNVYCVIKSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K +R+  EMR +KRL+ I+ PTP+TVD+LM+LD+ AGV++ IKL
Sbjct: 59  KDAREHFEMRTHKRLIDILDPTPKTVDSLMRLDLPAGVDIEIKL 102


>gi|150015042|ref|YP_001307296.1| 30S ribosomal protein S10 [Clostridium beijerinckii NCIMB 8052]
 gi|187934271|ref|YP_001884472.1| 30S ribosomal protein S10 [Clostridium botulinum B str. Eklund 17B]
 gi|188589142|ref|YP_001919671.1| 30S ribosomal protein S10 [Clostridium botulinum E3 str. Alaska
           E43]
 gi|237666839|ref|ZP_04526824.1| ribosomal protein S10 [Clostridium butyricum E4 str. BoNT E BL5262]
 gi|251777765|ref|ZP_04820685.1| 30S ribosomal protein S10 [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
 gi|189040366|sp|A6LPR0|RS10_CLOB8 RecName: Full=30S ribosomal protein S10
 gi|226705423|sp|B2UYA9|RS10_CLOBA RecName: Full=30S ribosomal protein S10
 gi|226705424|sp|B2TIH4|RS10_CLOBB RecName: Full=30S ribosomal protein S10
 gi|149901507|gb|ABR32340.1| ribosomal protein S10 [Clostridium beijerinckii NCIMB 8052]
 gi|187722424|gb|ACD23645.1| 30S ribosomal protein S10 [Clostridium botulinum B str. Eklund 17B]
 gi|188499423|gb|ACD52559.1| 30S ribosomal protein S10 [Clostridium botulinum E3 str. Alaska
           E43]
 gi|237658038|gb|EEP55593.1| ribosomal protein S10 [Clostridium butyricum E4 str. BoNT E BL5262]
 gi|243082080|gb|EES47970.1| 30S ribosomal protein S10 [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
          Length = 102

 Score =  100 bits (250), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 73/104 (70%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M+ + IRI   LKAFD  ILD S  +IV T K SG+++VGP+P P      T+ R+ H  
Sbjct: 1   MSKQKIRIR--LKAFDHTILDQSAEKIVETAKTSGAKVVGPVPLPTEKDVVTILRAVHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+Q E+R +KRL+ I+ P+P+TVDALM+L++ AGV++ IKL
Sbjct: 59  KDSREQFEIRTHKRLIDIVNPSPKTVDALMRLNLPAGVDIEIKL 102


>gi|224417884|ref|ZP_03655890.1| 30S ribosomal protein S10 [Helicobacter canadensis MIT 98-5491]
 gi|313141426|ref|ZP_07803619.1| 30S ribosomal protein S10 [Helicobacter canadensis MIT 98-5491]
 gi|313130457|gb|EFR48074.1| 30S ribosomal protein S10 [Helicobacter canadensis MIT 98-5491]
          Length = 103

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 47/98 (47%), Positives = 73/98 (74%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + LKA+D R+LD S+  IV   K++G++I GPIP P   RR+TV +SPH++K SR+Q
Sbjct: 3   KIRLKLKAYDHRVLDRSVVSIVEAVKRTGAEIRGPIPLPTKKRRYTVLKSPHINKDSREQ 62

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R++ R++ I+  TP+TVD+L KLD+A  V+V ++L
Sbjct: 63  FEIRVHCRVIDIVSATPETVDSLTKLDMAPEVDVEVRL 100


>gi|224373650|ref|YP_002608022.1| 30S ribosomal protein S10 [Nautilia profundicola AmH]
 gi|254809977|sp|B9L6N4|RS10_NAUPA RecName: Full=30S ribosomal protein S10
 gi|223588670|gb|ACM92406.1| ribosomal protein S10 [Nautilia profundicola AmH]
          Length = 102

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 73/97 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I L+A+D R+LD ++  I    K++G+++ GPIP P  IRR+TV RSPH++K SR+Q
Sbjct: 3   KIRIKLQAYDHRVLDKAVSIITDAIKRTGAEVKGPIPLPTKIRRYTVLRSPHINKDSREQ 62

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E+RI++R++ ++  +P+TVD LMKL++A  V+V ++
Sbjct: 63  FEIRIHRRIVDVVNASPETVDQLMKLELAPEVDVEVR 99


>gi|172039994|ref|YP_001799708.1| 30S ribosomal protein S10 [Corynebacterium urealyticum DSM 7109]
 gi|260579268|ref|ZP_05847152.1| 30S ribosomal protein S10 [Corynebacterium jeikeium ATCC 43734]
 gi|226705429|sp|B1VET5|RS10_CORU7 RecName: Full=30S ribosomal protein S10
 gi|171851298|emb|CAQ04274.1| 30S ribosomal protein S10 [Corynebacterium urealyticum DSM 7109]
 gi|258602620|gb|EEW15913.1| 30S ribosomal protein S10 [Corynebacterium jeikeium ATCC 43734]
          Length = 101

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 72/103 (69%), Gaps = 2/103 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LKA+D   +D+S ++IV T  ++G+++VGP+P P     + V RSPH D
Sbjct: 1   MAGQKIRIR--LKAYDHEAIDASAKKIVETVTRTGARVVGPVPLPTEKNVYCVIRSPHKD 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           K SR+  EMR +KRL+ I+ PTP+TVDALM++D+ A V+V I+
Sbjct: 59  KDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNIQ 101


>gi|195952642|ref|YP_002120932.1| ribosomal protein S10 [Hydrogenobaculum sp. Y04AAS1]
 gi|226705579|sp|B4U743|RS10_HYDS0 RecName: Full=30S ribosomal protein S10
 gi|195932254|gb|ACG56954.1| ribosomal protein S10 [Hydrogenobaculum sp. Y04AAS1]
          Length = 104

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 46/98 (46%), Positives = 74/98 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D ++LD S+++IV T K++GS + GPIP P S RR+ V RSPH   +SR+ 
Sbjct: 5   KIRIKLKSYDYKLLDQSVKQIVETVKRTGSSVKGPIPLPTSRRRWVVLRSPHKFDQSREH 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KR+L I+K TPQT+++LM++ + AGV++ +K+
Sbjct: 65  FEIREFKRMLDIVKITPQTIESLMEISLPAGVDIEVKM 102


>gi|256371214|ref|YP_003109038.1| ribosomal protein S10 [Acidimicrobium ferrooxidans DSM 10331]
 gi|256007798|gb|ACU53365.1| ribosomal protein S10 [Acidimicrobium ferrooxidans DSM 10331]
          Length = 108

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 69/98 (70%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI + LK FD  IL++S R IV T  ++  ++VGP+P P  I R+TV RSPH  K SR+ 
Sbjct: 8   RIRVRLKGFDHEILEASTRRIVDTVTRTQGKVVGPVPLPTDIHRYTVIRSPHKYKDSREH 67

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR++KRLL I+  + +TVDAL +L++ AGV++ IK+
Sbjct: 68  FEMRVHKRLLDIVDHSAKTVDALKRLELPAGVDIEIKI 105


>gi|325507296|gb|ADZ18934.1| 30S ribosomal protein S10 [Chlamydophila psittaci 6BC]
 gi|328914390|gb|AEB55223.1| ribosomal protein S10 [Chlamydophila psittaci 6BC]
          Length = 105

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 51/103 (49%), Positives = 69/103 (66%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  +  +I I LK FD   LD S   IV T K++G+++ GPIP P     +TV RSPHVD
Sbjct: 1   MKQQKQKIRIRLKGFDQGQLDRSTAAIVETAKRTGARVAGPIPLPTKREVYTVLRSPHVD 60

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           KKSR+Q E+R +KRL+ I+ PT +T+DAL  L + AGV++ IK
Sbjct: 61  KKSREQFEIRTHKRLIDILDPTGKTIDALKMLALPAGVDIKIK 103


>gi|120437175|ref|YP_862861.1| 30S ribosomal protein S10 [Gramella forsetii KT0803]
 gi|166231275|sp|A0M599|RS10_GRAFK RecName: Full=30S ribosomal protein S10
 gi|117579325|emb|CAL67794.1| 30S ribosomal protein S10 [Gramella forsetii KT0803]
          Length = 101

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++D S  +IV T K +G+ + GPIP P + + FTV RSPHV+KKSR+Q
Sbjct: 4   KIRIKLKSYDHNLVDKSAEKIVKTVKTTGAVVTGPIPLPTNKKIFTVLRSPHVNKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+  YKRLL I   + +T+DALMKL++ +GV V IK+
Sbjct: 64  FELSSYKRLLDIYSSSSKTIDALMKLELPSGVEVEIKV 101


>gi|218437060|ref|YP_002375389.1| 30S ribosomal protein S10 [Cyanothece sp. PCC 7424]
 gi|307152010|ref|YP_003887394.1| 30S ribosomal protein S10 [Cyanothece sp. PCC 7822]
 gi|226705431|sp|B7K833|RS10_CYAP7 RecName: Full=30S ribosomal protein S10
 gi|218169788|gb|ACK68521.1| ribosomal protein S10 [Cyanothece sp. PCC 7424]
 gi|306982238|gb|ADN14119.1| ribosomal protein S10 [Cyanothece sp. PCC 7822]
          Length = 105

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD R+LD+S  +IV T  ++ +  +GPIP P   R + V RSPHVDK SR+ 
Sbjct: 8   KIRIRLKAFDRRLLDTSCEKIVDTANRTNATAIGPIPLPTKRRVYCVLRSPHVDKDSREH 67

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R ++R++ I +P+ +T+DALMKLD+ AGV++ +KL
Sbjct: 68  FETRTHRRIIDIYQPSSKTIDALMKLDLPAGVDIEVKL 105


>gi|238018622|ref|ZP_04599048.1| hypothetical protein VEIDISOL_00457 [Veillonella dispar ATCC 17748]
 gi|269798551|ref|YP_003312451.1| ribosomal protein S10 [Veillonella parvula DSM 2008]
 gi|282849863|ref|ZP_06259246.1| ribosomal protein S10 [Veillonella parvula ATCC 17745]
 gi|294792793|ref|ZP_06757940.1| ribosomal protein S10 [Veillonella sp. 6_1_27]
 gi|294794547|ref|ZP_06759683.1| ribosomal protein S10 [Veillonella sp. 3_1_44]
 gi|303230158|ref|ZP_07316927.1| ribosomal protein S10 [Veillonella atypica ACS-134-V-Col7a]
 gi|303231247|ref|ZP_07317985.1| ribosomal protein S10 [Veillonella atypica ACS-049-V-Sch6]
 gi|313892873|ref|ZP_07826450.1| ribosomal protein S10 [Veillonella sp. oral taxon 158 str. F0412]
 gi|237865093|gb|EEP66383.1| hypothetical protein VEIDISOL_00457 [Veillonella dispar ATCC 17748]
 gi|269095180|gb|ACZ25171.1| ribosomal protein S10 [Veillonella parvula DSM 2008]
 gi|282580300|gb|EFB85700.1| ribosomal protein S10 [Veillonella parvula ATCC 17745]
 gi|294454877|gb|EFG23250.1| ribosomal protein S10 [Veillonella sp. 3_1_44]
 gi|294456692|gb|EFG25055.1| ribosomal protein S10 [Veillonella sp. 6_1_27]
 gi|302514154|gb|EFL56158.1| ribosomal protein S10 [Veillonella atypica ACS-049-V-Sch6]
 gi|302515219|gb|EFL57192.1| ribosomal protein S10 [Veillonella atypica ACS-134-V-Col7a]
 gi|313442226|gb|EFR60641.1| ribosomal protein S10 [Veillonella sp. oral taxon 158 str. F0412]
          Length = 103

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 72/102 (70%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           ++  +I I LKA+D + LD S  +IV T K++G+ + GPIP P     FT+ RS HV+K 
Sbjct: 2   AKQQKIRIRLKAYDHKALDQSAAKIVDTAKRNGAMVSGPIPLPTEKNIFTILRSVHVNKD 61

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           SR+Q EMR +KRL+ I++P  +TVDA+ +LD+ AGV++ IKL
Sbjct: 62  SREQFEMRTHKRLIDILEPNSKTVDAITRLDLPAGVSIEIKL 103


>gi|289423696|ref|ZP_06425495.1| ribosomal protein S10 [Peptostreptococcus anaerobius 653-L]
 gi|289155946|gb|EFD04612.1| ribosomal protein S10 [Peptostreptococcus anaerobius 653-L]
          Length = 103

 Score =  100 bits (248), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 72/102 (70%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           ++N +I I LK++D ++LD S  +IV   KK+GS + GPIP P   +  T+ R+ H  K 
Sbjct: 2   AKNEKIRIRLKSYDHKLLDYSATKIVEAAKKAGSVVSGPIPLPTEKKVVTILRAVHKYKD 61

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           SR+Q E+R +KRL+ I  PTP+TVD+LMKLD+ AGV++ IKL
Sbjct: 62  SREQFEIRTHKRLIDIANPTPKTVDSLMKLDLPAGVDIEIKL 103


>gi|73661971|ref|YP_300752.1| 30S ribosomal protein S10 [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|82581612|sp|Q49ZG9|RS10_STAS1 RecName: Full=30S ribosomal protein S10
 gi|72494486|dbj|BAE17807.1| 30S ribosomal protein S10 [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
          Length = 102

 Score =  100 bits (248), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 69/98 (70%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D R++D S  +IV T K+SG+ + GPIP P     +TV R+ H  K SR+Q
Sbjct: 5   KIRIRLKAYDHRVIDQSAEKIVETAKRSGADVSGPIPLPTERSVYTVIRAVHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R +KRL+ I+ PTP+TVDALM L++ +GV++ IKL
Sbjct: 65  FEQRTHKRLIDIVNPTPKTVDALMGLNLPSGVDIEIKL 102


>gi|86141139|ref|ZP_01059685.1| 30S ribosomal protein S10 [Leeuwenhoekiella blandensis MED217]
 gi|85831698|gb|EAQ50153.1| 30S ribosomal protein S10 [Leeuwenhoekiella blandensis MED217]
          Length = 101

 Score =  100 bits (248), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 69/98 (70%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++D S  +IV T K +G+ + GPIP P   + FTV RSPHV+KKSR+Q
Sbjct: 4   KIRIKLKSYDHNLVDKSAEKIVKTVKSTGAVVTGPIPLPTHKKIFTVLRSPHVNKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+  YKRLL I   + +T+DALMKL++ +GV V IK+
Sbjct: 64  FELSSYKRLLDIYSSSSKTIDALMKLELPSGVEVEIKV 101


>gi|87306539|ref|ZP_01088686.1| 30S ribosomal protein S10 [Blastopirellula marina DSM 3645]
 gi|87290718|gb|EAQ82605.1| 30S ribosomal protein S10 [Blastopirellula marina DSM 3645]
          Length = 105

 Score =  100 bits (248), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 69/96 (71%)

Query: 8   ICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQL 67
           I I ++A+D  ILD S  EIV T K++ S++ GPIP P  I R+TV   PHVDKK+R Q 
Sbjct: 6   IRIRMEAYDHSILDQSALEIVDTAKRTHSEVHGPIPLPTRIERYTVLSGPHVDKKARQQF 65

Query: 68  EMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           E+R +KRL+ I++ T +T++AL KL++ AGV++ IK
Sbjct: 66  EIRTHKRLIDIVQATAKTIEALNKLNLPAGVDIKIK 101


>gi|163783907|ref|ZP_02178881.1| 50S ribosomal protein L4 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159880828|gb|EDP74358.1| 50S ribosomal protein L4 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 103

 Score =  100 bits (248), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD  +LD S+++I+ T K+SG  I GP+P P S + + V RSPH  ++SR+ 
Sbjct: 5   KIRIKLKAFDHDVLDQSVKQIIDTVKRSGGVIKGPVPLPTSRKMWCVLRSPHKFEQSREH 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMRI+KRL+ I   TPQT++ALM + + AGV+V IKL
Sbjct: 65  FEMRIHKRLIDIENATPQTIEALMDISLPAGVDVEIKL 102


>gi|86132543|ref|ZP_01051136.1| 30S ribosomal protein S10 [Dokdonia donghaensis MED134]
 gi|295135702|ref|YP_003586378.1| 30S ribosomal protein S10 [Zunongwangia profunda SM-A87]
 gi|85816785|gb|EAQ37970.1| 30S ribosomal protein S10 [Dokdonia donghaensis MED134]
 gi|294983717|gb|ADF54182.1| 30S ribosomal protein S10 [Zunongwangia profunda SM-A87]
          Length = 101

 Score =  100 bits (248), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 69/98 (70%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++D S  +IV T K +G+ + GPIP P   + FTV RSPHV+KKSR+Q
Sbjct: 4   KIRIKLKSYDHNLVDKSAEKIVKTVKTTGAVVTGPIPLPTHKKIFTVLRSPHVNKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+  YKRLL I   + +T+DALMKL++ +GV V IK+
Sbjct: 64  FELSSYKRLLDIYSSSSKTIDALMKLELPSGVEVEIKV 101


>gi|18311388|ref|NP_563322.1| 30S ribosomal protein S10 [Clostridium perfringens str. 13]
 gi|110799526|ref|YP_697095.1| 30S ribosomal protein S10 [Clostridium perfringens ATCC 13124]
 gi|110803264|ref|YP_699664.1| 30S ribosomal protein S10 [Clostridium perfringens SM101]
 gi|20140038|sp|Q8XHS2|RS10_CLOPE RecName: Full=30S ribosomal protein S10
 gi|118597171|sp|Q0TMP5|RS10_CLOP1 RecName: Full=30S ribosomal protein S10
 gi|118597172|sp|Q0SQE3|RS10_CLOPS RecName: Full=30S ribosomal protein S10
 gi|18146072|dbj|BAB82112.1| 30S ribosomal protein S10 [Clostridium perfringens str. 13]
 gi|110674173|gb|ABG83160.1| 30S ribosomal protein S10 [Clostridium perfringens ATCC 13124]
 gi|110683765|gb|ABG87135.1| 30S ribosomal protein S10 [Clostridium perfringens SM101]
          Length = 102

 Score =  100 bits (248), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 73/104 (70%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M+ + IRI   LKAFD  ILD S  +IV T K +G+++VGP+P P      T+ R+ H  
Sbjct: 1   MSKQKIRIR--LKAFDHTILDQSAEKIVETAKSTGAKVVGPVPLPTEKDVITILRAVHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+Q E+R +KRL+ I+ P+P+TVDALM+L++ AGV++ IKL
Sbjct: 59  KDSREQFEVRTHKRLIDIVNPSPKTVDALMRLNLPAGVDIEIKL 102


>gi|15927831|ref|NP_375364.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           N315]
 gi|21283899|ref|NP_646987.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus MW2]
 gi|27468743|ref|NP_765380.1| 30S ribosomal protein S10 [Staphylococcus epidermidis ATCC 12228]
 gi|49484467|ref|YP_041691.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|49487033|ref|YP_044254.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57867724|ref|YP_189395.1| 30S ribosomal protein S10 [Staphylococcus epidermidis RP62A]
 gi|82751840|ref|YP_417581.1| 30S ribosomal protein S10 [Staphylococcus aureus RF122]
 gi|87162279|ref|YP_494840.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|148268691|ref|YP_001247634.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus JH9]
 gi|150394756|ref|YP_001317431.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus JH1]
 gi|151222365|ref|YP_001333187.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus str.
           Newman]
 gi|221140147|ref|ZP_03564640.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus str.
           JKD6009]
 gi|223042347|ref|ZP_03612396.1| ribosomal protein S10 [Staphylococcus capitis SK14]
 gi|228474644|ref|ZP_04059375.1| ribosomal protein S10 [Staphylococcus hominis SK119]
 gi|239636234|ref|ZP_04677238.1| ribosomal protein S10 [Staphylococcus warneri L37603]
 gi|242243946|ref|ZP_04798389.1| 30S ribosomal protein S10 [Staphylococcus epidermidis W23144]
 gi|242371897|ref|ZP_04817471.1| 30S ribosomal protein S10 [Staphylococcus epidermidis M23864:W1]
 gi|253729917|ref|ZP_04864082.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253734340|ref|ZP_04868505.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|257423736|ref|ZP_05600165.1| SSU ribosomal protein S10p/S20e [Staphylococcus aureus subsp.
           aureus 55/2053]
 gi|257431699|ref|ZP_05608062.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257434660|ref|ZP_05610711.1| SSU ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           M876]
 gi|257794597|ref|ZP_05643576.1| 30S ribosomal protein S10 [Staphylococcus aureus A9781]
 gi|258408801|ref|ZP_05681085.1| 30S ribosomal protein S10 [Staphylococcus aureus A9763]
 gi|258422400|ref|ZP_05685312.1| SSU ribosomal protein S10 [Staphylococcus aureus A9719]
 gi|258422698|ref|ZP_05685603.1| SSU ribosomal protein S10 [Staphylococcus aureus A9635]
 gi|258439789|ref|ZP_05690535.1| 30S ribosomal protein S10 [Staphylococcus aureus A9299]
 gi|258442655|ref|ZP_05691215.1| 30S ribosomal protein S10 [Staphylococcus aureus A8115]
 gi|258446646|ref|ZP_05694801.1| 30S ribosomal protein S10 [Staphylococcus aureus A6300]
 gi|258450236|ref|ZP_05698328.1| ribosomal protein S10 [Staphylococcus aureus A6224]
 gi|258450754|ref|ZP_05698813.1| ribosomal protein S10 [Staphylococcus aureus A5948]
 gi|262048515|ref|ZP_06021399.1| 30S ribosomal protein S10 [Staphylococcus aureus D30]
 gi|269203884|ref|YP_003283153.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           ED98]
 gi|282893689|ref|ZP_06301921.1| 30S ribosomal protein S10 [Staphylococcus aureus A8117]
 gi|282902154|ref|ZP_06310047.1| ribosomal protein S10 [Staphylococcus aureus subsp. aureus C160]
 gi|282906594|ref|ZP_06314442.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282909564|ref|ZP_06317375.1| ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282911811|ref|ZP_06319607.1| ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282915100|ref|ZP_06322877.1| ribosomal protein S10 [Staphylococcus aureus subsp. aureus M899]
 gi|282917596|ref|ZP_06325348.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           D139]
 gi|282920826|ref|ZP_06328544.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           C427]
 gi|282922120|ref|ZP_06329816.1| 30S ribosomal protein S10 [Staphylococcus aureus A9765]
 gi|282925731|ref|ZP_06333379.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           C101]
 gi|282926797|ref|ZP_06334424.1| 30S ribosomal protein S10 [Staphylococcus aureus A10102]
 gi|283767343|ref|ZP_06340258.1| small subunit ribosomal protein S10 [Staphylococcus aureus subsp.
           aureus H19]
 gi|283959029|ref|ZP_06376470.1| ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|284025277|ref|ZP_06379675.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus 132]
 gi|289550142|ref|YP_003471046.1| SSU ribosomal protein S10p (S20e) [Staphylococcus lugdunensis
           HKU09-01]
 gi|293368432|ref|ZP_06615056.1| 30S ribosomal protein S10 [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|293511079|ref|ZP_06669776.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           M809]
 gi|293549685|ref|ZP_06672357.1| ribosomal protein S10 [Staphylococcus aureus subsp. aureus M1015]
 gi|294848784|ref|ZP_06789529.1| 30S ribosomal protein S10 [Staphylococcus aureus A9754]
 gi|295404927|ref|ZP_06814740.1| 30S ribosomal protein S10 [Staphylococcus aureus A8819]
 gi|295428834|ref|ZP_06821458.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|296275958|ref|ZP_06858465.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus MR1]
 gi|297209936|ref|ZP_06926332.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|297589680|ref|ZP_06948321.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus MN8]
 gi|300910948|ref|ZP_07128398.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|304379435|ref|ZP_07362170.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|314934298|ref|ZP_07841657.1| ribosomal protein S10 [Staphylococcus caprae C87]
 gi|314935831|ref|ZP_07843183.1| ribosomal protein S10 [Staphylococcus hominis subsp. hominis C80]
 gi|315659228|ref|ZP_07912092.1| 30S ribosomal protein S10 [Staphylococcus lugdunensis M23590]
 gi|54039320|sp|P66335|RS10_STAAW RecName: Full=30S ribosomal protein S10
 gi|54039321|sp|P66336|RS10_STAES RecName: Full=30S ribosomal protein S10
 gi|54042101|sp|P66334|RS10_STAAN RecName: Full=30S ribosomal protein S10
 gi|73917908|sp|Q6GEI2|RS10_STAAR RecName: Full=30S ribosomal protein S10
 gi|73917909|sp|Q6G770|RS10_STAAS RecName: Full=30S ribosomal protein S10
 gi|81673576|sp|Q5HLZ8|RS10_STAEQ RecName: Full=30S ribosomal protein S10
 gi|118597324|sp|Q2FEN8|RS10_STAA3 RecName: Full=30S ribosomal protein S10
 gi|118597325|sp|Q2YYP5|RS10_STAAB RecName: Full=30S ribosomal protein S10
 gi|172049049|sp|A6QJ93|RS10_STAAE RecName: Full=30S ribosomal protein S10
 gi|189040395|sp|A6U3X6|RS10_STAA2 RecName: Full=30S ribosomal protein S10
 gi|189040396|sp|A5IV35|RS10_STAA9 RecName: Full=30S ribosomal protein S10
 gi|27316291|gb|AAO05466.1|AE016750_71 30S ribosomal protein S10 [Staphylococcus epidermidis ATCC 12228]
 gi|13702051|dbj|BAB43343.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           N315]
 gi|21205341|dbj|BAB96035.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus MW2]
 gi|49242596|emb|CAG41317.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|49245476|emb|CAG43953.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57638382|gb|AAW55170.1| ribosomal protein S10 [Staphylococcus epidermidis RP62A]
 gi|82657371|emb|CAI81812.1| 30S ribosomal protein S10 [Staphylococcus aureus RF122]
 gi|87128253|gb|ABD22767.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|147741760|gb|ABQ50058.1| SSU ribosomal protein S10P [Staphylococcus aureus subsp. aureus
           JH9]
 gi|149947208|gb|ABR53144.1| ribosomal protein S10 [Staphylococcus aureus subsp. aureus JH1]
 gi|150375165|dbj|BAF68425.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus str.
           Newman]
 gi|222444010|gb|EEE50106.1| ribosomal protein S10 [Staphylococcus capitis SK14]
 gi|228271307|gb|EEK12675.1| ribosomal protein S10 [Staphylococcus hominis SK119]
 gi|239598250|gb|EEQ80743.1| ribosomal protein S10 [Staphylococcus warneri L37603]
 gi|242232579|gb|EES34891.1| 30S ribosomal protein S10 [Staphylococcus epidermidis W23144]
 gi|242350404|gb|EES42005.1| 30S ribosomal protein S10 [Staphylococcus epidermidis M23864:W1]
 gi|253726364|gb|EES95093.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253727657|gb|EES96386.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|257272754|gb|EEV04856.1| SSU ribosomal protein S10p/S20e [Staphylococcus aureus subsp.
           aureus 55/2053]
 gi|257282578|gb|EEV12710.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257285256|gb|EEV15372.1| SSU ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           M876]
 gi|257788569|gb|EEV26909.1| 30S ribosomal protein S10 [Staphylococcus aureus A9781]
 gi|257840484|gb|EEV64944.1| 30S ribosomal protein S10 [Staphylococcus aureus A9763]
 gi|257841831|gb|EEV66268.1| SSU ribosomal protein S10 [Staphylococcus aureus A9719]
 gi|257847109|gb|EEV71118.1| SSU ribosomal protein S10 [Staphylococcus aureus A9635]
 gi|257847565|gb|EEV71567.1| 30S ribosomal protein S10 [Staphylococcus aureus A9299]
 gi|257851776|gb|EEV75710.1| 30S ribosomal protein S10 [Staphylococcus aureus A8115]
 gi|257854714|gb|EEV77662.1| 30S ribosomal protein S10 [Staphylococcus aureus A6300]
 gi|257856328|gb|EEV79237.1| ribosomal protein S10 [Staphylococcus aureus A6224]
 gi|257861537|gb|EEV84339.1| ribosomal protein S10 [Staphylococcus aureus A5948]
 gi|259163373|gb|EEW47931.1| 30S ribosomal protein S10 [Staphylococcus aureus D30]
 gi|262076174|gb|ACY12147.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           ED98]
 gi|269941840|emb|CBI50250.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           TW20]
 gi|282312560|gb|EFB42964.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           C101]
 gi|282315241|gb|EFB45625.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           C427]
 gi|282318558|gb|EFB48916.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           D139]
 gi|282320821|gb|EFB51155.1| ribosomal protein S10 [Staphylococcus aureus subsp. aureus M899]
 gi|282323507|gb|EFB53823.1| ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282326543|gb|EFB56845.1| ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282329493|gb|EFB59014.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282591248|gb|EFB96321.1| 30S ribosomal protein S10 [Staphylococcus aureus A10102]
 gi|282593588|gb|EFB98581.1| 30S ribosomal protein S10 [Staphylococcus aureus A9765]
 gi|282596613|gb|EFC01572.1| ribosomal protein S10 [Staphylococcus aureus subsp. aureus C160]
 gi|282763747|gb|EFC03875.1| 30S ribosomal protein S10 [Staphylococcus aureus A8117]
 gi|283461222|gb|EFC08306.1| small subunit ribosomal protein S10 [Staphylococcus aureus subsp.
           aureus H19]
 gi|283471473|emb|CAQ50684.1| ribosomal protein S10 [Staphylococcus aureus subsp. aureus ST398]
 gi|283788621|gb|EFC27448.1| ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|285817913|gb|ADC38400.1| 30S ribosomal protein S10 [Staphylococcus aureus 04-02981]
 gi|289179674|gb|ADC86919.1| SSU ribosomal protein S10p (S20e) [Staphylococcus lugdunensis
           HKU09-01]
 gi|290918732|gb|EFD95808.1| ribosomal protein S10 [Staphylococcus aureus subsp. aureus M1015]
 gi|291317390|gb|EFE57812.1| 30S ribosomal protein S10 [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|291466066|gb|EFF08595.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           M809]
 gi|294824163|gb|EFG40587.1| 30S ribosomal protein S10 [Staphylococcus aureus A9754]
 gi|294969872|gb|EFG45890.1| 30S ribosomal protein S10 [Staphylococcus aureus A8819]
 gi|295127183|gb|EFG56825.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|296885609|gb|EFH24546.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|297578191|gb|EFH96904.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus MN8]
 gi|298695507|gb|ADI98729.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           ED133]
 gi|300887928|gb|EFK83123.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|302333887|gb|ADL24080.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           JKD6159]
 gi|302752124|gb|ADL66301.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus str.
           JKD6008]
 gi|304341967|gb|EFM07871.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|312437338|gb|ADQ76409.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           TCH60]
 gi|312830600|emb|CBX35442.1| ribosomal protein S10 [Staphylococcus aureus subsp. aureus ECT-R 2]
 gi|313652228|gb|EFS15991.1| ribosomal protein S10 [Staphylococcus caprae C87]
 gi|313656396|gb|EFS20136.1| ribosomal protein S10 [Staphylococcus hominis subsp. hominis C80]
 gi|315129669|gb|EFT85660.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           CGS03]
 gi|315193503|gb|EFU23899.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           CGS00]
 gi|315198219|gb|EFU28550.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           CGS01]
 gi|315495653|gb|EFU83984.1| 30S ribosomal protein S10 [Staphylococcus lugdunensis M23590]
 gi|319400624|gb|EFV88849.1| ribosomal protein S10 [Staphylococcus epidermidis FRI909]
 gi|320140211|gb|EFW32070.1| ribosomal protein S10 [Staphylococcus aureus subsp. aureus MRSA131]
 gi|320143481|gb|EFW35262.1| ribosomal protein S10 [Staphylococcus aureus subsp. aureus MRSA177]
 gi|323440069|gb|EGA97784.1| 30S ribosomal protein S10 [Staphylococcus aureus O11]
 gi|323442743|gb|EGB00369.1| 30S ribosomal protein S10 [Staphylococcus aureus O46]
 gi|329314934|gb|AEB89347.1| 30S ribosomal protein S10 [Staphylococcus aureus subsp. aureus
           T0131]
 gi|329723458|gb|EGG59987.1| ribosomal protein S10 [Staphylococcus aureus subsp. aureus 21172]
 gi|329730370|gb|EGG66760.1| ribosomal protein S10 [Staphylococcus aureus subsp. aureus 21193]
 gi|329731280|gb|EGG67650.1| ribosomal protein S10 [Staphylococcus epidermidis VCU144]
 gi|329732088|gb|EGG68443.1| ribosomal protein S10 [Staphylococcus aureus subsp. aureus 21189]
 gi|329736979|gb|EGG73234.1| ribosomal protein S10 [Staphylococcus epidermidis VCU045]
          Length = 102

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 69/98 (70%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D R++D S  +IV T K+SG+ + GPIP P     +T+ R+ H  K SR+Q
Sbjct: 5   KIRIRLKAYDHRVIDQSAEKIVETAKRSGADVSGPIPLPTEKSVYTIIRAVHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R +KRL+ I+ PTP+TVDALM L++ +GV++ IKL
Sbjct: 65  FEQRTHKRLIDIVNPTPKTVDALMGLNLPSGVDIEIKL 102


>gi|260655384|ref|ZP_05860872.1| ribosomal protein S10 [Jonquetella anthropi E3_33 E1]
 gi|260629832|gb|EEX48026.1| ribosomal protein S10 [Jonquetella anthropi E3_33 E1]
          Length = 102

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 78/104 (75%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M+++NIRI   LKAFD R++D+S  +I     +SG+++ GPIP P ++++F V RSPH +
Sbjct: 1   MSTKNIRIR--LKAFDHRVIDASAAQIADAAVRSGAKVAGPIPLPTNVKKFCVLRSPHAN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K +R+  EMR +KRL+ I+ PT +T++ALM+L++ +GV++ IKL
Sbjct: 59  KDAREHFEMRTHKRLIDIMDPTQKTMEALMQLNLPSGVDIQIKL 102


>gi|297623273|ref|YP_003704707.1| 30S ribosomal protein S10 [Truepera radiovictrix DSM 17093]
 gi|297164453|gb|ADI14164.1| ribosomal protein S10 [Truepera radiovictrix DSM 17093]
          Length = 106

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 49/97 (50%), Positives = 67/97 (69%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I L+AFD + LDSS  +IV T K++G+++ GP+P P  IRRF V RSP  DK SR+ 
Sbjct: 5   RIRIKLRAFDHKSLDSSATKIVDTVKRTGAKVAGPVPLPTRIRRFCVLRSPFTDKDSREH 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E+R + RL+ I  PT  T+D+LM LD+  GV++ IK
Sbjct: 65  FEIRTHNRLIDIKTPTKSTIDSLMHLDLPTGVDIEIK 101


>gi|294786410|ref|ZP_06751664.1| ribosomal protein S10 [Parascardovia denticolens F0305]
 gi|294790410|ref|ZP_06755568.1| ribosomal protein S10 [Scardovia inopinata F0304]
 gi|315225972|ref|ZP_07867760.1| 30S ribosomal protein S10 [Parascardovia denticolens DSM 10105]
 gi|294458307|gb|EFG26660.1| ribosomal protein S10 [Scardovia inopinata F0304]
 gi|294485243|gb|EFG32877.1| ribosomal protein S10 [Parascardovia denticolens F0305]
 gi|315120104|gb|EFT83236.1| 30S ribosomal protein S10 [Parascardovia denticolens DSM 10105]
          Length = 102

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 47/98 (47%), Positives = 67/98 (68%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++D S ++IV T   +G+ +VGP+P P     F V RSPH  K SR+ 
Sbjct: 5   KIRIRLKSYDHEVIDQSAKKIVETVTNAGATVVGPVPLPTEKNVFVVIRSPHKYKDSREH 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTP+ VD+LM+LD+ A VN+ IKL
Sbjct: 65  FEMRTHKRLIDIVDPTPKAVDSLMRLDLPADVNIEIKL 102


>gi|319893201|ref|YP_004150076.1| SSU ribosomal protein S10p (S20e) [Staphylococcus pseudintermedius
           HKU10-03]
 gi|317162897|gb|ADV06440.1| SSU ribosomal protein S10p (S20e) [Staphylococcus pseudintermedius
           HKU10-03]
 gi|323463751|gb|ADX75904.1| ribosomal protein S10 [Staphylococcus pseudintermedius ED99]
          Length = 102

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 69/98 (70%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D R++D S  +IV T K+SG+ + GPIP P     +T+ R+ H  K SR+Q
Sbjct: 5   KIRIRLKAYDHRVIDQSAEKIVETAKRSGADVSGPIPLPTEKAVYTIIRAVHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R +KRL+ I+ PTP+TVDALM L++ +GV++ IKL
Sbjct: 65  FEQRTHKRLIDIVNPTPKTVDALMGLNLPSGVDIEIKL 102


>gi|254421961|ref|ZP_05035679.1| ribosomal protein S10 [Synechococcus sp. PCC 7335]
 gi|196189450|gb|EDX84414.1| ribosomal protein S10 [Synechococcus sp. PCC 7335]
          Length = 106

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD R+LD+S  +IV T  ++ +  VGPIP P   + + V RSPHVDK SR+ 
Sbjct: 9   KIRIRLKAFDRRLLDTSCEKIVETANRTNATAVGPIPLPTKRKIYCVLRSPHVDKDSREH 68

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R ++R++ I +P+ +T+DALMKLD+ AGV++ +KL
Sbjct: 69  FETRTHRRIIDIYQPSSRTIDALMKLDLPAGVDIEVKL 106


>gi|163840907|ref|YP_001625312.1| SSU ribosomal protein S10P [Renibacterium salmoninarum ATCC 33209]
 gi|162954383|gb|ABY23898.1| SSU ribosomal protein S10P [Renibacterium salmoninarum ATCC 33209]
          Length = 124

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 70/104 (67%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LK++D  ++D S R+IV T  ++G+ +VGP+P P     + V RSPH  
Sbjct: 23  MAGQKIRIR--LKSYDHEVIDVSARKIVETVTRAGATVVGPVPLPTEKNVYCVIRSPHKY 80

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+  EMR +KRL+ II PTP+ VD+LM+LD+ A VN+ IKL
Sbjct: 81  KDSREHFEMRTHKRLIDIIDPTPKAVDSLMRLDLPADVNIEIKL 124


>gi|227497180|ref|ZP_03927428.1| ribosomal protein S10 [Actinomyces urogenitalis DSM 15434]
 gi|320531959|ref|ZP_08032860.1| ribosomal protein S10 [Actinomyces sp. oral taxon 171 str. F0337]
 gi|325068029|ref|ZP_08126702.1| ribosomal protein S10 [Actinomyces oris K20]
 gi|326773962|ref|ZP_08233244.1| ribosomal protein S10 [Actinomyces viscosus C505]
 gi|329945683|ref|ZP_08293413.1| ribosomal protein S10 [Actinomyces sp. oral taxon 170 str. F0386]
 gi|226833311|gb|EEH65694.1| ribosomal protein S10 [Actinomyces urogenitalis DSM 15434]
 gi|320135826|gb|EFW27873.1| ribosomal protein S10 [Actinomyces sp. oral taxon 171 str. F0337]
 gi|326636101|gb|EGE37005.1| ribosomal protein S10 [Actinomyces viscosus C505]
 gi|328528491|gb|EGF55465.1| ribosomal protein S10 [Actinomyces sp. oral taxon 170 str. F0386]
          Length = 102

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 70/104 (67%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LK++D  ++DSS R+IV    ++G+ +VGP+P P     F V RSPH  
Sbjct: 1   MAGQKIRIR--LKSYDHEVIDSSARKIVDVVTRAGATVVGPVPLPTEKNVFCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+  EMR +KRL+ I+ PTP+ VD+LM+LD+ A VN+ IKL
Sbjct: 59  KDSREHFEMRTHKRLIDIVDPTPKAVDSLMRLDLPADVNIEIKL 102


>gi|225850734|ref|YP_002730968.1| 30S ribosomal protein S10 [Persephonella marina EX-H1]
 gi|254809979|sp|C0QQM2|RS10_PERMH RecName: Full=30S ribosomal protein S10
 gi|225646226|gb|ACO04412.1| ribosomal protein S10 [Persephonella marina EX-H1]
          Length = 103

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD ++LD S+++I+ T K+SG  I GPIP P   + + V RSPH  ++SR+ 
Sbjct: 5   KIRIKLKAFDHKVLDQSVKQIIDTVKRSGGVIKGPIPLPTQRKVWCVLRSPHKFEQSREH 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMRI+KRL+ I   TPQT++ALM + + AGV+V IKL
Sbjct: 65  FEMRIHKRLIDIENATPQTIEALMDISLPAGVDVEIKL 102


>gi|222529731|ref|YP_002573613.1| 30S ribosomal protein S10 [Caldicellulosiruptor bescii DSM 6725]
 gi|302871497|ref|YP_003840133.1| ribosomal protein S10 [Caldicellulosiruptor obsidiansis OB47]
 gi|312127225|ref|YP_003992099.1| 30S ribosomal protein S10 [Caldicellulosiruptor hydrothermalis 108]
 gi|312135497|ref|YP_004002835.1| 30S ribosomal protein S10 [Caldicellulosiruptor owensensis OL]
 gi|312622044|ref|YP_004023657.1| 30S ribosomal protein S10 [Caldicellulosiruptor kronotskyensis
           2002]
 gi|312793940|ref|YP_004026863.1| 30S ribosomal protein S10 [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312877364|ref|ZP_07737329.1| ribosomal protein S10 [Caldicellulosiruptor lactoaceticus 6A]
 gi|254809574|sp|B9MKI2|RS10_ANATD RecName: Full=30S ribosomal protein S10
 gi|222456578|gb|ACM60840.1| ribosomal protein S10 [Caldicellulosiruptor bescii DSM 6725]
 gi|302574356|gb|ADL42147.1| ribosomal protein S10 [Caldicellulosiruptor obsidiansis OB47]
 gi|311775548|gb|ADQ05035.1| ribosomal protein S10 [Caldicellulosiruptor owensensis OL]
 gi|311777244|gb|ADQ06730.1| ribosomal protein S10 [Caldicellulosiruptor hydrothermalis 108]
 gi|311795838|gb|EFR12202.1| ribosomal protein S10 [Caldicellulosiruptor lactoaceticus 6A]
 gi|312181080|gb|ADQ41250.1| ribosomal protein S10 [Caldicellulosiruptor kristjanssonii 177R1B]
 gi|312202511|gb|ADQ45838.1| ribosomal protein S10 [Caldicellulosiruptor kronotskyensis 2002]
          Length = 106

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 74/102 (72%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           S+  R+ I LK+FD ++L+ S ++IV T K +G+++ GP+P P      T+ R+PH  K 
Sbjct: 2   SKAQRMRIKLKSFDYKLLEQSAKKIVETAKNTGAEVSGPVPLPTDREVITIIRAPHKYKD 61

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           SR+Q E++ +KRL+ IIKPT +TVDALM++++ AGV++ IKL
Sbjct: 62  SREQFEIKTHKRLIDIIKPTQKTVDALMRVELPAGVDIEIKL 103


>gi|332170558|gb|AEE19813.1| ribosomal protein S10 [Krokinobacter diaphorus 4H-3-7-5]
          Length = 101

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 69/98 (70%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++D S  +IV T K +G+ + GPIP P   + FTV RSPHV+KKSR+Q
Sbjct: 4   KIRIKLKSYDHNLVDKSAEKIVRTVKTTGAVVTGPIPLPTHKKIFTVLRSPHVNKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+  YKRLL I   + +T+DALMKL++ +GV V IK+
Sbjct: 64  FELSSYKRLLDIYSSSSKTIDALMKLELPSGVEVEIKV 101


>gi|269837065|ref|YP_003319293.1| 30S ribosomal protein S10 [Sphaerobacter thermophilus DSM 20745]
 gi|269786328|gb|ACZ38471.1| ribosomal protein S10 [Sphaerobacter thermophilus DSM 20745]
          Length = 106

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 46/98 (46%), Positives = 73/98 (74%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D +ILD S  +IV T + +G+++ GP+P P  I RF+V RSP +DK S++Q
Sbjct: 9   KIRIRLKAYDHKILDQSAAKIVDTAESTGAKVSGPVPLPTRIERFSVIRSPFIDKDSQEQ 68

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRL+ +++P+  T+ ALM+L++ AGV++ IKL
Sbjct: 69  FEIRTHKRLIDVLEPSHATIRALMRLNLPAGVDIEIKL 106


>gi|218246373|ref|YP_002371744.1| 30S ribosomal protein S10 [Cyanothece sp. PCC 8801]
 gi|257059417|ref|YP_003137305.1| 30S ribosomal protein S10 [Cyanothece sp. PCC 8802]
 gi|218166851|gb|ACK65588.1| ribosomal protein S10 [Cyanothece sp. PCC 8801]
 gi|256589583|gb|ACV00470.1| ribosomal protein S10 [Cyanothece sp. PCC 8802]
          Length = 104

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 71/104 (68%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M +   +I I LKAFD R+LD+S  +IV T  ++ +  +GPIP P   R + V RSPHVD
Sbjct: 1   MATLQQKIRIRLKAFDRRLLDTSCEKIVDTANRTEATAIGPIPLPTKRRIYCVLRSPHVD 60

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+  E R ++R++ I +P+ +T+DALMKLD+ AGV + +KL
Sbjct: 61  KDSREHFETRTHRRIIDIYQPSSKTIDALMKLDLPAGVEIEVKL 104


>gi|149371628|ref|ZP_01891044.1| 30S ribosomal protein S10 [unidentified eubacterium SCB49]
 gi|149355255|gb|EDM43815.1| 30S ribosomal protein S10 [unidentified eubacterium SCB49]
          Length = 101

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 69/98 (70%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++D S  +IV T K +G+ + GPIP P   + FTV RSPHV+KKSR+Q
Sbjct: 4   KIRIKLKSYDHNLVDKSAEKIVKTVKSTGAAVTGPIPLPTHKKIFTVLRSPHVNKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            ++  YKRLL I   + +T+DALMKL++ +GV V IK+
Sbjct: 64  FQLSSYKRLLDIYSSSSKTIDALMKLELPSGVEVEIKV 101


>gi|126662265|ref|ZP_01733264.1| 30S ribosomal protein S10 [Flavobacteria bacterium BAL38]
 gi|126625644|gb|EAZ96333.1| 30S ribosomal protein S10 [Flavobacteria bacterium BAL38]
          Length = 101

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 69/98 (70%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++D S  +IV T K +G+ + GPIP P   + FTV RSPHV+KKSR+Q
Sbjct: 4   KIRIKLKSYDHMLVDKSAEKIVKTVKSTGAVVTGPIPLPTHKKIFTVLRSPHVNKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+  YKRLL I   + +T+DALMKL++ +GV V IK+
Sbjct: 64  FELSSYKRLLDIYSSSSKTIDALMKLELPSGVEVEIKV 101


>gi|210623187|ref|ZP_03293626.1| hypothetical protein CLOHIR_01576 [Clostridium hiranonis DSM 13275]
 gi|210153724|gb|EEA84730.1| hypothetical protein CLOHIR_01576 [Clostridium hiranonis DSM 13275]
          Length = 103

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 73/102 (71%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           ++N +I I LK++D ++LD S  +IV T KK+GSQ+ GP+P P   +  T+ R+ H  K 
Sbjct: 2   AKNEKIRIRLKSYDHKLLDFSAGKIVETAKKAGSQVSGPVPLPTEKKIVTILRAVHKYKD 61

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           SR+Q E+R +KRL+ I  PT +TVD+LM+LD+ AGV++ IKL
Sbjct: 62  SREQFEIRTHKRLIDIANPTQKTVDSLMRLDLPAGVDIEIKL 103


>gi|298373291|ref|ZP_06983280.1| ribosomal protein S10 [Bacteroidetes oral taxon 274 str. F0058]
 gi|298274343|gb|EFI15895.1| ribosomal protein S10 [Bacteroidetes oral taxon 274 str. F0058]
          Length = 102

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 71/104 (68%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M+ + IRI   LK++D  ++D S  +IV T K +G+ + GPIP P   R FTVNRS  V+
Sbjct: 1   MSQQKIRIK--LKSYDYNLVDKSAEKIVKTAKATGAAVSGPIPLPTHKRIFTVNRSTFVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSR+Q E+  YKRL+ I   T Q VDALMKL++ +GV+V IK+
Sbjct: 59  KKSREQFELSSYKRLIDIYSSTSQVVDALMKLELPSGVSVEIKV 102


>gi|159029227|emb|CAO87587.1| rpsJ [Microcystis aeruginosa PCC 7806]
          Length = 105

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 48/103 (46%), Positives = 72/103 (69%)

Query: 2   TSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDK 61
           T +  +I I LKAFD R+LD+S  +IV T  ++ +  +GPIP P   + + V RSPHVDK
Sbjct: 3   TLQQQKIRIRLKAFDQRLLDTSCEKIVDTANRTNATAIGPIPLPTKRKIYCVLRSPHVDK 62

Query: 62  KSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            SR+  E R ++R++ I +P+ +T+DALMKLD+ AGV++ +KL
Sbjct: 63  DSREHFETRTHRRIIDIYQPSSKTIDALMKLDLPAGVDIEVKL 105


>gi|162446956|ref|YP_001620088.1| 30S ribosomal protein S10 [Acholeplasma laidlawii PG-8A]
 gi|161985063|gb|ABX80712.1| small subunit ribosomal protein S10 [Acholeplasma laidlawii PG-8A]
          Length = 102

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 70/96 (72%)

Query: 8   ICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQL 67
           I I LKA+D R++D + ++I+ + +K+G  + GPIP P     FTV RSPHV+K SR+Q 
Sbjct: 6   IKISLKAYDHRLIDQAAKKIIESVEKTGVVVQGPIPLPTKKEIFTVLRSPHVNKDSREQF 65

Query: 68  EMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           E R +KRL+ I+ P  +T+DALM++D+ +G+++V+K
Sbjct: 66  ERRTHKRLIQILDPNSKTIDALMRIDLPSGIDIVLK 101


>gi|116671522|ref|YP_832455.1| 30S ribosomal protein S10 [Arthrobacter sp. FB24]
 gi|119961625|ref|YP_948658.1| 30S ribosomal protein S10 [Arthrobacter aurescens TC1]
 gi|184200261|ref|YP_001854468.1| 30S ribosomal protein S10 [Kocuria rhizophila DC2201]
 gi|220913433|ref|YP_002488742.1| 30S ribosomal protein S10 [Arthrobacter chlorophenolicus A6]
 gi|325964167|ref|YP_004242073.1| 30S ribosomal protein S10P [Arthrobacter phenanthrenivorans Sphe3]
 gi|166231236|sp|A1R8U6|RS10_ARTAT RecName: Full=30S ribosomal protein S10
 gi|166231237|sp|A0JZ85|RS10_ARTS2 RecName: Full=30S ribosomal protein S10
 gi|226705581|sp|B2GIL3|RS10_KOCRD RecName: Full=30S ribosomal protein S10
 gi|254809575|sp|B8HD07|RS10_ARTCA RecName: Full=30S ribosomal protein S10
 gi|116611631|gb|ABK04355.1| SSU ribosomal protein S10P [Arthrobacter sp. FB24]
 gi|119948484|gb|ABM07395.1| ribosomal protein S10 [Arthrobacter aurescens TC1]
 gi|183580491|dbj|BAG28962.1| 30S ribosomal protein S10 [Kocuria rhizophila DC2201]
 gi|219860311|gb|ACL40653.1| ribosomal protein S10 [Arthrobacter chlorophenolicus A6]
 gi|323470254|gb|ADX73939.1| SSU ribosomal protein S10P [Arthrobacter phenanthrenivorans Sphe3]
          Length = 102

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 70/104 (67%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LK++D  ++D S R+IV T  ++G+ +VGP+P P     + V RSPH  
Sbjct: 1   MAGQKIRIR--LKSYDHEVIDVSARKIVETVTRAGATVVGPVPLPTEKNVYCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+  EMR +KRL+ II PTP+ VD+LM+LD+ A VN+ IKL
Sbjct: 59  KDSREHFEMRTHKRLIDIIDPTPKAVDSLMRLDLPADVNIEIKL 102


>gi|67921719|ref|ZP_00515236.1| Ribosomal protein S10, bacterial form [Crocosphaera watsonii WH
           8501]
 gi|126658886|ref|ZP_01730029.1| 30S ribosomal protein S10 [Cyanothece sp. CCY0110]
 gi|172039000|ref|YP_001805501.1| 30S ribosomal protein S10 [Cyanothece sp. ATCC 51142]
 gi|254809593|sp|B1WQY3|RS10_CYAA5 RecName: Full=30S ribosomal protein S10
 gi|67856311|gb|EAM51553.1| Ribosomal protein S10, bacterial form [Crocosphaera watsonii WH
           8501]
 gi|126619836|gb|EAZ90562.1| 30S ribosomal protein S10 [Cyanothece sp. CCY0110]
 gi|171700454|gb|ACB53435.1| 30S ribosomal protein S10 [Cyanothece sp. ATCC 51142]
          Length = 105

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 69/98 (70%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD R+LD+S  +IV T  ++ +  +GPIP P   R + V RSPHVDK SR+ 
Sbjct: 8   KIRIRLKAFDRRLLDTSCEKIVDTANRTDATAIGPIPLPTKRRIYCVLRSPHVDKDSREH 67

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R ++R++ I +P+ +T+DALMKLD+ AGV + +KL
Sbjct: 68  FETRTHRRIIDIYQPSSKTIDALMKLDLPAGVEIEVKL 105


>gi|19551745|ref|NP_599747.1| 30S ribosomal protein S10 [Corynebacterium glutamicum ATCC 13032]
 gi|145294655|ref|YP_001137476.1| 30S ribosomal protein S10 [Corynebacterium glutamicum R]
 gi|161485995|ref|NP_737131.2| 30S ribosomal protein S10 [Corynebacterium efficiens YS-314]
 gi|161486722|ref|YP_224802.2| 30S ribosomal protein S10 [Corynebacterium glutamicum ATCC 13032]
 gi|300857761|ref|YP_003782744.1| 30S ribosomal protein S10 [Corynebacterium pseudotuberculosis
           FRC41]
 gi|54039316|sp|P66327|RS10_COREF RecName: Full=30S ribosomal protein S10
 gi|54042097|sp|P66326|RS10_CORGL RecName: Full=30S ribosomal protein S10
 gi|166231266|sp|A4QBH7|RS10_CORGB RecName: Full=30S ribosomal protein S10
 gi|21323269|dbj|BAB97897.1| Ribosomal protein S10 [Corynebacterium glutamicum ATCC 13032]
 gi|140844575|dbj|BAF53574.1| hypothetical protein [Corynebacterium glutamicum R]
 gi|300685215|gb|ADK28137.1| 30S ribosomal protein S10 [Corynebacterium pseudotuberculosis
           FRC41]
 gi|302205499|gb|ADL09841.1| 30S ribosomal protein S10 [Corynebacterium pseudotuberculosis C231]
 gi|302330054|gb|ADL20248.1| 30S ribosomal protein S10 [Corynebacterium pseudotuberculosis 1002]
 gi|308275735|gb|ADO25634.1| 30S ribosomal protein S10 [Corynebacterium pseudotuberculosis I19]
          Length = 101

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 69/97 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D   +D+S R+IV T  ++G+++VGP+P P     + V RSPH  K SR+ 
Sbjct: 5   KIRIRLKAYDHEAIDASARKIVETVTRTGARVVGPVPLPTEKNVYAVIRSPHKYKDSREH 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            EMR +KRL+ I+ PTP+TVDALM++D+ A V+V I+
Sbjct: 65  FEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNIQ 101


>gi|260905722|ref|ZP_05914044.1| SSU ribosomal protein S10P [Brevibacterium linens BL2]
          Length = 102

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 71/104 (68%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LK++D  ++DS+ R+IV T  ++G+ +VGP+P P     + V RSPH  
Sbjct: 1   MAGQKIRIR--LKSYDHAVIDSAARKIVDTVTRAGATVVGPVPLPTEKNVYCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+  EMR +KRL+ I+ PTP+ VD+LM+LD+A  VN+ IKL
Sbjct: 59  KDSREHFEMRTHKRLIDIVDPTPKAVDSLMRLDLADDVNIEIKL 102


>gi|259506794|ref|ZP_05749694.1| 30S ribosomal protein S10 [Corynebacterium efficiens YS-314]
 gi|259165665|gb|EEW50219.1| 30S ribosomal protein S10 [Corynebacterium efficiens YS-314]
          Length = 113

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 69/97 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D   +D+S R+IV T  ++G+++VGP+P P     + V RSPH  K SR+ 
Sbjct: 17  KIRIRLKAYDHEAIDASARKIVETVTRTGARVVGPVPLPTEKNVYAVIRSPHKYKDSREH 76

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            EMR +KRL+ I+ PTP+TVDALM++D+ A V+V I+
Sbjct: 77  FEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNIQ 113


>gi|253827223|ref|ZP_04870108.1| ribosomal protein S10 [Helicobacter canadensis MIT 98-5491]
 gi|253510629|gb|EES89288.1| ribosomal protein S10 [Helicobacter canadensis MIT 98-5491]
          Length = 103

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 72/97 (74%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + LKA+D R+LD S+  IV   K++G++I GPIP P   RR+TV +SPH++K SR+Q
Sbjct: 3   KIRLKLKAYDHRVLDRSVVSIVEAVKRTGAEIRGPIPLPTKKRRYTVLKSPHINKDSREQ 62

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E+R++ R++ I+  TP+TVD+L KLD+A  V+V ++
Sbjct: 63  FEIRVHCRVIDIVSATPETVDSLTKLDMAPEVDVEVR 99


>gi|242309318|ref|ZP_04808473.1| 30S ribosomal protein S10 [Helicobacter pullorum MIT 98-5489]
 gi|239523889|gb|EEQ63755.1| 30S ribosomal protein S10 [Helicobacter pullorum MIT 98-5489]
          Length = 103

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 72/97 (74%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + LKA+D R+LD S+  IV   K++G++I GPIP P   RR+TV +SPH++K SR+Q
Sbjct: 3   KIRLKLKAYDHRVLDRSVVSIVEAVKRTGAEIRGPIPLPTKKRRYTVLKSPHINKDSREQ 62

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E+R++ R++ I+  TP+TVD+L KLD+A  V+V ++
Sbjct: 63  FEIRVHCRVIDIVSATPETVDSLTKLDMAPEVDVEVR 99


>gi|254517469|ref|ZP_05129525.1| ribosomal protein S10 [Clostridium sp. 7_2_43FAA]
 gi|226911218|gb|EEH96419.1| ribosomal protein S10 [Clostridium sp. 7_2_43FAA]
          Length = 102

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 72/104 (69%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M+ + IRI   LKAFD  ILD S  +IV T K +G+++ GP+P P      T+ R+ H  
Sbjct: 1   MSKQKIRIR--LKAFDHNILDQSAEKIVETAKSTGAKVAGPVPLPTEKDVVTILRAVHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+Q E+R +KRL+ I+ P+P+TVDALM+L++ AGV++ IKL
Sbjct: 59  KDSREQFEIRTHKRLIDIVNPSPKTVDALMRLNLPAGVDIEIKL 102


>gi|167755911|ref|ZP_02428038.1| hypothetical protein CLORAM_01431 [Clostridium ramosum DSM 1402]
 gi|237733227|ref|ZP_04563708.1| 30S ribosomal protein S10 [Mollicutes bacterium D7]
 gi|167703903|gb|EDS18482.1| hypothetical protein CLORAM_01431 [Clostridium ramosum DSM 1402]
 gi|229383608|gb|EEO33699.1| 30S ribosomal protein S10 [Coprobacillus sp. D7]
          Length = 102

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 71/100 (71%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LK+FD +ILD+S  +I+   KKSG+Q+VGP+P P     +TV R+ H  K SR
Sbjct: 3   NNKIRIRLKSFDHKILDNSAEKIIGAAKKSGAQVVGPVPLPTEKEIYTVLRAVHKYKDSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q E+R +KRL+ I+ PT +TVD L +L++ +GV++ IKL
Sbjct: 63  EQFEIRTHKRLIDIVNPTQETVDILTRLELPSGVDIEIKL 102


>gi|134103265|ref|YP_001108926.1| 30S ribosomal protein S10 [Saccharopolyspora erythraea NRRL 2338]
 gi|291007942|ref|ZP_06565915.1| 30S ribosomal protein S10 [Saccharopolyspora erythraea NRRL 2338]
 gi|166231776|sp|A4FPM6|RS10_SACEN RecName: Full=30S ribosomal protein S10
 gi|133915888|emb|CAM06001.1| 30S ribosomal protein S10 [Saccharopolyspora erythraea NRRL 2338]
          Length = 101

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 72/103 (69%), Gaps = 2/103 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LKA+D   +D+S R+IV T  ++G+++VGP+P P     + V RSPH  
Sbjct: 1   MAGQKIRIR--LKAYDHEAIDASARKIVETVTRTGARVVGPVPLPTEKNVYCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           K SR+  EMR +KRL+ I++PTP+TVDALM++D+ A V+V I+
Sbjct: 59  KDSREHFEMRTHKRLIDILEPTPKTVDALMRIDLPASVDVNIQ 101


>gi|237786396|ref|YP_002907101.1| 30S ribosomal protein S10 [Corynebacterium kroppenstedtii DSM
           44385]
 gi|237759308|gb|ACR18558.1| 30S ribosomal protein S10 [Corynebacterium kroppenstedtii DSM
           44385]
          Length = 108

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 49/97 (50%), Positives = 68/97 (70%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D   +D+S R+IV T  ++G+ +VGPIP P     + V RSPH  K SR+ 
Sbjct: 12  KIRIRLKAYDHEAIDASARKIVETVTRTGATVVGPIPLPTEKNVYCVIRSPHKYKDSREH 71

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            EMR +KRL+ II PTP+TVDALM++D+ A V+V I+
Sbjct: 72  FEMRTHKRLIDIIDPTPKTVDALMRIDLPASVDVNIQ 108


>gi|169350794|ref|ZP_02867732.1| hypothetical protein CLOSPI_01568 [Clostridium spiroforme DSM 1552]
 gi|169292380|gb|EDS74513.1| hypothetical protein CLOSPI_01568 [Clostridium spiroforme DSM 1552]
          Length = 102

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 71/100 (71%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LK+FD +ILD+S  +I+   KKSG+Q+VGP+P P     +T+ R+ H  K SR
Sbjct: 3   NNKIRIRLKSFDHKILDNSAEKIIGAAKKSGAQVVGPVPLPTEKEIYTILRAVHKYKDSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q E+R +KRL+ I+ PT +TVD L +L++ +GV++ IKL
Sbjct: 63  EQFEIRTHKRLIDIVNPTQETVDVLTRLELPSGVDIEIKL 102


>gi|56750666|ref|YP_171367.1| 30S ribosomal protein S10 [Synechococcus elongatus PCC 6301]
 gi|81299692|ref|YP_399900.1| 30S ribosomal protein S10 [Synechococcus elongatus PCC 7942]
 gi|81596482|sp|Q5N4C2|RS10_SYNP6 RecName: Full=30S ribosomal protein S10
 gi|118597332|sp|Q31PV6|RS10_SYNE7 RecName: Full=30S ribosomal protein S10
 gi|56685625|dbj|BAD78847.1| 30S ribosomal protein S10 [Synechococcus elongatus PCC 6301]
 gi|81168573|gb|ABB56913.1| SSU ribosomal protein S10P [Synechococcus elongatus PCC 7942]
          Length = 105

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 69/98 (70%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD R+LD+S   IV T  ++ +  +GPIP P   R + V RSPHVDK SR+ 
Sbjct: 8   KIRIRLKAFDRRLLDTSCDRIVETANRTNATAIGPIPLPTRRRIYCVLRSPHVDKDSREH 67

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R ++R++ I +P+ +T+DALMKLD+ AGV++ +KL
Sbjct: 68  FETRTHRRIIDIYQPSSKTIDALMKLDLPAGVDIEVKL 105


>gi|23492357|dbj|BAC17331.1| putative 30S ribosomal protein S10 [Corynebacterium efficiens
           YS-314]
          Length = 137

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 69/97 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D   +D+S R+IV T  ++G+++VGP+P P     + V RSPH  K SR+ 
Sbjct: 41  KIRIRLKAYDHEAIDASARKIVETVTRTGARVVGPVPLPTEKNVYAVIRSPHKYKDSREH 100

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            EMR +KRL+ I+ PTP+TVDALM++D+ A V+V I+
Sbjct: 101 FEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNIQ 137


>gi|41324734|emb|CAF19216.1| RIBOSOMAL PROTEIN S10 [Corynebacterium glutamicum ATCC 13032]
          Length = 110

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 69/97 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D   +D+S R+IV T  ++G+++VGP+P P     + V RSPH  K SR+ 
Sbjct: 14  KIRIRLKAYDHEAIDASARKIVETVTRTGARVVGPVPLPTEKNVYAVIRSPHKYKDSREH 73

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            EMR +KRL+ I+ PTP+TVDALM++D+ A V+V I+
Sbjct: 74  FEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNIQ 110


>gi|213693089|ref|YP_002323675.1| ribosomal protein S10 [Bifidobacterium longum subsp. infantis ATCC
           15697]
 gi|254809608|sp|B7GNE1|RS10_BIFLI RecName: Full=30S ribosomal protein S10
 gi|213524550|gb|ACJ53297.1| ribosomal protein S10 [Bifidobacterium longum subsp. infantis ATCC
           15697]
 gi|320459267|dbj|BAJ69888.1| 30S ribosomal protein S10 [Bifidobacterium longum subsp. infantis
           ATCC 15697]
          Length = 102

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 69/104 (66%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LK++D  ++D S ++IV T   +G+ +VGP+P P     F V RSPH+ 
Sbjct: 1   MAGQKIRIR--LKSYDHEVIDQSAKKIVETVTNAGATVVGPVPLPTEKNVFCVIRSPHMY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+  EMR +KRL+ I+ PTP+ VD+LM +D+ A VN+ IKL
Sbjct: 59  KDSREHFEMRTHKRLIDIVDPTPKAVDSLMHIDLPADVNIEIKL 102


>gi|325287047|ref|YP_004262837.1| 30S ribosomal protein S10 [Cellulophaga lytica DSM 7489]
 gi|324322501|gb|ADY29966.1| 30S ribosomal protein S10 [Cellulophaga lytica DSM 7489]
          Length = 101

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 69/98 (70%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++D S  +IV T K +G+ I GPIP P   + FTV RSPHV+KKSR+Q
Sbjct: 4   KIRIKLKSYDHNLVDKSAEKIVKTVKTTGAVITGPIPLPTHKKIFTVLRSPHVNKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            ++  YKRLL I   + +T+DALMKL++ +GV V IK+
Sbjct: 64  FQLSSYKRLLDIYSSSSKTIDALMKLELPSGVEVEIKV 101


>gi|331702081|ref|YP_004399040.1| 30S ribosomal protein S10 [Lactobacillus buchneri NRRL B-30929]
 gi|329129424|gb|AEB73977.1| 30S ribosomal protein S10 [Lactobacillus buchneri NRRL B-30929]
          Length = 102

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA++ RILD S  +IV T +++G+ I GPIP P     +TV  SPH  K SR+Q
Sbjct: 5   KIRIRLKAYEHRILDQSADKIVATAQRTGATISGPIPLPTDRTIYTVLASPHKFKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+  +KRL+ I+ PTP+TVD+LMKLD+ +GV++ IKL
Sbjct: 65  FEILTHKRLIDILNPTPKTVDSLMKLDLPSGVDIEIKL 102


>gi|284929377|ref|YP_003421899.1| 30S ribosomal protein S10P [cyanobacterium UCYN-A]
 gi|284809821|gb|ADB95518.1| SSU ribosomal protein S10P [cyanobacterium UCYN-A]
          Length = 105

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 69/98 (70%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD R+LD+S  +IV T  ++ +  VGPIP P   R + V RSPHVDK SR+ 
Sbjct: 8   KIRIRLKAFDRRLLDTSCEKIVDTANRTDAIAVGPIPLPTKKRIYCVLRSPHVDKDSREH 67

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R ++R++ I +P+ +T+DALMKLD+ AGV + +KL
Sbjct: 68  FETRTHRRIIDIYQPSSKTIDALMKLDLPAGVEIEVKL 105


>gi|257067061|ref|YP_003153317.1| 30S ribosomal protein S10 [Anaerococcus prevotii DSM 20548]
 gi|256798941|gb|ACV29596.1| ribosomal protein S10 [Anaerococcus prevotii DSM 20548]
          Length = 102

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 69/100 (69%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I L+A+D  ++DSS  +IV   K+SG+++ GPIP P  I R T+ R+ H  K SR
Sbjct: 3   NQKIRIRLRAYDHEVIDSSAEKIVEAVKRSGAEVSGPIPLPTEIERITILRAVHKYKDSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q E R +KRL+ II P  +T+DAL KL++ AGV++ IKL
Sbjct: 63  EQFEQRTHKRLIDIIGPNAKTLDALKKLNLPAGVDIEIKL 102


>gi|166367016|ref|YP_001659289.1| 30S ribosomal protein S10 [Microcystis aeruginosa NIES-843]
 gi|170078664|ref|YP_001735302.1| 30S ribosomal protein S10 [Synechococcus sp. PCC 7002]
 gi|189040378|sp|B0JSD9|RS10_MICAN RecName: Full=30S ribosomal protein S10
 gi|226705635|sp|B1XI62|RS10_SYNP2 RecName: Full=30S ribosomal protein S10
 gi|166089389|dbj|BAG04097.1| 30S ribosomal protein S10 [Microcystis aeruginosa NIES-843]
 gi|169886333|gb|ACB00047.1| ribosomal protein S10 [Synechococcus sp. PCC 7002]
          Length = 105

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 47/98 (47%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD R+LD+S  +IV T  ++ +  +GPIP P   + + V RSPHVDK SR+ 
Sbjct: 8   KIRIRLKAFDRRLLDTSCEKIVDTANRTNATAIGPIPLPTKRKIYCVLRSPHVDKDSREH 67

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R ++R++ I +P+ +T+DALMKLD+ AGV++ +KL
Sbjct: 68  FETRTHRRIIDIYQPSSKTIDALMKLDLPAGVDIEVKL 105


>gi|308178137|ref|YP_003917543.1| 30S ribosomal protein S10 [Arthrobacter arilaitensis Re117]
 gi|307745600|emb|CBT76572.1| 30S ribosomal protein S10 [Arthrobacter arilaitensis Re117]
          Length = 102

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 70/104 (67%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LK++D  ++D S R+IV T  ++G+ +VGP+P P     + V RSPH  
Sbjct: 1   MAGQKIRIR--LKSYDHEVIDVSARKIVETVTRAGATVVGPVPLPTEKNVYCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+  EMR +KRL+ I+ PTP+ VD+LM+LD+ A VN+ IKL
Sbjct: 59  KDSREHFEMRTHKRLIDIVDPTPKAVDSLMRLDLPADVNIEIKL 102


>gi|255038088|ref|YP_003088709.1| 30S ribosomal protein S10 [Dyadobacter fermentans DSM 18053]
 gi|254950844|gb|ACT95544.1| ribosomal protein S10 [Dyadobacter fermentans DSM 18053]
          Length = 101

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 70/100 (70%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I L++FD  ++D S  +IV   K +G+ + GPIP P    +FTV RSPHV+KKSR
Sbjct: 2   NQKIRIKLRSFDHNLVDKSAEKIVKAVKATGAVVSGPIPLPTKTEKFTVLRSPHVNKKSR 61

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q ++  YKRL+ I   + +TVDALMKL++ +GV+V IK+
Sbjct: 62  EQFQLCTYKRLVDIFSTSAKTVDALMKLELPSGVDVEIKV 101


>gi|284992875|ref|YP_003411429.1| 30S ribosomal protein S10 [Geodermatophilus obscurus DSM 43160]
 gi|284066120|gb|ADB77058.1| ribosomal protein S10 [Geodermatophilus obscurus DSM 43160]
          Length = 101

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/103 (48%), Positives = 70/103 (67%), Gaps = 2/103 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LKA+D   +D+S R IV T  K+G+++VGP+P P     + V RSPH  
Sbjct: 1   MAGQKIRIR--LKAYDHEAIDASARRIVETVTKTGARVVGPVPLPTEKNVYCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           K SR+  EMR +KRL+ I+ PTP+TVDALM++D+ A V+V I+
Sbjct: 59  KDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNIQ 101


>gi|239918200|ref|YP_002957758.1| SSU ribosomal protein S10P [Micrococcus luteus NCTC 2665]
 gi|281415609|ref|ZP_06247351.1| SSU ribosomal protein S10P [Micrococcus luteus NCTC 2665]
 gi|289706532|ref|ZP_06502882.1| ribosomal protein S10 [Micrococcus luteus SK58]
 gi|259494598|sp|C5CC63|RS10_MICLC RecName: Full=30S ribosomal protein S10
 gi|239839407|gb|ACS31204.1| SSU ribosomal protein S10P [Micrococcus luteus NCTC 2665]
 gi|289556667|gb|EFD50008.1| ribosomal protein S10 [Micrococcus luteus SK58]
          Length = 102

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 70/104 (67%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LK++D  ++D S R+IV T  ++G+ +VGP+P P     + V RSPH  
Sbjct: 1   MAGQKIRIR--LKSYDHEVIDVSARKIVDTVTRAGATVVGPVPLPTEKNVYCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+  EMR +KRL+ II PTP+ VD+LM+LD+ A VN+ IKL
Sbjct: 59  KDSREHFEMRTHKRLIDIIDPTPKAVDSLMRLDLPADVNIEIKL 102


>gi|16330912|ref|NP_441640.1| 30S ribosomal protein S10 [Synechocystis sp. PCC 6803]
 gi|2500435|sp|P74226|RS10_SYNY3 RecName: Full=30S ribosomal protein S10
 gi|1653406|dbj|BAA18320.1| 30S ribosomal protein S10 [Synechocystis sp. PCC 6803]
          Length = 105

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 72/103 (69%)

Query: 2   TSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDK 61
           T +  +I I LKAFD R+LD+S  +IV T  ++ +  VGPIP P   + + V RSPHVDK
Sbjct: 3   TLQQQKIRIRLKAFDRRLLDTSCDKIVDTANRTNAAAVGPIPLPTKRKIYCVLRSPHVDK 62

Query: 62  KSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            SR+  E R ++R++ I +P+ +T+DALMKLD+ AGV++ +KL
Sbjct: 63  DSREHFETRTHRRIIDIYQPSSKTIDALMKLDLPAGVDIEVKL 105


>gi|325972662|ref|YP_004248853.1| 30S ribosomal protein S10 [Spirochaeta sp. Buddy]
 gi|324027900|gb|ADY14659.1| 30S ribosomal protein S10 [Spirochaeta sp. Buddy]
          Length = 102

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 70/97 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI + L+ FD  +++ S + IV T  ++G+ + GP+P P  I ++TV RSP V+KKSR+Q
Sbjct: 5   RIRVRLRGFDIELVEQSSKAIVETVVRAGATVSGPVPLPTRINKYTVLRSPFVNKKSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            EMR +KRL+ I+ PT + +DALMKL++ AGV+V IK
Sbjct: 65  FEMRTHKRLIDILDPTSKVMDALMKLELPAGVDVEIK 101


>gi|315925257|ref|ZP_07921471.1| 30S ribosomal protein S10 [Pseudoramibacter alactolyticus ATCC
           23263]
 gi|315621491|gb|EFV01458.1| 30S ribosomal protein S10 [Pseudoramibacter alactolyticus ATCC
           23263]
          Length = 120

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 74/104 (71%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M+ + IRI   LKAFD ++LD S + IV T K++G+ + GPIP P      T+ R+ H  
Sbjct: 19  MSKQKIRIR--LKAFDHKLLDQSAQRIVETVKRTGAAVSGPIPLPTDKEVVTILRAVHKY 76

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+Q E+R +KRL+ I++PTP+TVDALM+L++ +GV++ IKL
Sbjct: 77  KDSREQFEIRTHKRLIDILEPTPKTVDALMRLNLPSGVDIEIKL 120


>gi|298207726|ref|YP_003715905.1| 30S ribosomal protein S10 [Croceibacter atlanticus HTCC2559]
 gi|83850363|gb|EAP88231.1| 30S ribosomal protein S10 [Croceibacter atlanticus HTCC2559]
          Length = 101

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 69/98 (70%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++D S  +IV T K +G+ + GPIP P   + FTV RSPHV+KKSR+Q
Sbjct: 4   KIRIKLKSYDHNLVDKSAEKIVKTVKSTGAVVTGPIPLPTHKKIFTVLRSPHVNKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            ++  YKRLL I   + +T+DALMKL++ +GV V IK+
Sbjct: 64  FQLSSYKRLLDIYSSSSKTIDALMKLELPSGVEVEIKV 101


>gi|325479141|gb|EGC82238.1| ribosomal protein S10 [Anaerococcus prevotii ACS-065-V-Col13]
          Length = 102

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 69/100 (69%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I L+A+D  ++DSS  +IV   K+SG+++ GPIP P  I R T+ R+ H  K SR
Sbjct: 3   NQKIRIRLRAYDHEVIDSSAEKIVEAVKRSGAEVSGPIPLPTEIERVTILRAVHKYKDSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q E R +KRL+ II P  +T+DAL KL++ AGV++ IKL
Sbjct: 63  EQFEQRTHKRLIDIIGPNAKTLDALKKLNLPAGVDIEIKL 102


>gi|152993892|ref|YP_001359613.1| 30S ribosomal protein S10 [Sulfurovum sp. NBC37-1]
 gi|166231789|sp|A6QCP7|RS10_SULNB RecName: Full=30S ribosomal protein S10
 gi|151425753|dbj|BAF73256.1| 30S ribosomal protein S10 [Sulfurovum sp. NBC37-1]
          Length = 103

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 71/97 (73%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + LKA+D R+LD S+  IV   K++G++I GPIP P  ++R+TV +SPHV+K +R+Q
Sbjct: 3   KIRLKLKAYDHRVLDRSVAAIVDAVKRTGAEIRGPIPMPTKMKRYTVLKSPHVNKDAREQ 62

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E+RI+ R++ I+  T  T+D+LMKLD+A  + V I+
Sbjct: 63  FEIRIHGRMIDIVSATSDTIDSLMKLDLAPEIEVEIR 99


>gi|258651362|ref|YP_003200518.1| 30S ribosomal protein S10 [Nakamurella multipartita DSM 44233]
 gi|258554587|gb|ACV77529.1| ribosomal protein S10 [Nakamurella multipartita DSM 44233]
          Length = 101

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 71/103 (68%), Gaps = 2/103 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LKA+D   +D+S R+IV T  ++G+++VGP+P P     + V RSPH  
Sbjct: 1   MAGQKIRIR--LKAYDHEAIDASARKIVETVTRTGARVVGPVPLPTEKNVYCVVRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           K SR+  EMR +KRL+ I+ PTP+TVDALM++D+ A V+V I+
Sbjct: 59  KDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNIQ 101


>gi|148273802|ref|YP_001223363.1| 30S ribosomal protein S10 [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
 gi|170780732|ref|YP_001709064.1| 30S ribosomal protein S10 [Clavibacter michiganensis subsp.
           sepedonicus]
 gi|166231260|sp|A5CUB4|RS10_CLAM3 RecName: Full=30S ribosomal protein S10
 gi|189040365|sp|B0RB38|RS10_CLAMS RecName: Full=30S ribosomal protein S10
 gi|147831732|emb|CAN02701.1| 30S ribosomal protein S10 [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
 gi|169155300|emb|CAQ00403.1| 30S ribosomal protein S10 [Clavibacter michiganensis subsp.
           sepedonicus]
          Length = 102

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 70/104 (67%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LK++D  ++DSS R+IV T  ++G+ +VGP+P P       V RSPH  
Sbjct: 1   MAGQKIRIR--LKSYDHSVIDSSARKIVDTVTRAGATVVGPVPLPTEKNVICVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+  EMR +KRL+ I+ PTP+ VD+LM+LD+ A VN+ IKL
Sbjct: 59  KDSREHFEMRTHKRLIDIVDPTPKAVDSLMRLDLPADVNIEIKL 102


>gi|163752918|ref|ZP_02160042.1| 30S ribosomal protein S10 [Kordia algicida OT-1]
 gi|260061896|ref|YP_003194976.1| 30S ribosomal protein S10 [Robiginitalea biformata HTCC2501]
 gi|305665138|ref|YP_003861425.1| 30S ribosomal protein S10 [Maribacter sp. HTCC2170]
 gi|88709890|gb|EAR02122.1| 30S ribosomal protein S10 [Maribacter sp. HTCC2170]
 gi|88786029|gb|EAR17198.1| 30S ribosomal protein S10 [Robiginitalea biformata HTCC2501]
 gi|161326650|gb|EDP97975.1| 30S ribosomal protein S10 [Kordia algicida OT-1]
          Length = 101

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 69/98 (70%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++D S  +IV T K +G+ + GPIP P   + FTV RSPHV+KKSR+Q
Sbjct: 4   KIRIKLKSYDHNLVDKSAEKIVKTVKTTGAVVTGPIPLPTHKKIFTVLRSPHVNKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            ++  YKRLL I   + +T+DALMKL++ +GV V IK+
Sbjct: 64  FQLSSYKRLLDIYSSSSKTIDALMKLELPSGVEVEIKV 101


>gi|118616570|ref|YP_904902.1| 30S ribosomal protein S10 [Mycobacterium ulcerans Agy99]
 gi|166231298|sp|A0PM62|RS10_MYCUA RecName: Full=30S ribosomal protein S10
 gi|118568680|gb|ABL03431.1| 30S ribosomal protein S10, RpsJ [Mycobacterium ulcerans Agy99]
          Length = 101

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 50/103 (48%), Positives = 70/103 (67%), Gaps = 2/103 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LKA+D   +D+S R+IV T  ++G+ +VGP+P P     + V RSPH  
Sbjct: 1   MAGQKIRIR--LKAYDHEAIDASARKIVETVVRTGASVVGPVPLPTEKNVYCVVRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           K SR+  EMR +KRL+ II PTP+TVDALM++D+ A V+V I+
Sbjct: 59  KDSREHFEMRTHKRLIDIIDPTPKTVDALMRIDLPASVDVNIQ 101


>gi|154486746|ref|ZP_02028153.1| hypothetical protein BIFADO_00571 [Bifidobacterium adolescentis
           L2-32]
 gi|171741274|ref|ZP_02917081.1| hypothetical protein BIFDEN_00349 [Bifidobacterium dentium ATCC
           27678]
 gi|212716612|ref|ZP_03324740.1| hypothetical protein BIFCAT_01541 [Bifidobacterium catenulatum DSM
           16992]
 gi|224283708|ref|ZP_03647030.1| 30S ribosomal protein S10 [Bifidobacterium bifidum NCIMB 41171]
 gi|225351046|ref|ZP_03742069.1| hypothetical protein BIFPSEUDO_02628 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|283455365|ref|YP_003359929.1| 30S ribosomal protein S10 [Bifidobacterium dentium Bd1]
 gi|306823569|ref|ZP_07456944.1| 30S ribosomal protein S10 [Bifidobacterium dentium ATCC 27679]
 gi|308235497|ref|ZP_07666234.1| 30S ribosomal protein S10 [Gardnerella vaginalis ATCC 14018]
 gi|309802851|ref|ZP_07696952.1| ribosomal protein S10 [Bifidobacterium dentium JCVIHMP022]
 gi|310288025|ref|YP_003939284.1| 30S ribosomal protein S10 [Bifidobacterium bifidum S17]
 gi|311064898|ref|YP_003971624.1| 30S ribosomal protein S10 RpsJ [Bifidobacterium bifidum PRL2010]
 gi|311115168|ref|YP_003986389.1| 30S ribosomal protein S10 [Gardnerella vaginalis ATCC 14019]
 gi|313140864|ref|ZP_07803057.1| 30S ribosomal protein S10 [Bifidobacterium bifidum NCIMB 41171]
 gi|154084609|gb|EDN83654.1| hypothetical protein BIFADO_00571 [Bifidobacterium adolescentis
           L2-32]
 gi|171276888|gb|EDT44549.1| hypothetical protein BIFDEN_00349 [Bifidobacterium dentium ATCC
           27678]
 gi|212660316|gb|EEB20891.1| hypothetical protein BIFCAT_01541 [Bifidobacterium catenulatum DSM
           16992]
 gi|225158502|gb|EEG71744.1| hypothetical protein BIFPSEUDO_02628 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|283101999|gb|ADB09105.1| rpsJ 30S ribosomal protein S10 [Bifidobacterium dentium Bd1]
 gi|304553276|gb|EFM41188.1| 30S ribosomal protein S10 [Bifidobacterium dentium ATCC 27679]
 gi|308220318|gb|EFO76629.1| ribosomal protein S10 [Bifidobacterium dentium JCVIHMP022]
 gi|309251962|gb|ADO53710.1| 30S ribosomal protein S10 [Bifidobacterium bifidum S17]
 gi|310867218|gb|ADP36587.1| RpsJ 30S ribosomal protein S10 [Bifidobacterium bifidum PRL2010]
 gi|310946662|gb|ADP39366.1| 30S ribosomal protein S10 [Gardnerella vaginalis ATCC 14019]
 gi|313133374|gb|EFR50991.1| 30S ribosomal protein S10 [Bifidobacterium bifidum NCIMB 41171]
          Length = 102

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 46/98 (46%), Positives = 66/98 (67%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++D S ++IV T   +G+ +VGP+P P     F V RSPH  K SR+ 
Sbjct: 5   KIRIRLKSYDHEVIDQSAKKIVETVTNAGATVVGPVPLPTEKNVFVVIRSPHKYKDSREH 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTP+ VD+LM +D+ A VN+ IKL
Sbjct: 65  FEMRTHKRLIDIVDPTPKAVDSLMHIDLPADVNIEIKL 102


>gi|313206881|ref|YP_004046058.1| SSU ribosomal protein s10p [Riemerella anatipestifer DSM 15868]
 gi|312446197|gb|ADQ82552.1| SSU ribosomal protein S10P [Riemerella anatipestifer DSM 15868]
 gi|325335681|gb|ADZ11955.1| Ribosomal protein S10 [Riemerella anatipestifer RA-GD]
          Length = 101

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I LK++D  ++D S  +IV T K +G+ + GPIP P   R FTV RSPHV+KK+R+Q
Sbjct: 4   RIRIKLKSYDYNLVDKSAEKIVKTVKSTGAVVNGPIPLPTHKRIFTVLRSPHVNKKAREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            ++  +KRL+ I   + +TVDALMKL++++GV+V IK+
Sbjct: 64  FQLSAHKRLMDIYSSSSKTVDALMKLELSSGVDVEIKV 101


>gi|313903152|ref|ZP_07836546.1| SSU ribosomal protein S10P [Thermaerobacter subterraneus DSM 13965]
 gi|317123098|ref|YP_004103101.1| 30S ribosomal protein S10P [Thermaerobacter marianensis DSM 12885]
 gi|313466654|gb|EFR62174.1| SSU ribosomal protein S10P [Thermaerobacter subterraneus DSM 13965]
 gi|315593078|gb|ADU52374.1| SSU ribosomal protein S10P [Thermaerobacter marianensis DSM 12885]
          Length = 102

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 47/98 (47%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I L+AFD  +LD S  +IV T +++G++I GP+P P     FTV  +P+ +K  R+Q
Sbjct: 5   KIRIKLRAFDHGVLDQSADKIVETARRTGAKISGPVPLPTERSVFTVLTAPNGEKDHREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ II PTP+T+DAL ++D+ AGV++ IKL
Sbjct: 65  FEMRTHKRLIDIIDPTPKTIDALRRVDLPAGVDIEIKL 102


>gi|298345473|ref|YP_003718160.1| 30S ribosomal protein S10 [Mobiluncus curtisii ATCC 43063]
 gi|304391029|ref|ZP_07372981.1| 30S ribosomal protein S10 [Mobiluncus curtisii subsp. curtisii ATCC
           35241]
 gi|315655882|ref|ZP_07908780.1| 30S ribosomal protein S10 [Mobiluncus curtisii ATCC 51333]
 gi|315656192|ref|ZP_07909083.1| 30S ribosomal protein S10 [Mobiluncus curtisii subsp. holmesii ATCC
           35242]
 gi|298235534|gb|ADI66666.1| 30S ribosomal protein S10 [Mobiluncus curtisii ATCC 43063]
 gi|304325912|gb|EFL93158.1| 30S ribosomal protein S10 [Mobiluncus curtisii subsp. curtisii ATCC
           35241]
 gi|315489946|gb|EFU79573.1| 30S ribosomal protein S10 [Mobiluncus curtisii ATCC 51333]
 gi|315493194|gb|EFU82794.1| 30S ribosomal protein S10 [Mobiluncus curtisii subsp. holmesii ATCC
           35242]
          Length = 102

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 70/104 (67%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LK++D  ++DSS ++IV T   +G+ +VGP+P P     + V RSPH  
Sbjct: 1   MAGQKIRIR--LKSYDHEVIDSSAKKIVETVTSAGATVVGPVPLPTEKNVYVVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+Q E+R +KRL+ II PTP  VD+LM+L++ A VN+ IKL
Sbjct: 59  KDSREQFEVRTHKRLIDIIDPTPSAVDSLMRLELPADVNIEIKL 102


>gi|239618266|ref|YP_002941588.1| ribosomal protein S10 [Kosmotoga olearia TBF 19.5.1]
 gi|259494596|sp|C5CGR5|RS10_KOSOT RecName: Full=30S ribosomal protein S10
 gi|239507097|gb|ACR80584.1| ribosomal protein S10 [Kosmotoga olearia TBF 19.5.1]
          Length = 102

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D R+LD+S ++IV   K + +++ GPIP P     +TV  SPH  K +R+Q
Sbjct: 5   KIRIRLKAYDHRLLDASAKKIVEAVKMTNAKVSGPIPLPTERTLYTVLTSPHKYKDAREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E  ++KRL+ II PTP+T+D+LMK+D+ AGV+V IKL
Sbjct: 65  FEKLVHKRLIEIIDPTPKTIDSLMKVDLPAGVDVEIKL 102


>gi|34541542|ref|NP_906021.1| 30S ribosomal protein S10 [Porphyromonas gingivalis W83]
 gi|188995733|ref|YP_001929985.1| 30S ribosomal protein S10 [Porphyromonas gingivalis ATCC 33277]
 gi|44888373|sp|Q7MTL2|RS10_PORGI RecName: Full=30S ribosomal protein S10
 gi|226705606|sp|B2RLZ3|RS10_PORG3 RecName: Full=30S ribosomal protein S10
 gi|34397859|gb|AAQ66920.1| ribosomal protein S10 [Porphyromonas gingivalis W83]
 gi|188595413|dbj|BAG34388.1| 30S ribosomal protein S10 [Porphyromonas gingivalis ATCC 33277]
          Length = 101

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 68/98 (69%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++D S  +IV T K +G+ + GPIP P   R FTVNRS  V+KKSR+Q
Sbjct: 4   KIRIKLKSYDYMLVDKSAEKIVKTVKAAGAMVSGPIPLPTHKRIFTVNRSTFVNKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+  YKRL+ I   T +TVDALMKL++ +GV V IK+
Sbjct: 64  FELSSYKRLIDIYNSTAKTVDALMKLELPSGVEVEIKV 101


>gi|229823536|ref|ZP_04449605.1| hypothetical protein GCWU000282_00834 [Catonella morbi ATCC 51271]
 gi|229786980|gb|EEP23094.1| hypothetical protein GCWU000282_00834 [Catonella morbi ATCC 51271]
          Length = 102

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 71/100 (71%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA++ R LD +  +IV + +++G++  GPIP P     +TV R+ H  K SR
Sbjct: 3   NKKIRIRLKAYEHRALDLAASKIVESAQRTGAKTAGPIPLPTERSLYTVIRATHKYKDSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KRL+ I++PT +TVDALMKLD+ +GV+V IKL
Sbjct: 63  EQFEMRTHKRLIDILEPTNKTVDALMKLDLPSGVDVEIKL 102


>gi|189460683|ref|ZP_03009468.1| hypothetical protein BACCOP_01330 [Bacteroides coprocola DSM 17136]
 gi|224023617|ref|ZP_03641983.1| hypothetical protein BACCOPRO_00324 [Bacteroides coprophilus DSM
           18228]
 gi|189432642|gb|EDV01627.1| hypothetical protein BACCOP_01330 [Bacteroides coprocola DSM 17136]
 gi|224016839|gb|EEF74851.1| hypothetical protein BACCOPRO_00324 [Bacteroides coprophilus DSM
           18228]
          Length = 101

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 68/98 (69%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++D S  +IV T K +G+ + GPIP P   R FTVNRS  V+KKSR+Q
Sbjct: 4   KIRIKLKSYDHNLVDKSAEKIVRTVKATGAIVSGPIPLPTHKRVFTVNRSTFVNKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+  YKRL+ I   T +TVDALMKL++ +GV V IK+
Sbjct: 64  FELSSYKRLIDIYSSTAKTVDALMKLELPSGVEVEIKV 101


>gi|54022699|ref|YP_116941.1| 30S ribosomal protein S10 [Nocardia farcinica IFM 10152]
 gi|111023095|ref|YP_706067.1| 30S ribosomal protein S10 [Rhodococcus jostii RHA1]
 gi|213964839|ref|ZP_03393038.1| ribosomal protein S10 [Corynebacterium amycolatum SK46]
 gi|226305340|ref|YP_002765298.1| 30S ribosomal protein S10 [Rhodococcus erythropolis PR4]
 gi|226365594|ref|YP_002783377.1| 30S ribosomal protein S10 [Rhodococcus opacus B4]
 gi|229489574|ref|ZP_04383437.1| ribosomal protein S10 [Rhodococcus erythropolis SK121]
 gi|256380599|ref|YP_003104259.1| 30S ribosomal protein S10 [Actinosynnema mirum DSM 43827]
 gi|262203625|ref|YP_003274833.1| 30S ribosomal protein S10 [Gordonia bronchialis DSM 43247]
 gi|296141116|ref|YP_003648359.1| ribosomal protein S10 [Tsukamurella paurometabola DSM 20162]
 gi|312140919|ref|YP_004008255.1| 30S ribosomal protein s10 rpsj [Rhodococcus equi 103S]
 gi|319948724|ref|ZP_08022845.1| 30S ribosomal protein S10 [Dietzia cinnamea P4]
 gi|325000493|ref|ZP_08121605.1| 30S ribosomal protein S10 [Pseudonocardia sp. P1]
 gi|325675443|ref|ZP_08155127.1| 30S ribosomal protein S10 [Rhodococcus equi ATCC 33707]
 gi|326385100|ref|ZP_08206770.1| 30S ribosomal protein S10 [Gordonia neofelifaecis NRRL B-59395]
 gi|331699177|ref|YP_004335416.1| 30S ribosomal protein S10 [Pseudonocardia dioxanivorans CB1190]
 gi|81603037|sp|Q5Z1W4|RS10_NOCFA RecName: Full=30S ribosomal protein S10
 gi|118597200|sp|Q0S3H7|RS10_RHOSR RecName: Full=30S ribosomal protein S10
 gi|254809981|sp|C1B011|RS10_RHOOB RecName: Full=30S ribosomal protein S10
 gi|259494601|sp|C0ZW24|RS10_RHOE4 RecName: Full=30S ribosomal protein S10
 gi|54014207|dbj|BAD55577.1| putative ribosomal protein S10 [Nocardia farcinica IFM 10152]
 gi|110822625|gb|ABG97909.1| 30S ribosomal protein S10 [Rhodococcus jostii RHA1]
 gi|213952375|gb|EEB63758.1| ribosomal protein S10 [Corynebacterium amycolatum SK46]
 gi|226184455|dbj|BAH32559.1| 30S ribosomal protein S10 [Rhodococcus erythropolis PR4]
 gi|226244084|dbj|BAH54432.1| 30S ribosomal protein S10 [Rhodococcus opacus B4]
 gi|229323671|gb|EEN89429.1| ribosomal protein S10 [Rhodococcus erythropolis SK121]
 gi|255924902|gb|ACU40413.1| ribosomal protein S10 [Actinosynnema mirum DSM 43827]
 gi|262086972|gb|ACY22940.1| ribosomal protein S10 [Gordonia bronchialis DSM 43247]
 gi|296029250|gb|ADG80020.1| ribosomal protein S10 [Tsukamurella paurometabola DSM 20162]
 gi|311890258|emb|CBH49576.1| 30S ribosomal protein S10 RpsJ [Rhodococcus equi 103S]
 gi|319437626|gb|EFV92625.1| 30S ribosomal protein S10 [Dietzia cinnamea P4]
 gi|325553414|gb|EGD23092.1| 30S ribosomal protein S10 [Rhodococcus equi ATCC 33707]
 gi|326196185|gb|EGD53389.1| 30S ribosomal protein S10 [Gordonia neofelifaecis NRRL B-59395]
 gi|326953866|gb|AEA27563.1| 30S ribosomal protein S10 [Pseudonocardia dioxanivorans CB1190]
          Length = 101

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 71/103 (68%), Gaps = 2/103 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LKA+D   +D+S R+IV T  ++G+++VGP+P P     + V RSPH  
Sbjct: 1   MAGQKIRIR--LKAYDHEAIDASARKIVETVTRTGARVVGPVPLPTEKNVYCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           K SR+  EMR +KRL+ I+ PTP+TVDALM++D+ A V+V I+
Sbjct: 59  KDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNIQ 101


>gi|300782607|ref|YP_003762898.1| 30S ribosomal protein S10 [Amycolatopsis mediterranei U32]
 gi|302523992|ref|ZP_07276334.1| ribosomal protein S10 [Streptomyces sp. AA4]
 gi|299792121|gb|ADJ42496.1| small subunit ribosomal protein S10 [Amycolatopsis mediterranei
           U32]
 gi|302432887|gb|EFL04703.1| ribosomal protein S10 [Streptomyces sp. AA4]
          Length = 101

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 71/103 (68%), Gaps = 2/103 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LKA+D   +D+S R+IV T  ++G+++VGP+P P     + V RSPH  
Sbjct: 1   MAGQKIRIR--LKAYDHEAIDTSARKIVETVTRTGARVVGPVPLPTEKNVYCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           K SR+  EMR +KRL+ I+ PTP+TVDALM++D+ A V+V I+
Sbjct: 59  KDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNIQ 101


>gi|15607840|ref|NP_215214.1| 30S ribosomal protein S10 [Mycobacterium tuberculosis H37Rv]
 gi|15840107|ref|NP_335144.1| 30S ribosomal protein S10 [Mycobacterium tuberculosis CDC1551]
 gi|31791885|ref|NP_854378.1| 30S ribosomal protein S10 [Mycobacterium bovis AF2122/97]
 gi|121636622|ref|YP_976845.1| 30S ribosomal protein S10 [Mycobacterium bovis BCG str. Pasteur
           1173P2]
 gi|148660475|ref|YP_001281998.1| 30S ribosomal protein S10 [Mycobacterium tuberculosis H37Ra]
 gi|148821905|ref|YP_001286659.1| 30S ribosomal protein S10 [Mycobacterium tuberculosis F11]
 gi|167967941|ref|ZP_02550218.1| 30S ribosomal protein S10 [Mycobacterium tuberculosis H37Ra]
 gi|183981052|ref|YP_001849343.1| 30S ribosomal protein S10, RpsJ [Mycobacterium marinum M]
 gi|215402484|ref|ZP_03414665.1| 30S ribosomal protein S10 [Mycobacterium tuberculosis 02_1987]
 gi|215410255|ref|ZP_03419063.1| 30S ribosomal protein S10 [Mycobacterium tuberculosis 94_M4241A]
 gi|215425942|ref|ZP_03423861.1| 30S ribosomal protein S10 [Mycobacterium tuberculosis T92]
 gi|215429540|ref|ZP_03427459.1| 30S ribosomal protein S10 [Mycobacterium tuberculosis EAS054]
 gi|215444823|ref|ZP_03431575.1| 30S ribosomal protein S10 [Mycobacterium tuberculosis T85]
 gi|218752350|ref|ZP_03531146.1| 30S ribosomal protein S10 [Mycobacterium tuberculosis GM 1503]
 gi|219556549|ref|ZP_03535625.1| 30S ribosomal protein S10 [Mycobacterium tuberculosis T17]
 gi|224989094|ref|YP_002643781.1| 30S ribosomal protein S10 [Mycobacterium bovis BCG str. Tokyo 172]
 gi|253797643|ref|YP_003030644.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis KZN
           1435]
 gi|254231020|ref|ZP_04924347.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis C]
 gi|254363647|ref|ZP_04979693.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis str.
           Haarlem]
 gi|254549661|ref|ZP_05140108.1| 30S ribosomal protein S10 [Mycobacterium tuberculosis '98-R604
           INH-RIF-EM']
 gi|260185582|ref|ZP_05763056.1| 30S ribosomal protein S10 [Mycobacterium tuberculosis CPHL_A]
 gi|260199710|ref|ZP_05767201.1| 30S ribosomal protein S10 [Mycobacterium tuberculosis T46]
 gi|260203871|ref|ZP_05771362.1| 30S ribosomal protein S10 [Mycobacterium tuberculosis K85]
 gi|289442101|ref|ZP_06431845.1| SSU ribosomal protein S10 [Mycobacterium tuberculosis T46]
 gi|289446260|ref|ZP_06436004.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis CPHL_A]
 gi|289552957|ref|ZP_06442167.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis KZN 605]
 gi|289568644|ref|ZP_06448871.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis T17]
 gi|289573308|ref|ZP_06453535.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis K85]
 gi|289744424|ref|ZP_06503802.1| 30s ribosomal protein s10 rpsj [Mycobacterium tuberculosis 02_1987]
 gi|289749207|ref|ZP_06508585.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis T92]
 gi|289752747|ref|ZP_06512125.1| ribosomal protein S10 [Mycobacterium tuberculosis EAS054]
 gi|289756788|ref|ZP_06516166.1| 30S ribosomal protein s10 [Mycobacterium tuberculosis T85]
 gi|289760827|ref|ZP_06520205.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis GM 1503]
 gi|294996195|ref|ZP_06801886.1| 30S ribosomal protein S10 [Mycobacterium tuberculosis 210]
 gi|297633199|ref|ZP_06950979.1| 30S ribosomal protein S10 [Mycobacterium tuberculosis KZN 4207]
 gi|297730179|ref|ZP_06959297.1| 30S ribosomal protein S10 [Mycobacterium tuberculosis KZN R506]
 gi|298524191|ref|ZP_07011600.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis
           94_M4241A]
 gi|306774811|ref|ZP_07413148.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis SUMu001]
 gi|306781457|ref|ZP_07419794.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis SUMu002]
 gi|306783352|ref|ZP_07421674.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis SUMu003]
 gi|306787721|ref|ZP_07426043.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis SUMu004]
 gi|306794488|ref|ZP_07432790.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis SUMu005]
 gi|306796454|ref|ZP_07434756.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis SUMu006]
 gi|306802314|ref|ZP_07438982.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis SUMu008]
 gi|306806524|ref|ZP_07443192.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis SUMu007]
 gi|306966721|ref|ZP_07479382.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis SUMu009]
 gi|306970913|ref|ZP_07483574.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis SUMu010]
 gi|307078643|ref|ZP_07487813.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis SUMu011]
 gi|307083207|ref|ZP_07492320.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis SUMu012]
 gi|313657506|ref|ZP_07814386.1| 30S ribosomal protein S10 [Mycobacterium tuberculosis KZN V2475]
 gi|61236892|sp|P0A5X0|RS10_MYCTU RecName: Full=30S ribosomal protein S10
 gi|61236899|sp|P0A5X1|RS10_MYCBO RecName: Full=30S ribosomal protein S10
 gi|166231293|sp|A1KGI1|RS10_MYCBP RecName: Full=30S ribosomal protein S10
 gi|166231297|sp|A5U086|RS10_MYCTA RecName: Full=30S ribosomal protein S10
 gi|226705596|sp|B2HSN0|RS10_MYCMM RecName: Full=30S ribosomal protein S10
 gi|254809975|sp|C1AL34|RS10_MYCBT RecName: Full=30S ribosomal protein S10
 gi|1806168|emb|CAB06463.1| 30S RIBOSOMAL PROTEIN S10 RPSJ (TRANSCRIPTION ANTITERMINATION
           FACTOR NUSE) [Mycobacterium tuberculosis H37Rv]
 gi|2113865|emb|CAA73671.1| rpsX [Mycobacterium bovis BCG]
 gi|13880257|gb|AAK44958.1| ribosomal protein S10 [Mycobacterium tuberculosis CDC1551]
 gi|31617472|emb|CAD93582.1| 30S RIBOSOMAL PROTEIN S10 RPSJ (TRANSCRIPTION ANTITERMINATION
           FACTOR NUSE) [Mycobacterium bovis AF2122/97]
 gi|121492269|emb|CAL70736.1| 30S ribosomal protein S10 rpsJ (transcription antitermination
           factor nusE) [Mycobacterium bovis BCG str. Pasteur
           1173P2]
 gi|124600079|gb|EAY59089.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis C]
 gi|134149161|gb|EBA41206.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis str.
           Haarlem]
 gi|148504627|gb|ABQ72436.1| 30S ribosomal protein S10 [Mycobacterium tuberculosis H37Ra]
 gi|148720432|gb|ABR05057.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis F11]
 gi|183174378|gb|ACC39488.1| 30S ribosomal protein S10, RpsJ [Mycobacterium marinum M]
 gi|224772207|dbj|BAH25013.1| 30S ribosomal protein S10 [Mycobacterium bovis BCG str. Tokyo 172]
 gi|253319146|gb|ACT23749.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis KZN
           1435]
 gi|289415020|gb|EFD12260.1| SSU ribosomal protein S10 [Mycobacterium tuberculosis T46]
 gi|289419218|gb|EFD16419.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis CPHL_A]
 gi|289437589|gb|EFD20082.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis KZN 605]
 gi|289537739|gb|EFD42317.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis K85]
 gi|289542398|gb|EFD46046.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis T17]
 gi|289684952|gb|EFD52440.1| 30s ribosomal protein s10 rpsj [Mycobacterium tuberculosis 02_1987]
 gi|289689794|gb|EFD57223.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis T92]
 gi|289693334|gb|EFD60763.1| ribosomal protein S10 [Mycobacterium tuberculosis EAS054]
 gi|289708333|gb|EFD72349.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis GM 1503]
 gi|289712352|gb|EFD76364.1| 30S ribosomal protein s10 [Mycobacterium tuberculosis T85]
 gi|298493985|gb|EFI29279.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis
           94_M4241A]
 gi|308216701|gb|EFO76100.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis SUMu001]
 gi|308325757|gb|EFP14608.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis SUMu002]
 gi|308331846|gb|EFP20697.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis SUMu003]
 gi|308335633|gb|EFP24484.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis SUMu004]
 gi|308337248|gb|EFP26099.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis SUMu005]
 gi|308343114|gb|EFP31965.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis SUMu006]
 gi|308347001|gb|EFP35852.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis SUMu007]
 gi|308350980|gb|EFP39831.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis SUMu008]
 gi|308355576|gb|EFP44427.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis SUMu009]
 gi|308359534|gb|EFP48385.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis SUMu010]
 gi|308363439|gb|EFP52290.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis SUMu011]
 gi|308367077|gb|EFP55928.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis SUMu012]
 gi|323720924|gb|EGB29990.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis
           CDC1551A]
 gi|326905078|gb|EGE52011.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis W-148]
 gi|328457424|gb|AEB02847.1| 30S ribosomal protein S10 rpsJ [Mycobacterium tuberculosis KZN
           4207]
          Length = 101

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 50/103 (48%), Positives = 70/103 (67%), Gaps = 2/103 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LKA+D   +D+S R+IV T  ++G+ +VGP+P P     + V RSPH  
Sbjct: 1   MAGQKIRIR--LKAYDHEAIDASARKIVETVVRTGASVVGPVPLPTEKNVYCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           K SR+  EMR +KRL+ II PTP+TVDALM++D+ A V+V I+
Sbjct: 59  KDSREHFEMRTHKRLIDIIDPTPKTVDALMRIDLPASVDVNIQ 101


>gi|325299133|ref|YP_004259050.1| 30S ribosomal protein S10 [Bacteroides salanitronis DSM 18170]
 gi|324318686|gb|ADY36577.1| 30S ribosomal protein S10 [Bacteroides salanitronis DSM 18170]
          Length = 101

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 68/98 (69%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++D S  +IV T K +G+ + GPIP P   R FTVNRS  V+KKSR+Q
Sbjct: 4   KIRIKLKSYDHNLVDKSAEKIVKTVKATGAIVSGPIPLPTHKRIFTVNRSTFVNKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+  YKRL+ I   T +TVDALMKL++ +GV V IK+
Sbjct: 64  FELSSYKRLIDIYSSTAKTVDALMKLELPSGVEVEIKV 101


>gi|319952197|ref|YP_004163464.1| ssu ribosomal protein s10p [Cellulophaga algicola DSM 14237]
 gi|319420857|gb|ADV47966.1| SSU ribosomal protein S10P [Cellulophaga algicola DSM 14237]
          Length = 101

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 69/98 (70%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++D S  +IV T K +G+ + GPIP P   + FTV RSPHV+KKSR+Q
Sbjct: 4   KIRIKLKSYDYNLVDKSAEKIVKTVKSTGAVVTGPIPLPTHKKIFTVLRSPHVNKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            ++  YKRLL I   + +T+DALMKL++ +GV V IK+
Sbjct: 64  FQLSSYKRLLDIYSSSSKTIDALMKLELPSGVEVEIKV 101


>gi|302876535|ref|YP_003845168.1| 30S ribosomal protein S10 [Clostridium cellulovorans 743B]
 gi|307687208|ref|ZP_07629654.1| 30S ribosomal protein S10 [Clostridium cellulovorans 743B]
 gi|302579392|gb|ADL53404.1| ribosomal protein S10 [Clostridium cellulovorans 743B]
          Length = 104

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 68/98 (69%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD  +LD S   IV T K +G+++ GP+P P      T+ R+ H  K SR+Q
Sbjct: 5   KIRIRLKAFDHTLLDQSAERIVETAKSTGAKVAGPVPLPTEKDVVTILRAVHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R +KRL+ I+ P+P+TVDALM+LD+ AGV++ IKL
Sbjct: 65  FEIRTHKRLVDILSPSPKTVDALMRLDLPAGVDIEIKL 102


>gi|320538166|ref|ZP_08038061.1| ribosomal protein S10 [Treponema phagedenis F0421]
 gi|320144983|gb|EFW36704.1| ribosomal protein S10 [Treponema phagedenis F0421]
          Length = 102

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 70/97 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I + L+ FD  ++D S + IV   +K+G+++ GPIP P  + +FTV RSPHV+KKSR+Q
Sbjct: 5   KIRVRLRGFDVDLVDQSSKAIVQAVQKAGAKVSGPIPLPTRVNKFTVLRSPHVNKKSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            EM  +KRL+ II PT   ++AL+ L+++AGV+V IK
Sbjct: 65  FEMITHKRLIDIIDPTQDVMNALVGLELSAGVDVEIK 101


>gi|108797985|ref|YP_638182.1| 30S ribosomal protein S10 [Mycobacterium sp. MCS]
 gi|118473457|ref|YP_885818.1| 30S ribosomal protein S10 [Mycobacterium smegmatis str. MC2 155]
 gi|119867081|ref|YP_937033.1| 30S ribosomal protein S10 [Mycobacterium sp. KMS]
 gi|120402315|ref|YP_952144.1| 30S ribosomal protein S10 [Mycobacterium vanbaalenii PYR-1]
 gi|126433647|ref|YP_001069338.1| 30S ribosomal protein S10 [Mycobacterium sp. JLS]
 gi|145225626|ref|YP_001136304.1| 30S ribosomal protein S10 [Mycobacterium gilvum PYR-GCK]
 gi|169630901|ref|YP_001704550.1| 30S ribosomal protein S10 [Mycobacterium abscessus ATCC 19977]
 gi|257054469|ref|YP_003132301.1| 30S ribosomal protein S10 [Saccharomonospora viridis DSM 43017]
 gi|315445979|ref|YP_004078858.1| 30S ribosomal protein S10P [Mycobacterium sp. Spyr1]
 gi|123369678|sp|Q1BDA8|RS10_MYCSS RecName: Full=30S ribosomal protein S10
 gi|166231294|sp|A0QSD0|RS10_MYCS2 RecName: Full=30S ribosomal protein S10
 gi|166231295|sp|A3PVC0|RS10_MYCSJ RecName: Full=30S ribosomal protein S10
 gi|166231296|sp|A1UBN5|RS10_MYCSK RecName: Full=30S ribosomal protein S10
 gi|166231299|sp|A1T4N8|RS10_MYCVP RecName: Full=30S ribosomal protein S10
 gi|189040379|sp|A4T1U3|RS10_MYCGI RecName: Full=30S ribosomal protein S10
 gi|226705595|sp|B1MGF1|RS10_MYCA9 RecName: Full=30S ribosomal protein S10
 gi|108768404|gb|ABG07126.1| SSU ribosomal protein S10P [Mycobacterium sp. MCS]
 gi|118174744|gb|ABK75640.1| ribosomal protein S10 [Mycobacterium smegmatis str. MC2 155]
 gi|119693170|gb|ABL90243.1| SSU ribosomal protein S10P [Mycobacterium sp. KMS]
 gi|119955133|gb|ABM12138.1| SSU ribosomal protein S10P [Mycobacterium vanbaalenii PYR-1]
 gi|126233447|gb|ABN96847.1| SSU ribosomal protein S10P [Mycobacterium sp. JLS]
 gi|145218112|gb|ABP47516.1| SSU ribosomal protein S10P [Mycobacterium gilvum PYR-GCK]
 gi|169242868|emb|CAM63896.1| 30S ribosomal protein S10 [Mycobacterium abscessus]
 gi|256584341|gb|ACU95474.1| SSU ribosomal protein S10P [Saccharomonospora viridis DSM 43017]
 gi|315264282|gb|ADU01024.1| SSU ribosomal protein S10P [Mycobacterium sp. Spyr1]
          Length = 101

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 70/103 (67%), Gaps = 2/103 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LKA+D   +D+S R+IV T  ++G+ +VGP+P P     + V RSPH  
Sbjct: 1   MAGQKIRIR--LKAYDHEAIDASARKIVETVTRTGASVVGPVPLPTEKNVYCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           K SR+  EMR +KRL+ I+ PTP+TVDALM++D+ A V+V I+
Sbjct: 59  KDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNIQ 101


>gi|38233084|ref|NP_938851.1| 30S ribosomal protein S10 [Corynebacterium diphtheriae NCTC 13129]
 gi|227502653|ref|ZP_03932702.1| 30S ribosomal protein S10 [Corynebacterium accolens ATCC 49725]
 gi|227549825|ref|ZP_03979874.1| 30S ribosomal protein S10 [Corynebacterium lipophiloflavum DSM
           44291]
 gi|227832218|ref|YP_002833925.1| 30S ribosomal protein S10 [Corynebacterium aurimucosum ATCC 700975]
 gi|255324735|ref|ZP_05365849.1| ribosomal protein S10 [Corynebacterium tuberculostearicum SK141]
 gi|262183927|ref|ZP_06043348.1| 30S ribosomal protein S10 [Corynebacterium aurimucosum ATCC 700975]
 gi|296119208|ref|ZP_06837778.1| ribosomal protein S10 [Corynebacterium ammoniagenes DSM 20306]
 gi|311740078|ref|ZP_07713912.1| 30S ribosomal protein S10 [Corynebacterium pseudogenitalium ATCC
           33035]
 gi|54036370|sp|Q6NJD3|RS10_CORDI RecName: Full=30S ribosomal protein S10
 gi|254809594|sp|C3PKQ1|RS10_CORA7 RecName: Full=30S ribosomal protein S10
 gi|38199343|emb|CAE48976.1| 30S ribosomal protein S10 [Corynebacterium diphtheriae]
 gi|227076383|gb|EEI14346.1| 30S ribosomal protein S10 [Corynebacterium accolens ATCC 49725]
 gi|227078080|gb|EEI16043.1| 30S ribosomal protein S10 [Corynebacterium lipophiloflavum DSM
           44291]
 gi|227453234|gb|ACP31987.1| 30S ribosomal protein S10 [Corynebacterium aurimucosum ATCC 700975]
 gi|255298210|gb|EET77513.1| ribosomal protein S10 [Corynebacterium tuberculostearicum SK141]
 gi|295967834|gb|EFG81089.1| ribosomal protein S10 [Corynebacterium ammoniagenes DSM 20306]
 gi|311305151|gb|EFQ81220.1| 30S ribosomal protein S10 [Corynebacterium pseudogenitalium ATCC
           33035]
          Length = 101

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 69/97 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D   +D+S ++IV T  ++G+++VGP+P P     + V RSPH  K SR+ 
Sbjct: 5   KIRIRLKAYDHEAIDASAKKIVETVTRTGARVVGPVPLPTEKNVYAVIRSPHKYKDSREH 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            EMR +KRL+ I+ PTP+TVDALM++D+ A V+V I+
Sbjct: 65  FEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNIQ 101


>gi|154494379|ref|ZP_02033699.1| hypothetical protein PARMER_03734 [Parabacteroides merdae ATCC
           43184]
 gi|218262298|ref|ZP_03476812.1| hypothetical protein PRABACTJOHN_02486 [Parabacteroides johnsonii
           DSM 18315]
 gi|154085823|gb|EDN84868.1| hypothetical protein PARMER_03734 [Parabacteroides merdae ATCC
           43184]
 gi|218223449|gb|EEC96099.1| hypothetical protein PRABACTJOHN_02486 [Parabacteroides johnsonii
           DSM 18315]
          Length = 101

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 68/98 (69%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++D S  +IV T K +G+ + GPIP P   R FTVNRS  V+KKSR+Q
Sbjct: 4   KIRIKLKSYDYSLVDKSAEKIVKTVKATGAVVSGPIPLPTHKRIFTVNRSTFVNKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+  YKRL+ I   T +TVDALMKL++ +GV V IK+
Sbjct: 64  FELSSYKRLIDIYSSTAKTVDALMKLELPSGVEVEIKV 101


>gi|29348137|ref|NP_811640.1| 30S ribosomal protein S10 [Bacteroides thetaiotaomicron VPI-5482]
 gi|150003388|ref|YP_001298132.1| 30S ribosomal protein S10 [Bacteroides vulgatus ATCC 8482]
 gi|153805956|ref|ZP_01958624.1| hypothetical protein BACCAC_00201 [Bacteroides caccae ATCC 43185]
 gi|189465417|ref|ZP_03014202.1| hypothetical protein BACINT_01770 [Bacteroides intestinalis DSM
           17393]
 gi|198274004|ref|ZP_03206536.1| hypothetical protein BACPLE_00140 [Bacteroides plebeius DSM 17135]
 gi|212695306|ref|ZP_03303434.1| hypothetical protein BACDOR_04846 [Bacteroides dorei DSM 17855]
 gi|224537816|ref|ZP_03678355.1| hypothetical protein BACCELL_02703 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|237711672|ref|ZP_04542153.1| 30S ribosomal protein S10 [Bacteroides sp. 9_1_42FAA]
 gi|237717398|ref|ZP_04547879.1| 30S ribosomal protein S10 [Bacteroides sp. D1]
 gi|237718744|ref|ZP_04549225.1| 30S ribosomal protein S10 [Bacteroides sp. 2_2_4]
 gi|237725886|ref|ZP_04556367.1| 30S ribosomal protein S10 [Bacteroides sp. D4]
 gi|253569589|ref|ZP_04846999.1| 30S ribosomal protein S10 [Bacteroides sp. 1_1_6]
 gi|254881321|ref|ZP_05254031.1| 30S ribosomal protein S10 [Bacteroides sp. 4_3_47FAA]
 gi|260175415|ref|ZP_05761827.1| 30S ribosomal protein S10 [Bacteroides sp. D2]
 gi|262406163|ref|ZP_06082713.1| ribosomal protein S10 [Bacteroides sp. 2_1_22]
 gi|265753092|ref|ZP_06088661.1| 30S ribosomal protein S10 [Bacteroides sp. 3_1_33FAA]
 gi|294644058|ref|ZP_06721835.1| ribosomal protein S10 [Bacteroides ovatus SD CC 2a]
 gi|294807314|ref|ZP_06766127.1| ribosomal protein S10 [Bacteroides xylanisolvens SD CC 1b]
 gi|298386180|ref|ZP_06995737.1| ribosomal protein S10 [Bacteroides sp. 1_1_14]
 gi|298483063|ref|ZP_07001244.1| ribosomal protein S10 [Bacteroides sp. D22]
 gi|299144625|ref|ZP_07037693.1| ribosomal protein S10 [Bacteroides sp. 3_1_23]
 gi|319640323|ref|ZP_07995048.1| 30S ribosomal protein S10 [Bacteroides sp. 3_1_40A]
 gi|44888483|sp|Q8A475|RS10_BACTN RecName: Full=30S ribosomal protein S10
 gi|166231241|sp|A6KYJ6|RS10_BACV8 RecName: Full=30S ribosomal protein S10
 gi|29340040|gb|AAO77834.1| 30S ribosomal protein S10 [Bacteroides thetaiotaomicron VPI-5482]
 gi|149130633|gb|EDM21839.1| hypothetical protein BACCAC_00201 [Bacteroides caccae ATCC 43185]
 gi|149931812|gb|ABR38510.1| 30S ribosomal protein S10 [Bacteroides vulgatus ATCC 8482]
 gi|189437691|gb|EDV06676.1| hypothetical protein BACINT_01770 [Bacteroides intestinalis DSM
           17393]
 gi|198273082|gb|EDY97351.1| hypothetical protein BACPLE_00140 [Bacteroides plebeius DSM 17135]
 gi|212662216|gb|EEB22790.1| hypothetical protein BACDOR_04846 [Bacteroides dorei DSM 17855]
 gi|224520502|gb|EEF89607.1| hypothetical protein BACCELL_02703 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|229435694|gb|EEO45771.1| 30S ribosomal protein S10 [Bacteroides dorei 5_1_36/D4]
 gi|229443381|gb|EEO49172.1| 30S ribosomal protein S10 [Bacteroides sp. D1]
 gi|229451876|gb|EEO57667.1| 30S ribosomal protein S10 [Bacteroides sp. 2_2_4]
 gi|229454367|gb|EEO60088.1| 30S ribosomal protein S10 [Bacteroides sp. 9_1_42FAA]
 gi|251841608|gb|EES69689.1| 30S ribosomal protein S10 [Bacteroides sp. 1_1_6]
 gi|254834114|gb|EET14423.1| 30S ribosomal protein S10 [Bacteroides sp. 4_3_47FAA]
 gi|262357038|gb|EEZ06128.1| ribosomal protein S10 [Bacteroides sp. 2_1_22]
 gi|263236278|gb|EEZ21773.1| 30S ribosomal protein S10 [Bacteroides sp. 3_1_33FAA]
 gi|292640582|gb|EFF58823.1| ribosomal protein S10 [Bacteroides ovatus SD CC 2a]
 gi|294445479|gb|EFG14133.1| ribosomal protein S10 [Bacteroides xylanisolvens SD CC 1b]
 gi|298261408|gb|EFI04275.1| ribosomal protein S10 [Bacteroides sp. 1_1_14]
 gi|298270807|gb|EFI12387.1| ribosomal protein S10 [Bacteroides sp. D22]
 gi|298515116|gb|EFI38997.1| ribosomal protein S10 [Bacteroides sp. 3_1_23]
 gi|317388098|gb|EFV68952.1| 30S ribosomal protein S10 [Bacteroides sp. 3_1_40A]
          Length = 101

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 68/98 (69%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++D S  +IV T K +G+ + GPIP P   R FTVNRS  V+KKSR+Q
Sbjct: 4   KIRIKLKSYDHNLVDKSAEKIVRTVKATGAIVSGPIPLPTHKRIFTVNRSTFVNKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+  YKRL+ I   T +TVDALMKL++ +GV V IK+
Sbjct: 64  FELSSYKRLIDIYSSTAKTVDALMKLELPSGVEVEIKV 101


>gi|88854683|ref|ZP_01129349.1| 30S ribosomal protein S10 [marine actinobacterium PHSC20C1]
 gi|88815844|gb|EAR25700.1| 30S ribosomal protein S10 [marine actinobacterium PHSC20C1]
          Length = 102

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 67/98 (68%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++DSS R+IV T  ++G+ +VGP+P P       V RSPH  K SR+ 
Sbjct: 5   KIRIRLKSYDHEVIDSSARKIVDTVTRAGATVVGPVPLPTEKNVIAVIRSPHKYKDSREH 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R +KRL+ II PTP+ VD+LM+LD+ A VN+ IKL
Sbjct: 65  FEKRTHKRLIDIIDPTPKAVDSLMRLDLPADVNIEIKL 102


>gi|160888400|ref|ZP_02069403.1| hypothetical protein BACUNI_00813 [Bacteroides uniformis ATCC 8492]
 gi|167764373|ref|ZP_02436498.1| hypothetical protein BACSTE_02757 [Bacteroides stercoris ATCC
           43183]
 gi|218131328|ref|ZP_03460132.1| hypothetical protein BACEGG_02939 [Bacteroides eggerthii DSM 20697]
 gi|270294753|ref|ZP_06200954.1| 30S ribosomal protein S10 [Bacteroides sp. D20]
 gi|317476357|ref|ZP_07935606.1| ribosomal protein S10 [Bacteroides eggerthii 1_2_48FAA]
 gi|317477752|ref|ZP_07936945.1| ribosomal protein S10 [Bacteroides sp. 4_1_36]
 gi|319900923|ref|YP_004160651.1| SSU ribosomal protein S10P [Bacteroides helcogenes P 36-108]
 gi|329956702|ref|ZP_08297275.1| ribosomal protein S10 [Bacteroides clarus YIT 12056]
 gi|329962266|ref|ZP_08300272.1| ribosomal protein S10 [Bacteroides fluxus YIT 12057]
 gi|156862077|gb|EDO55508.1| hypothetical protein BACUNI_00813 [Bacteroides uniformis ATCC 8492]
 gi|167697778|gb|EDS14357.1| hypothetical protein BACSTE_02757 [Bacteroides stercoris ATCC
           43183]
 gi|217986260|gb|EEC52597.1| hypothetical protein BACEGG_02939 [Bacteroides eggerthii DSM 20697]
 gi|270274000|gb|EFA19861.1| 30S ribosomal protein S10 [Bacteroides sp. D20]
 gi|316906097|gb|EFV27858.1| ribosomal protein S10 [Bacteroides sp. 4_1_36]
 gi|316907383|gb|EFV29088.1| ribosomal protein S10 [Bacteroides eggerthii 1_2_48FAA]
 gi|319415954|gb|ADV43065.1| SSU ribosomal protein S10P [Bacteroides helcogenes P 36-108]
 gi|328524074|gb|EGF51150.1| ribosomal protein S10 [Bacteroides clarus YIT 12056]
 gi|328530374|gb|EGF57251.1| ribosomal protein S10 [Bacteroides fluxus YIT 12057]
          Length = 101

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 68/98 (69%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++D S  +IV T K +G+ + GPIP P   R FTVNRS  V+KKSR+Q
Sbjct: 4   KIRIKLKSYDHNLVDKSAEKIVRTVKTTGAIVSGPIPLPTHKRIFTVNRSTFVNKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+  YKRL+ I   T +TVDALMKL++ +GV V IK+
Sbjct: 64  FELSSYKRLIDIYSSTAKTVDALMKLELPSGVEVEIKV 101


>gi|319789237|ref|YP_004150870.1| ribosomal protein S10 [Thermovibrio ammonificans HB-1]
 gi|317113739|gb|ADU96229.1| ribosomal protein S10 [Thermovibrio ammonificans HB-1]
          Length = 103

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 69/98 (70%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I L A+D R+LD S++EI+ T K++G+ + GPIP P     ++V RSPH  K S++Q
Sbjct: 5   RIRIKLTAYDHRLLDRSVQEIIDTVKRTGAIVAGPIPLPTKRSWWSVIRSPHKYKYSQEQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R ++RLL I  P PQTV+ALM L + AGV+V IKL
Sbjct: 65  FEIRKHRRLLDIKNPKPQTVEALMDLKLPAGVDVEIKL 102


>gi|23336500|ref|ZP_00121714.1| COG0051: Ribosomal protein S10 [Bifidobacterium longum DJO10A]
 gi|23466129|ref|NP_696732.1| 30S ribosomal protein S10 [Bifidobacterium longum NCC2705]
 gi|189440568|ref|YP_001955649.1| 30S ribosomal protein S10 [Bifidobacterium longum DJO10A]
 gi|227546475|ref|ZP_03976524.1| ribosomal protein S10 [Bifidobacterium longum subsp. infantis ATCC
           55813]
 gi|229818241|ref|ZP_04448523.1| hypothetical protein BIFANG_03539 [Bifidobacterium angulatum DSM
           20098]
 gi|239621009|ref|ZP_04664040.1| 30S ribosomal protein S10 [Bifidobacterium longum subsp. infantis
           CCUG 52486]
 gi|291457201|ref|ZP_06596591.1| ribosomal protein S10 [Bifidobacterium breve DSM 20213]
 gi|296454871|ref|YP_003662015.1| 30S ribosomal protein S10 [Bifidobacterium longum subsp. longum
           JDM301]
 gi|312133873|ref|YP_004001212.1| rpsj [Bifidobacterium longum subsp. longum BBMN68]
 gi|317483451|ref|ZP_07942441.1| ribosomal protein S10 [Bifidobacterium sp. 12_1_47BFAA]
 gi|322689930|ref|YP_004209664.1| 30S ribosomal protein S10 [Bifidobacterium longum subsp. infantis
           157F]
 gi|322691871|ref|YP_004221441.1| 30S ribosomal protein S10 [Bifidobacterium longum subsp. longum JCM
           1217]
 gi|44888504|sp|Q8G418|RS10_BIFLO RecName: Full=30S ribosomal protein S10
 gi|226705402|sp|B3DQ12|RS10_BIFLD RecName: Full=30S ribosomal protein S10
 gi|23326865|gb|AAN25368.1| 30S ribosomal protein S10 [Bifidobacterium longum NCC2705]
 gi|189429003|gb|ACD99151.1| Ribosomal protein S10 [Bifidobacterium longum DJO10A]
 gi|227213024|gb|EEI80903.1| ribosomal protein S10 [Bifidobacterium longum subsp. infantis ATCC
           55813]
 gi|229784492|gb|EEP20606.1| hypothetical protein BIFANG_03539 [Bifidobacterium angulatum DSM
           20098]
 gi|239516110|gb|EEQ55977.1| 30S ribosomal protein S10 [Bifidobacterium longum subsp. infantis
           CCUG 52486]
 gi|291381036|gb|EFE88554.1| ribosomal protein S10 [Bifidobacterium breve DSM 20213]
 gi|291516470|emb|CBK70086.1| SSU ribosomal protein S10P [Bifidobacterium longum subsp. longum
           F8]
 gi|296184303|gb|ADH01185.1| ribosomal protein S10 [Bifidobacterium longum subsp. longum JDM301]
 gi|311773166|gb|ADQ02654.1| RpsJ [Bifidobacterium longum subsp. longum BBMN68]
 gi|316915137|gb|EFV36569.1| ribosomal protein S10 [Bifidobacterium sp. 12_1_47BFAA]
 gi|320456727|dbj|BAJ67349.1| 30S ribosomal protein S10 [Bifidobacterium longum subsp. longum JCM
           1217]
 gi|320461266|dbj|BAJ71886.1| 30S ribosomal protein S10 [Bifidobacterium longum subsp. infantis
           157F]
          Length = 102

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 68/104 (65%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LK++D  ++D S ++IV T   +G+ +VGP+P P     F V RSPH  
Sbjct: 1   MAGQKIRIR--LKSYDHEVIDQSAKKIVETVTNAGATVVGPVPLPTEKNVFCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+  EMR +KRL+ I+ PTP+ VD+LM +D+ A VN+ IKL
Sbjct: 59  KDSREHFEMRTHKRLIDIVDPTPKAVDSLMHIDLPADVNIEIKL 102


>gi|323357373|ref|YP_004223769.1| ribosomal protein S10 [Microbacterium testaceum StLB037]
 gi|323273744|dbj|BAJ73889.1| ribosomal protein S10 [Microbacterium testaceum StLB037]
          Length = 102

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 69/104 (66%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LK++D   LDSS R+IV T  ++G+ +VGP+P P       V RSPH  
Sbjct: 1   MAGQKIRIR--LKSYDHAGLDSSARKIVDTVTRAGATVVGPVPLPTEKNVVCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+  EMR +KRL+ II PTP+ VD+LM+LD+ A VN+ IKL
Sbjct: 59  KDSREHFEMRTHKRLIDIIDPTPKAVDSLMRLDLPADVNIEIKL 102


>gi|163786191|ref|ZP_02180639.1| 30S ribosomal protein S10 [Flavobacteriales bacterium ALC-1]
 gi|159878051|gb|EDP72107.1| 30S ribosomal protein S10 [Flavobacteriales bacterium ALC-1]
 gi|332042721|gb|EGI78921.1| ribosomal protein S10 [Lacinutrix algicola 5H-3-7-4]
          Length = 101

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 69/98 (70%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++D S  +IV T K +G+ + GPIP P   + FTV RSPHV+KKSR+Q
Sbjct: 4   KIRIKLKSYDHNLVDKSADKIVKTVKSTGAVVTGPIPLPTHKKIFTVLRSPHVNKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            ++  YKRLL I   + +T+DALMKL++ +GV V IK+
Sbjct: 64  FQLSSYKRLLDIYSSSSKTIDALMKLELPSGVEVEIKV 101


>gi|186684016|ref|YP_001867212.1| 30S ribosomal protein S10 [Nostoc punctiforme PCC 73102]
 gi|226705600|sp|B2J5B2|RS10_NOSP7 RecName: Full=30S ribosomal protein S10
 gi|186466468|gb|ACC82269.1| ribosomal protein S10 [Nostoc punctiforme PCC 73102]
          Length = 105

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 46/98 (46%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I L+AFD R+LD+S  +IV T  ++ +  +GPIP P   R + V RSPHVDK SR+ 
Sbjct: 8   KIRIRLQAFDRRLLDTSCEKIVDTANRTNATAIGPIPLPTKRRIYCVLRSPHVDKDSREH 67

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R ++R++ I +P+ +T+DALMKLD+ +GV++ +KL
Sbjct: 68  FETRTHRRIIDIYQPSSKTIDALMKLDLPSGVDIEVKL 105


>gi|227509930|ref|ZP_03939979.1| 30S ribosomal protein S10 [Lactobacillus brevis subsp. gravesensis
           ATCC 27305]
 gi|227512863|ref|ZP_03942912.1| 30S ribosomal protein S10 [Lactobacillus buchneri ATCC 11577]
 gi|227522991|ref|ZP_03953040.1| 30S ribosomal protein S10 [Lactobacillus hilgardii ATCC 8290]
 gi|227083863|gb|EEI19175.1| 30S ribosomal protein S10 [Lactobacillus buchneri ATCC 11577]
 gi|227089809|gb|EEI25121.1| 30S ribosomal protein S10 [Lactobacillus hilgardii ATCC 8290]
 gi|227190536|gb|EEI70603.1| 30S ribosomal protein S10 [Lactobacillus brevis subsp. gravesensis
           ATCC 27305]
          Length = 127

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA++ RILD S  +IV T +++G+ I GPIP P     +TV  SPH  K +R+Q
Sbjct: 30  KIRIRLKAYEHRILDQSADKIVATAQRTGATISGPIPLPTERTIYTVLASPHKFKDAREQ 89

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+  +KRL+ I+ PTP+TVD+LMKLD+ +GV++ IKL
Sbjct: 90  FEILTHKRLIDILNPTPKTVDSLMKLDLPSGVDIEIKL 127


>gi|225010516|ref|ZP_03700987.1| ribosomal protein S10 [Flavobacteria bacterium MS024-3C]
 gi|225005345|gb|EEG43296.1| ribosomal protein S10 [Flavobacteria bacterium MS024-3C]
          Length = 101

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 69/98 (70%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++D S  +IV T K +G+ + GPIP P   + FTV RSPHV+KKSR+Q
Sbjct: 4   KIRIKLKSYDFNLVDKSAEKIVKTVKSTGAVVTGPIPLPTHKKIFTVLRSPHVNKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            ++  YKRLL I   + +T+DALMKL++ +GV V IK+
Sbjct: 64  FQLSSYKRLLDIYSSSSKTIDALMKLELPSGVEVEIKV 101


>gi|229496194|ref|ZP_04389914.1| ribosomal protein S10 [Porphyromonas endodontalis ATCC 35406]
 gi|229316772|gb|EEN82685.1| ribosomal protein S10 [Porphyromonas endodontalis ATCC 35406]
          Length = 101

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 67/98 (68%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  +LD S  +IV   K +G+ + GPIP P   R FTVNRS  V+KKSR+Q
Sbjct: 4   KIRIKLKSYDHMLLDKSAEKIVKAVKATGAMVCGPIPLPTHKRIFTVNRSTFVNKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+  YKRL+ I   + QTVDAL KL++++GV + +KL
Sbjct: 64  FELSSYKRLIDIYNASKQTVDALTKLEVSSGVEINVKL 101


>gi|306835218|ref|ZP_07468252.1| 30S ribosomal protein S10 [Corynebacterium accolens ATCC 49726]
 gi|304568898|gb|EFM44429.1| 30S ribosomal protein S10 [Corynebacterium accolens ATCC 49726]
          Length = 101

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 69/97 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D   +D+S ++IV T  ++G+++VGP+P P     + V RSPH  K SR+ 
Sbjct: 5   KIRIRLKAYDHEAIDASAKKIVETVTRTGARVVGPVPLPTEKNVYVVIRSPHKYKDSREH 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            EMR +KRL+ I+ PTP+TVDALM++D+ A V+V I+
Sbjct: 65  FEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNIQ 101


>gi|227485526|ref|ZP_03915842.1| ribosomal protein S10 [Anaerococcus lactolyticus ATCC 51172]
 gi|227236525|gb|EEI86540.1| ribosomal protein S10 [Anaerococcus lactolyticus ATCC 51172]
          Length = 103

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 47/98 (47%), Positives = 68/98 (69%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I L+A+D  ++DSS  +IV   K+SG+++ GPIP P  I R T+ R+ H  K SR+Q
Sbjct: 6   KIRIRLRAYDHEVIDSSAEKIVEAVKRSGAEVSGPIPLPTEIERITILRAVHKYKDSREQ 65

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R +KRL+ II P  +T+DAL KL++ AGV++ IKL
Sbjct: 66  FEQRTHKRLIDIIGPNAKTLDALKKLNLPAGVDIEIKL 103


>gi|160883065|ref|ZP_02064068.1| hypothetical protein BACOVA_01028 [Bacteroides ovatus ATCC 8483]
 gi|293372120|ref|ZP_06618511.1| ribosomal protein S10 [Bacteroides ovatus SD CMC 3f]
 gi|315923645|ref|ZP_07919885.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|156111537|gb|EDO13282.1| hypothetical protein BACOVA_01028 [Bacteroides ovatus ATCC 8483]
 gi|292632912|gb|EFF51499.1| ribosomal protein S10 [Bacteroides ovatus SD CMC 3f]
 gi|295085429|emb|CBK66952.1| SSU ribosomal protein S10P [Bacteroides xylanisolvens XB1A]
 gi|313697520|gb|EFS34355.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 119

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 68/98 (69%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++D S  +IV T K +G+ + GPIP P   R FTVNRS  V+KKSR+Q
Sbjct: 22  KIRIKLKSYDHNLVDKSAEKIVRTVKATGAIVSGPIPLPTHKRIFTVNRSTFVNKKSREQ 81

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+  YKRL+ I   T +TVDALMKL++ +GV V IK+
Sbjct: 82  FELSSYKRLIDIYSSTAKTVDALMKLELPSGVEVEIKV 119


>gi|15828003|ref|NP_302266.1| 30S ribosomal protein S10 [Mycobacterium leprae TN]
 gi|221230480|ref|YP_002503896.1| 30S ribosomal protein S10 [Mycobacterium leprae Br4923]
 gi|401038|sp|P30765|RS10_MYCLE RecName: Full=30S ribosomal protein S10
 gi|254809976|sp|B8ZSC0|RS10_MYCLB RecName: Full=30S ribosomal protein S10
 gi|581340|emb|CAA78676.1| ribosomal protein S10 [Mycobacterium leprae]
 gi|13093556|emb|CAC30818.1| 30S ribosomal protein S10 [Mycobacterium leprae]
 gi|219933587|emb|CAR71960.1| 30S ribosomal protein S10 [Mycobacterium leprae Br4923]
          Length = 101

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 70/103 (67%), Gaps = 2/103 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LKA+D   +D+S R+IV T  ++G+ +VGP+P P     + V RSPH  
Sbjct: 1   MAGQKIRIR--LKAYDHEAIDASARKIVETVVRTGANVVGPVPLPTEKNVYCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           K SR+  EMR +KRL+ I+ PTP+TVDALM++D+ A V+V I+
Sbjct: 59  KDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNIQ 101


>gi|89891149|ref|ZP_01202657.1| 30S ribosomal protein S10 (rps10, rpsJ) [Flavobacteria bacterium
           BBFL7]
 gi|89516793|gb|EAS19452.1| 30S ribosomal protein S10 (rps10, rpsJ) [Flavobacteria bacterium
           BBFL7]
          Length = 101

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 69/98 (70%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++D S  +IV T K +G+ + GPIP P   + FTV RSPHV+KKSR+Q
Sbjct: 4   KIRIKLKSYDYMLVDKSAEKIVKTVKSTGAVVTGPIPLPTHKKIFTVLRSPHVNKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            ++  YKRLL I   + +T+DALMKL++ +GV V IK+
Sbjct: 64  FQLSSYKRLLDIYSSSSKTIDALMKLELPSGVEVEIKV 101


>gi|300774999|ref|ZP_07084862.1| 30S ribosomal protein S10 [Chryseobacterium gleum ATCC 35910]
 gi|300506814|gb|EFK37949.1| 30S ribosomal protein S10 [Chryseobacterium gleum ATCC 35910]
          Length = 101

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I LK++D  ++D S  +IV T K +G+ + GPIP P + R FTV RSPHV+KK+R+Q
Sbjct: 4   RIRIKLKSYDYNLVDKSAEKIVKTVKATGAVVNGPIPLPTNKRIFTVLRSPHVNKKAREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            ++  +KRL+ I   + +TVDALMKL++ +GV+V IK+
Sbjct: 64  FQLSAHKRLMDIYSSSSKTVDALMKLELPSGVDVEIKV 101


>gi|150008985|ref|YP_001303728.1| 30S ribosomal protein S10 [Parabacteroides distasonis ATCC 8503]
 gi|255014816|ref|ZP_05286942.1| 30S ribosomal protein S10 [Bacteroides sp. 2_1_7]
 gi|256841014|ref|ZP_05546521.1| ribosomal protein S10 [Parabacteroides sp. D13]
 gi|262383875|ref|ZP_06077011.1| 30S ribosomal protein S10 [Bacteroides sp. 2_1_33B]
 gi|298375782|ref|ZP_06985738.1| ribosomal protein S10 [Bacteroides sp. 3_1_19]
 gi|301312034|ref|ZP_07217956.1| ribosomal protein S10 [Bacteroides sp. 20_3]
 gi|166231304|sp|A6LEJ2|RS10_PARD8 RecName: Full=30S ribosomal protein S10
 gi|149937409|gb|ABR44106.1| 30S ribosomal protein S10 [Parabacteroides distasonis ATCC 8503]
 gi|256736857|gb|EEU50184.1| ribosomal protein S10 [Parabacteroides sp. D13]
 gi|262294773|gb|EEY82705.1| 30S ribosomal protein S10 [Bacteroides sp. 2_1_33B]
 gi|298266819|gb|EFI08476.1| ribosomal protein S10 [Bacteroides sp. 3_1_19]
 gi|300830136|gb|EFK60784.1| ribosomal protein S10 [Bacteroides sp. 20_3]
          Length = 101

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 68/98 (69%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++D S  +IV T K +G+ + GPIP P   R FTVNRS  V+KKSR+Q
Sbjct: 4   KIRIKLKSYDYSLVDKSAEKIVKTVKATGAIVSGPIPLPTHKRIFTVNRSTFVNKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+  YKRL+ I   T +TVDALMKL++ +GV V IK+
Sbjct: 64  FELSSYKRLIDIYSSTAKTVDALMKLELPSGVEVEIKV 101


>gi|313204916|ref|YP_004043573.1| SSU ribosomal protein s10p [Paludibacter propionicigenes WB4]
 gi|312444232|gb|ADQ80588.1| SSU ribosomal protein S10P [Paludibacter propionicigenes WB4]
          Length = 101

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 68/98 (69%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++D S  +IV T K +G+ + GPIP P   R FTVNR+  V+KKSR+Q
Sbjct: 4   KIRIKLKSYDHNLVDKSAEKIVKTVKATGAVVSGPIPLPTHKRIFTVNRATFVNKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+  YKRL+ I   T +TVDALMKL++ +GV V IK+
Sbjct: 64  FELSSYKRLIDIYSSTSKTVDALMKLELPSGVEVEIKV 101


>gi|55823822|ref|YP_142263.1| 30S ribosomal protein S10 [Streptococcus thermophilus CNRZ1066]
 gi|81558867|sp|Q5LXR0|RS10_STRT1 RecName: Full=30S ribosomal protein S10
 gi|55739807|gb|AAV63448.1| 30S ribosomal protein S10 [Streptococcus thermophilus CNRZ1066]
          Length = 102

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 68/100 (68%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LKA++ R LD++  +IV    ++G+ + GP+P       +T+ R+ H  K SR
Sbjct: 3   NKKIRIRLKAYEHRTLDTAAGKIVENATRTGATVAGPVPLSTERSLYTIIRATHKYKDSR 62

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q EMR +KRL+ II PT +TVDALMKLD+ +GVNV IKL
Sbjct: 63  EQFEMRTHKRLIDIINPTQKTVDALMKLDLPSGVNVEIKL 102


>gi|261338280|ref|ZP_05966164.1| ribosomal protein S10 [Bifidobacterium gallicum DSM 20093]
 gi|270276935|gb|EFA22789.1| ribosomal protein S10 [Bifidobacterium gallicum DSM 20093]
          Length = 102

 Score = 97.1 bits (240), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 45/98 (45%), Positives = 66/98 (67%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++D S ++IV T   +G+ +VGP+P P     + V RSPH  K SR+ 
Sbjct: 5   KIRIRLKSYDHEVIDQSAKKIVETVTNAGATVVGPVPLPTEKNVYVVIRSPHKYKDSREH 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTP+ VD+LM +D+ A VN+ IKL
Sbjct: 65  FEMRTHKRLIDIVDPTPKAVDSLMHIDLPADVNIEIKL 102


>gi|213962887|ref|ZP_03391147.1| ribosomal protein S10 [Capnocytophaga sputigena Capno]
 gi|213954544|gb|EEB65866.1| ribosomal protein S10 [Capnocytophaga sputigena Capno]
          Length = 103

 Score = 97.1 bits (240), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 72/102 (70%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           S   +I I LK++D  ++D S  +IV T K +G+ +VGPIP P   + FTV RSPHV+KK
Sbjct: 2   SNQQKIRIKLKSYDHNLVDKSAEKIVKTVKAAGAVVVGPIPLPTHKKIFTVLRSPHVNKK 61

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +R+Q ++  +KRLL I   + +T+DALMKL++ +GV+V IK+
Sbjct: 62  AREQFQLSSHKRLLDIYSSSSKTIDALMKLELPSGVDVDIKV 103


>gi|225020385|ref|ZP_03709577.1| hypothetical protein CORMATOL_00392 [Corynebacterium matruchotii
           ATCC 33806]
 gi|224946774|gb|EEG27983.1| hypothetical protein CORMATOL_00392 [Corynebacterium matruchotii
           ATCC 33806]
          Length = 110

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 67/96 (69%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D   +D S R+IV T  ++G+++VGP+P P     + V RSPH  K SR+ 
Sbjct: 14  KIRIRLKAYDHEAIDVSARKIVETVTRTGARVVGPVPLPTEKNVYAVIRSPHKYKDSREH 73

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVI 102
            EMR +KRL+ I+ PTP+TVDALM++D+ A V+V I
Sbjct: 74  FEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI 109


>gi|41410258|ref|NP_963094.1| 30S ribosomal protein S10 [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|118467320|ref|YP_883607.1| 30S ribosomal protein S10 [Mycobacterium avium 104]
 gi|240167702|ref|ZP_04746361.1| 30S ribosomal protein S10 [Mycobacterium kansasii ATCC 12478]
 gi|254776908|ref|ZP_05218424.1| 30S ribosomal protein S10 [Mycobacterium avium subsp. avium ATCC
           25291]
 gi|254822788|ref|ZP_05227789.1| 30S ribosomal protein S10 [Mycobacterium intracellulare ATCC 13950]
 gi|296168556|ref|ZP_06850360.1| 30S ribosomal protein S10 [Mycobacterium parascrofulaceum ATCC
           BAA-614]
 gi|54036385|sp|Q73SB4|RS10_MYCPA RecName: Full=30S ribosomal protein S10
 gi|166231292|sp|A0QL19|RS10_MYCA1 RecName: Full=30S ribosomal protein S10
 gi|41399092|gb|AAS06710.1| RpsJ [Mycobacterium avium subsp. paratuberculosis K-10]
 gi|118168607|gb|ABK69504.1| ribosomal protein S10 [Mycobacterium avium 104]
 gi|295896619|gb|EFG76258.1| 30S ribosomal protein S10 [Mycobacterium parascrofulaceum ATCC
           BAA-614]
          Length = 101

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 70/103 (67%), Gaps = 2/103 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LKA+D   +D+S R+IV T  ++G+ +VGP+P P     + V RSPH  
Sbjct: 1   MAGQKIRIR--LKAYDHEAIDASARKIVETVVRTGASVVGPVPLPTEKNVYCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           K SR+  EMR +KRL+ I+ PTP+TVDALM++D+ A V+V I+
Sbjct: 59  KDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNIQ 101


>gi|330997366|ref|ZP_08321217.1| ribosomal protein S10 [Paraprevotella xylaniphila YIT 11841]
 gi|329570740|gb|EGG52456.1| ribosomal protein S10 [Paraprevotella xylaniphila YIT 11841]
          Length = 101

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 68/98 (69%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++D S  +IV T K +G+ + GPIP P   R FTVNRS  V+KKSR+Q
Sbjct: 4   KIRIKLKSYDHNLVDKSAEKIVKTVKVTGAIVSGPIPLPTHKRIFTVNRSTFVNKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+  YKRL+ I   T +TVDALMKL++ +GV V IK+
Sbjct: 64  FELSSYKRLIDIYSSTAKTVDALMKLELPSGVEVEIKV 101


>gi|315023955|gb|EFT36957.1| SSU ribosomal protein S10p (S20e) [Riemerella anatipestifer RA-YM]
          Length = 101

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I LK++D  ++D S  +IV T K +G+ + GPIP P   R FTV RSPHV+KK+R+Q
Sbjct: 4   RIRIKLKSYDYNLVDKSAEKIVKTVKSTGAVVNGPIPLPTHKRIFTVLRSPHVNKKAREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            ++  +KRL+ I   + +TVDALMKL++ +GV+V IK+
Sbjct: 64  FQLSAHKRLMDIYSSSSKTVDALMKLELPSGVDVEIKV 101


>gi|254495340|ref|ZP_05108264.1| 30S ribosomal protein S10 [Polaribacter sp. MED152]
 gi|85819694|gb|EAQ40851.1| 30S ribosomal protein S10 [Polaribacter sp. MED152]
          Length = 101

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 69/98 (70%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++D S  +IV T K +G+ + GPIP P   + FTV RSPHV+KKSR+Q
Sbjct: 4   KIRIKLKSYDYNLVDKSAEKIVKTVKSTGAIVNGPIPLPTHKKIFTVLRSPHVNKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            ++  YKRLL I   + +T+DALMKL++ +GV V IK+
Sbjct: 64  FQLAAYKRLLDIYSSSSKTIDALMKLELPSGVEVEIKV 101


>gi|291296992|ref|YP_003508390.1| 30S ribosomal protein S10 [Meiothermus ruber DSM 1279]
 gi|290471951|gb|ADD29370.1| ribosomal protein S10 [Meiothermus ruber DSM 1279]
          Length = 104

 Score = 97.1 bits (240), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 45/98 (45%), Positives = 66/98 (67%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I L+ FD + LD+S  +IV T ++SG+Q+ GP+P P  IRRFTV RSP   K SR+ 
Sbjct: 3   KIRIKLRGFDHKSLDASAAKIVETARRSGAQVSGPVPLPTRIRRFTVLRSPFKHKDSREH 62

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R + RL+ I  PTP+T++ L  LD+  GV + +K+
Sbjct: 63  FELRTHNRLVDISDPTPKTIEGLRNLDLPTGVEIELKM 100


>gi|68536924|ref|YP_251629.1| 30S ribosomal protein S10 [Corynebacterium jeikeium K411]
 gi|300933011|ref|ZP_07148267.1| 30S ribosomal protein S10 [Corynebacterium resistens DSM 45100]
 gi|319443066|ref|ZP_07992222.1| 30S ribosomal protein S10 [Corynebacterium variabile DSM 44702]
 gi|109915156|sp|Q4JT46|RS10_CORJK RecName: Full=30S ribosomal protein S10
 gi|68264523|emb|CAI38011.1| 30S ribosomal protein S10 [Corynebacterium jeikeium K411]
          Length = 101

 Score = 97.1 bits (240), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 48/103 (46%), Positives = 71/103 (68%), Gaps = 2/103 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LKA+D   +D+S ++IV T  ++G+++VGP+P P     + V RSPH  
Sbjct: 1   MAGQKIRIR--LKAYDHEAIDASAKKIVETVTRTGARVVGPVPLPTEKNVYCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           K SR+  EMR +KRL+ I+ PTP+TVDALM++D+ A V+V I+
Sbjct: 59  KDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNIQ 101


>gi|225011646|ref|ZP_03702084.1| ribosomal protein S10 [Flavobacteria bacterium MS024-2A]
 gi|225004149|gb|EEG42121.1| ribosomal protein S10 [Flavobacteria bacterium MS024-2A]
          Length = 101

 Score = 96.7 bits (239), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 69/98 (70%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++D S  +IV T K +G+ + GPIP P   + FTV RSPHV+KKSR+Q
Sbjct: 4   KIRIKLKSYDHNLVDKSADKIVKTVKTTGAVVTGPIPLPTHKKIFTVLRSPHVNKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            ++  YKRLL I   + +T+DALMKL++ +GV V IK+
Sbjct: 64  FKLSSYKRLLDIYSSSSKTIDALMKLELPSGVEVEIKV 101


>gi|88803752|ref|ZP_01119276.1| 30S ribosomal protein S10 [Polaribacter irgensii 23-P]
 gi|88780485|gb|EAR11666.1| 30S ribosomal protein S10 [Polaribacter irgensii 23-P]
          Length = 101

 Score = 96.7 bits (239), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 69/98 (70%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++D S  +IV T K +G+ + GPIP P   + FTV RSPHV+KKSR+Q
Sbjct: 4   KIRIKLKSYDYNLVDKSAEKIVKTVKSTGAVVNGPIPLPTHKKIFTVLRSPHVNKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            ++  YKRLL I   + +T+DALMKL++ +GV V IK+
Sbjct: 64  FQLASYKRLLDIYSSSSKTIDALMKLELPSGVEVEIKV 101


>gi|255536160|ref|YP_003096531.1| SSU ribosomal protein S10p (S20e) [Flavobacteriaceae bacterium
           3519-10]
 gi|255342356|gb|ACU08469.1| SSU ribosomal protein S10p (S20e) [Flavobacteriaceae bacterium
           3519-10]
          Length = 101

 Score = 96.7 bits (239), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I LK++D  ++D S  +IV T K +G+ + GPIP P + R FTV RSPHV+KK+R+Q
Sbjct: 4   RIRIKLKSYDYSLVDKSAEKIVRTVKATGAVVNGPIPLPTNKRIFTVLRSPHVNKKAREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            ++  +KRL+ I   + +TVDALMKL++ +GV+V IK+
Sbjct: 64  FQLSAHKRLMDIYSSSSKTVDALMKLELPSGVDVEIKV 101


>gi|227487124|ref|ZP_03917440.1| 30S ribosomal protein S10 [Corynebacterium glucuronolyticum ATCC
           51867]
 gi|227541709|ref|ZP_03971758.1| 30S ribosomal protein S10 [Corynebacterium glucuronolyticum ATCC
           51866]
 gi|227092782|gb|EEI28094.1| 30S ribosomal protein S10 [Corynebacterium glucuronolyticum ATCC
           51867]
 gi|227182524|gb|EEI63496.1| 30S ribosomal protein S10 [Corynebacterium glucuronolyticum ATCC
           51866]
          Length = 142

 Score = 96.7 bits (239), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 69/97 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D   +D+S ++IV T  ++G++IVGP+P P     + V RSPH  K SR+ 
Sbjct: 46  KIRIRLKAYDHEAIDASAKKIVETVTRTGARIVGPVPLPTEKNVYCVIRSPHKYKDSREH 105

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            EMR +KR++ I+ PTP+TVDALM++D+ A V+V I+
Sbjct: 106 FEMRTHKRMIEILDPTPKTVDALMRIDLPASVDVNIQ 142


>gi|208780532|ref|ZP_03247871.1| ribosomal protein S10 [Francisella novicida FTG]
 gi|208743507|gb|EDZ89812.1| ribosomal protein S10 [Francisella novicida FTG]
          Length = 87

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 64/87 (73%)

Query: 1  MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
          M   N RI I LKAFD +++D S +EIV T KK+G+Q+ GPIP P    RFT+  SPHV+
Sbjct: 1  MAINNQRIRIRLKAFDHKLIDISTQEIVDTAKKTGAQVKGPIPLPVRKERFTILISPHVN 60

Query: 61 KKSRDQLEMRIYKRLLYIIKPTPQTVD 87
          KK+RDQ E+R +KRL+ I++PT +TVD
Sbjct: 61 KKARDQYEIRTHKRLIDIVEPTDKTVD 87


>gi|257453272|ref|ZP_05618571.1| SSU ribosomal protein S10P [Fusobacterium sp. 3_1_5R]
 gi|257467133|ref|ZP_05631444.1| SSU ribosomal protein S10P [Fusobacterium gonidiaformans ATCC
           25563]
 gi|315918264|ref|ZP_07914504.1| SSU ribosomal protein S10P [Fusobacterium gonidiaformans ATCC
           25563]
 gi|317059806|ref|ZP_07924291.1| SSU ribosomal protein S10P [Fusobacterium sp. 3_1_5R]
 gi|313685482|gb|EFS22317.1| SSU ribosomal protein S10P [Fusobacterium sp. 3_1_5R]
 gi|313692139|gb|EFS28974.1| SSU ribosomal protein S10P [Fusobacterium gonidiaformans ATCC
           25563]
          Length = 103

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 44/103 (42%), Positives = 72/103 (69%), Gaps = 2/103 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S  +RI   LKA+D  +LD S ++IV   KKSG+++VGP+P P  I+++TV RS HV+
Sbjct: 1   MASNKLRIY--LKAYDHSLLDESAKKIVEVAKKSGAEVVGPMPLPTKIKKYTVLRSVHVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           K SR+Q EMR+++R++ ++  T + + +L  +++ AGV + IK
Sbjct: 59  KDSREQFEMRVHRRMVELVNSTDKAIASLTAVNLPAGVGIEIK 101


>gi|150025408|ref|YP_001296234.1| 30S ribosomal protein S10 [Flavobacterium psychrophilum JIP02/86]
 gi|166231270|sp|A6GZA0|RS10_FLAPJ RecName: Full=30S ribosomal protein S10
 gi|149771949|emb|CAL43423.1| 30S ribosomal protein S10 [Flavobacterium psychrophilum JIP02/86]
          Length = 101

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 47/98 (47%), Positives = 69/98 (70%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++D S  +IV T K +G+ + GPIP P   + FTV RSPHV+KK+R+Q
Sbjct: 4   KIRIKLKSYDHMLVDKSAEKIVKTVKSTGAVVTGPIPLPTHKKLFTVLRSPHVNKKAREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+  YKRL+ I   + +T+DALMKL++ +GV V IK+
Sbjct: 64  FEVMSYKRLIDIYSSSSKTIDALMKLELPSGVEVEIKV 101


>gi|86605984|ref|YP_474747.1| 30S ribosomal protein S10 [Synechococcus sp. JA-3-3Ab]
 gi|115305651|sp|Q2JUX3|RS10_SYNJA RecName: Full=30S ribosomal protein S10
 gi|86554526|gb|ABC99484.1| ribosomal protein S10 [Synechococcus sp. JA-3-3Ab]
          Length = 105

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 73/104 (70%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           +T + IRI   LKA+D R+LD+S  +IV T +++ +  VGPIP P   R + V RSPH D
Sbjct: 4   LTQQKIRIR--LKAYDHRLLDTSCDKIVDTARRTEAVPVGPIPLPTRRRLYCVLRSPHTD 61

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+  E+R ++R++ I  P+ +T+DALMKLD+ AGV++ +KL
Sbjct: 62  KDSREHFEVRTHRRIIDIYSPSSKTIDALMKLDLPAGVDIEVKL 105


>gi|86608402|ref|YP_477164.1| 30S ribosomal protein S10 [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|115305652|sp|Q2JMX6|RS10_SYNJB RecName: Full=30S ribosomal protein S10
 gi|86556944|gb|ABD01901.1| ribosomal protein S10 [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 105

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 73/104 (70%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           +T + IRI   LKA+D R+LD+S  +IV T +++ +  VGPIP P   R + V RSPH+D
Sbjct: 4   LTQQKIRIR--LKAYDHRLLDTSCDKIVDTARRTDAVPVGPIPLPTRRRIYCVLRSPHID 61

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+  E R ++R++ I  P+ +T+DALMKLD+ AGV++ +KL
Sbjct: 62  KDSREHFETRTHRRIIDIYSPSSKTIDALMKLDLPAGVDIEVKL 105


>gi|325294395|ref|YP_004280909.1| 30S ribosomal protein S10 [Desulfurobacterium thermolithotrophum
           DSM 11699]
 gi|325064843|gb|ADY72850.1| 30S ribosomal protein S10 [Desulfurobacterium thermolithotrophum
           DSM 11699]
          Length = 103

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 69/98 (70%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I L A+D R+LD S++EI+ T K++G+ + GPIP P     ++V RSPH  K S++Q
Sbjct: 5   RIRIKLTAYDHRLLDRSVQEIIDTVKRTGAIVAGPIPLPTKRSVWSVIRSPHKYKYSQEQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R ++RLL I  P PQTV+ALM L + AGV+V IKL
Sbjct: 65  FEIRKHRRLLDIKNPKPQTVEALMDLKLPAGVDVEIKL 102


>gi|183601943|ref|ZP_02963312.1| 30S ribosomal protein S10 [Bifidobacterium animalis subsp. lactis
           HN019]
 gi|219682856|ref|YP_002469239.1| 30S ribosomal protein S10 [Bifidobacterium animalis subsp. lactis
           AD011]
 gi|241190432|ref|YP_002967826.1| 30S ribosomal protein S10 [Bifidobacterium animalis subsp. lactis
           Bl-04]
 gi|241195838|ref|YP_002969393.1| 30S ribosomal protein S10 [Bifidobacterium animalis subsp. lactis
           DSM 10140]
 gi|254809580|sp|B8DW12|RS10_BIFA0 RecName: Full=30S ribosomal protein S10
 gi|183218828|gb|EDT89470.1| 30S ribosomal protein S10 [Bifidobacterium animalis subsp. lactis
           HN019]
 gi|219620506|gb|ACL28663.1| ribosomal protein S10 [Bifidobacterium animalis subsp. lactis
           AD011]
 gi|240248824|gb|ACS45764.1| Ribosomal protein S10 [Bifidobacterium animalis subsp. lactis
           Bl-04]
 gi|240250392|gb|ACS47331.1| Ribosomal protein S10 [Bifidobacterium animalis subsp. lactis DSM
           10140]
 gi|289178156|gb|ADC85402.1| SSU ribosomal protein S10P [Bifidobacterium animalis subsp. lactis
           BB-12]
 gi|295793419|gb|ADG32954.1| Ribosomal protein S10 [Bifidobacterium animalis subsp. lactis V9]
          Length = 102

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 68/104 (65%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LK++D  ++D S ++IV T   +G+ +VGP+P P     + V RSPH  
Sbjct: 1   MAGQKIRIR--LKSYDHEVIDQSAKKIVETVTNAGATVVGPVPLPTEKNVYCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+  EMR +KRL+ I+ PTP+ VD+LM +D+ A VN+ IKL
Sbjct: 59  KDSREHFEMRTHKRLIDIVDPTPKAVDSLMHIDLPADVNIEIKL 102


>gi|310659503|ref|YP_003937224.1| 30S ribosomal protein S10 [Clostridium sticklandii DSM 519]
 gi|308826281|emb|CBH22319.1| 30S ribosomal subunit protein S10 [Clostridium sticklandii]
          Length = 103

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 71/102 (69%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
           S+N +I I LK++D RILD S  +IV T K +G+ + GPIP P   +  T+ R+ H  K 
Sbjct: 2   SKNQKIRIRLKSYDHRILDMSAEKIVETAKGTGASVSGPIPLPTEKQIITILRAVHKYKD 61

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           SR+Q E+R +KRL+ I  P+ +TVD+LM+LD+ AGV++ IKL
Sbjct: 62  SREQFEIRTHKRLIDISNPSSKTVDSLMRLDLPAGVDIEIKL 103


>gi|317507408|ref|ZP_07965142.1| ribosomal protein S10 [Segniliparus rugosus ATCC BAA-974]
 gi|316254293|gb|EFV13629.1| ribosomal protein S10 [Segniliparus rugosus ATCC BAA-974]
          Length = 101

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 48/103 (46%), Positives = 70/103 (67%), Gaps = 2/103 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LKA+D   +D+S R+IV T  ++G+ +VGP+P P     F V RSPH  
Sbjct: 1   MAGQKIRIR--LKAYDHEAIDASARKIVETVTRTGASVVGPVPLPTEKNVFCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           K SR+  EMR +KR++ I+ PTP+TVDALM++++ A V+V I+
Sbjct: 59  KDSREHFEMRTHKRMIDILDPTPKTVDALMRINLPASVDVNIQ 101


>gi|146298162|ref|YP_001192753.1| 30S ribosomal protein S10 [Flavobacterium johnsoniae UW101]
 gi|189040372|sp|A5FMY2|RS10_FLAJO RecName: Full=30S ribosomal protein S10
 gi|146152580|gb|ABQ03434.1| 30S ribosomal protein S10 [Flavobacterium johnsoniae UW101]
          Length = 101

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 47/98 (47%), Positives = 69/98 (70%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++D S  +IV T K +G+ + GPIP P   + FTV RSPHV+KK+R+Q
Sbjct: 4   KIRIKLKSYDHMLVDKSAEKIVKTVKTTGAVVTGPIPLPTHKKLFTVLRSPHVNKKAREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+  YKRL+ I   + +T+DALMKL++ +GV V IK+
Sbjct: 64  FEVMSYKRLIDIYSSSSKTIDALMKLELPSGVEVEIKV 101


>gi|325282639|ref|YP_004255180.1| 30S ribosomal protein S10 [Deinococcus proteolyticus MRP]
 gi|324314448|gb|ADY25563.1| 30S ribosomal protein S10 [Deinococcus proteolyticus MRP]
          Length = 107

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 66/97 (68%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I L+ FD R LD S  +IV T +++G+ + GP+P P  IRRF V RSP +DK SR+ 
Sbjct: 5   KIRIKLRGFDHRALDQSASKIVDTVRRTGADVSGPVPLPTRIRRFCVLRSPFIDKDSREH 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E+R + RL+ I  PT +T+D+LM LD+  GV++ IK
Sbjct: 65  FEIRTHNRLVDIKNPTKKTIDSLMTLDLPTGVDIEIK 101


>gi|329768272|ref|ZP_08259773.1| 30S ribosomal protein S10 [Gemella haemolysans M341]
 gi|329770041|ref|ZP_08261436.1| 30S ribosomal protein S10 [Gemella sanguinis M325]
 gi|328837352|gb|EGF86982.1| 30S ribosomal protein S10 [Gemella sanguinis M325]
 gi|328837471|gb|EGF87100.1| 30S ribosomal protein S10 [Gemella haemolysans M341]
          Length = 102

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/98 (46%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK +D R++D S  +IV T K+SG+++ GPIP P     +T+ RS H+ K SR+Q
Sbjct: 5   KIRIRLKGYDHRLVDQSAEKIVETAKRSGAKVSGPIPLPTEKAVYTILRSVHIYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R +KRL+ II+PT +TVDAL+ L++ +GV++ +KL
Sbjct: 65  FEQRTHKRLIDIIEPTQKTVDALISLNLPSGVDIELKL 102


>gi|227501133|ref|ZP_03931182.1| ribosomal protein S10 [Anaerococcus tetradius ATCC 35098]
 gi|227216718|gb|EEI82119.1| ribosomal protein S10 [Anaerococcus tetradius ATCC 35098]
          Length = 111

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 69/100 (69%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I L+A+D  ++DSS  +IV   K+SG+++ GPIP P  I + T+ R+ H  K SR
Sbjct: 12  NQKIRIRLRAYDHEVIDSSAEKIVEAVKRSGAEVSGPIPLPTEIEKITILRAVHKYKDSR 71

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q E R +KRL+ II P  +T+D+L KL++ AGV++ IKL
Sbjct: 72  EQFEQRTHKRLIDIIGPNAKTLDSLKKLNLPAGVDIEIKL 111


>gi|163791665|ref|ZP_02186060.1| 30S ribosomal protein S10 [Carnobacterium sp. AT7]
 gi|159873044|gb|EDP67153.1| 30S ribosomal protein S10 [Carnobacterium sp. AT7]
          Length = 102

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 68/98 (69%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA++ RILD S  +IV T K++G+ + GPIP P     +TV R+ H  K SR+Q
Sbjct: 5   KIRIRLKAYEHRILDQSAEKIVETAKRTGASVSGPIPLPTERTLYTVIRATHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EM  +KR++ I+ PT +TVDAL KLD+ +GV++ IKL
Sbjct: 65  FEMLTHKRVIDIVNPTAKTVDALTKLDLPSGVDIEIKL 102


>gi|17231828|ref|NP_488376.1| 30S ribosomal protein S10 [Nostoc sp. PCC 7120]
 gi|75907509|ref|YP_321805.1| 30S ribosomal protein S10 [Anabaena variabilis ATCC 29413]
 gi|298490077|ref|YP_003720254.1| 30S ribosomal protein S10 ['Nostoc azollae' 0708]
 gi|20140062|sp|Q8YP64|RS10_ANASP RecName: Full=30S ribosomal protein S10
 gi|115305606|sp|Q3MDM6|RS10_ANAVT RecName: Full=30S ribosomal protein S10
 gi|17133472|dbj|BAB76035.1| 30S ribosomal protein S10 [Nostoc sp. PCC 7120]
 gi|75701234|gb|ABA20910.1| SSU ribosomal protein S10P [Anabaena variabilis ATCC 29413]
 gi|298231995|gb|ADI63131.1| ribosomal protein S10 ['Nostoc azollae' 0708]
          Length = 105

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 45/98 (45%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I L+AFD R+LD+S  +IV T  ++ +  +GPIP P   + + V RSPHVDK SR+ 
Sbjct: 8   KIRIRLQAFDRRLLDTSCEKIVDTANRTNATAIGPIPLPTKRKIYCVLRSPHVDKDSREH 67

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R ++R++ I +P+ +T+DALMKLD+ +GV++ +KL
Sbjct: 68  FETRTHRRIIDIYQPSSKTIDALMKLDLPSGVDIEVKL 105


>gi|328958729|ref|YP_004376115.1| 30S ribosomal protein S10 [Carnobacterium sp. 17-4]
 gi|328675053|gb|AEB31099.1| 30S ribosomal protein S10 [Carnobacterium sp. 17-4]
          Length = 102

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 68/98 (69%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA++ RILD S  +IV T K++G+ + GPIP P     +TV R+ H  K SR+Q
Sbjct: 5   KIRIRLKAYEHRILDQSAEKIVETAKRTGASVSGPIPLPTERTLYTVIRATHKYKDSREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EM  +KR++ I+ PT +TVDAL KLD+ +GV++ IKL
Sbjct: 65  FEMLTHKRVIDIVNPTSKTVDALTKLDLPSGVDIEIKL 102


>gi|241889012|ref|ZP_04776316.1| ribosomal protein S10 [Gemella haemolysans ATCC 10379]
 gi|317496191|ref|ZP_07954551.1| ribosomal protein S10 [Gemella moribillum M424]
 gi|241864261|gb|EER68639.1| ribosomal protein S10 [Gemella haemolysans ATCC 10379]
 gi|316913766|gb|EFV35252.1| ribosomal protein S10 [Gemella moribillum M424]
          Length = 103

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/98 (46%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK +D R++D S  +IV T K+SG+++ GPIP P     +T+ RS H+ K SR+Q
Sbjct: 6   KIRIRLKGYDHRLVDQSAEKIVETAKRSGAKVSGPIPLPTEKAVYTILRSVHIYKDSREQ 65

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R +KRL+ II+PT +TVDAL+ L++ +GV++ +KL
Sbjct: 66  FEQRTHKRLIDIIEPTQKTVDALISLNLPSGVDIELKL 103


>gi|302669960|ref|YP_003829920.1| ribosomal protein S10 RpsJ [Butyrivibrio proteoclasticus B316]
 gi|302394433|gb|ADL33338.1| ribosomal protein S10 RpsJ [Butyrivibrio proteoclasticus B316]
          Length = 103

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 68/95 (71%)

Query: 10  ICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQLEM 69
           I LKA+D +++D+S ++I+ T KK+GSQ+ GP+P P      T+ R+ H  K SR+Q E 
Sbjct: 8   ITLKAYDHQLVDASAKKIIETVKKNGSQVSGPVPLPTKKEVVTILRAVHKYKDSREQFEQ 67

Query: 70  RIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           R +KRL+ II PT +TV+AL +L++ AGVN+ IK+
Sbjct: 68  RTHKRLIDIITPTSKTVEALQRLEMPAGVNINIKM 102


>gi|53715467|ref|YP_101459.1| 30S ribosomal protein S10 [Bacteroides fragilis YCH46]
 gi|60683439|ref|YP_213583.1| 30S ribosomal protein S10 [Bacteroides fragilis NCTC 9343]
 gi|253566669|ref|ZP_04844122.1| 30S ribosomal protein S10 [Bacteroides sp. 3_2_5]
 gi|255011645|ref|ZP_05283771.1| 30S ribosomal protein S10 [Bacteroides fragilis 3_1_12]
 gi|265767547|ref|ZP_06095213.1| ribosomal protein S10 [Bacteroides sp. 2_1_16]
 gi|313149481|ref|ZP_07811674.1| 30S ribosomal protein S10 [Bacteroides fragilis 3_1_12]
 gi|81313513|sp|Q5L8A8|RS10_BACFN RecName: Full=30S ribosomal protein S10
 gi|81608232|sp|Q64NK7|RS10_BACFR RecName: Full=30S ribosomal protein S10
 gi|52218332|dbj|BAD50925.1| 30S ribosomal protein S10 [Bacteroides fragilis YCH46]
 gi|60494873|emb|CAH09680.1| putative 30S ribosomal protein S10 [Bacteroides fragilis NCTC 9343]
 gi|251944841|gb|EES85316.1| 30S ribosomal protein S10 [Bacteroides sp. 3_2_5]
 gi|263252852|gb|EEZ24364.1| ribosomal protein S10 [Bacteroides sp. 2_1_16]
 gi|301164924|emb|CBW24485.1| putative 30S ribosomal protein S10 [Bacteroides fragilis 638R]
 gi|313138248|gb|EFR55608.1| 30S ribosomal protein S10 [Bacteroides fragilis 3_1_12]
          Length = 101

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 68/98 (69%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++D S  +IV T K +G+ + GPIP P   R FTVNRS  V+KKSR+Q
Sbjct: 4   KIRIKLKSYDHNLVDKSAEKIVRTVKATGAIVSGPIPLPTHKRIFTVNRSTFVNKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+  +KRL+ I   T +TVDALMKL++ +GV V IK+
Sbjct: 64  FELSSFKRLIDIYSSTAKTVDALMKLELPSGVEVEIKV 101


>gi|50955567|ref|YP_062855.1| 30S ribosomal protein S10 [Leifsonia xyli subsp. xyli str. CTCB07]
 gi|81612624|sp|Q6ACZ4|RS10_LEIXX RecName: Full=30S ribosomal protein S10
 gi|50952049|gb|AAT89750.1| 30S ribosomal protein S10 [Leifsonia xyli subsp. xyli str. CTCB07]
          Length = 102

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 69/104 (66%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LK++D   LD+S R+IV T  ++G+ +VGP+P P       V RSPH  
Sbjct: 1   MAGQKIRIR--LKSYDHAGLDTSARKIVDTVTRAGATVVGPVPLPTEKNVVCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+  EMR +KRL+ I+ PTP+ VD+LM+LD+ A VN+ IKL
Sbjct: 59  KDSREHFEMRTHKRLIDIVDPTPKAVDSLMRLDLPADVNIEIKL 102


>gi|167752384|ref|ZP_02424511.1| hypothetical protein ALIPUT_00628 [Alistipes putredinis DSM 17216]
 gi|167660625|gb|EDS04755.1| hypothetical protein ALIPUT_00628 [Alistipes putredinis DSM 17216]
 gi|291514944|emb|CBK64154.1| SSU ribosomal protein S10P [Alistipes shahii WAL 8301]
 gi|313158334|gb|EFR57736.1| ribosomal protein S10 [Alistipes sp. HGB5]
          Length = 101

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 70/100 (70%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LK+FD  ++D S  +IV T K +G+ + GP+P P   + FTVNRS  V+KK+R
Sbjct: 2   NQKIRIKLKSFDHNLVDKSAEKIVKTVKSTGAVVSGPVPLPTHKQIFTVNRSTFVNKKAR 61

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +Q ++  +KR+L I   TP+T+DALMKL++ +GV V IK+
Sbjct: 62  EQFQLCTFKRILDIYSSTPKTIDALMKLELPSGVEVEIKV 101


>gi|289806293|ref|ZP_06536922.1| ribosomal protein S10 [Salmonella enterica subsp. enterica
          serovar Typhi str. AG3]
          Length = 85

 Score = 95.9 bits (237), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 47/84 (55%), Positives = 62/84 (73%)

Query: 4  RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKS 63
          +N RI I LKAFD R++D S  EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +
Sbjct: 2  QNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDA 61

Query: 64 RDQLEMRIYKRLLYIIKPTPQTVD 87
          RDQ E+R +KRL+ I++PT +TVD
Sbjct: 62 RDQYEIRTHKRLVDIVEPTEKTVD 85


>gi|108804975|ref|YP_644912.1| 30S ribosomal protein S10P [Rubrobacter xylanophilus DSM 9941]
 gi|118597315|sp|Q1AU28|RS10_RUBXD RecName: Full=30S ribosomal protein S10
 gi|108766218|gb|ABG05100.1| SSU ribosomal protein S10P [Rubrobacter xylanophilus DSM 9941]
          Length = 103

 Score = 95.9 bits (237), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 67/97 (69%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKA+D  ++D + R IV T +++G+ + GP+P P    R+TV R P  DK SR+ 
Sbjct: 5   KIRIKLKAYDHEVIDKTARSIVETAERTGAFVFGPVPLPTKRSRYTVIRGPFKDKDSREH 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            ++  +KRL+ I +PTP+TVD+L +LD+ AGVN+ IK
Sbjct: 65  FQLNTHKRLIDIQQPTPRTVDSLQRLDLPAGVNIEIK 101


>gi|327402784|ref|YP_004343622.1| 30S ribosomal protein S10P [Fluviicola taffensis DSM 16823]
 gi|327318292|gb|AEA42784.1| SSU ribosomal protein S10P [Fluviicola taffensis DSM 16823]
          Length = 101

 Score = 95.9 bits (237), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++D S  +IV T K +G+ + GPIP P   R +TV RSPHV+KK+R+Q
Sbjct: 4   KIRIKLKSYDHNLVDKSAEKIVKTVKATGAVVSGPIPLPTHKRIYTVLRSPHVNKKAREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+  YKRLL I   + +TVDALM+L++ +GV+V IK+
Sbjct: 64  FELCSYKRLLDIYSSSSKTVDALMRLELPSGVDVEIKV 101


>gi|149279669|ref|ZP_01885798.1| 30S ribosomal protein S10 [Pedobacter sp. BAL39]
 gi|255530510|ref|YP_003090882.1| 30S ribosomal protein S10 [Pedobacter heparinus DSM 2366]
 gi|149229705|gb|EDM35095.1| 30S ribosomal protein S10 [Pedobacter sp. BAL39]
 gi|255343494|gb|ACU02820.1| ribosomal protein S10 [Pedobacter heparinus DSM 2366]
          Length = 101

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 68/98 (69%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I LK++D  ++D S  +IV T K +G+ + GPIP P   + FTV RSPHV+KK+R+Q
Sbjct: 4   RIRIKLKSYDYNLVDKSAEKIVKTVKPTGAVVSGPIPLPTEKKIFTVLRSPHVNKKAREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            ++  YKRLL I     +TVDALMKL++ +GV V IK+
Sbjct: 64  FQLCAYKRLLDIYSSNSKTVDALMKLELPSGVEVEIKV 101


>gi|282896081|ref|ZP_06304107.1| Ribosomal protein S10 [Raphidiopsis brookii D9]
 gi|281198999|gb|EFA73874.1| Ribosomal protein S10 [Raphidiopsis brookii D9]
          Length = 105

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 45/98 (45%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I L+AFD R+LD+S  +IV T  ++ +  +GPIP P   + + V RSPHVDK SR+ 
Sbjct: 8   KIRIRLQAFDRRLLDTSCEKIVDTANRTNATAIGPIPLPTKRKIYCVLRSPHVDKDSREH 67

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R ++R++ I +P+ +T+DALMKLD+ +GV++ +KL
Sbjct: 68  FETRTHRRIIDIHQPSSKTIDALMKLDLPSGVDIEVKL 105


>gi|295394349|ref|ZP_06804574.1| 30S ribosomal protein S10 [Brevibacterium mcbrellneri ATCC 49030]
 gi|294972807|gb|EFG48657.1| 30S ribosomal protein S10 [Brevibacterium mcbrellneri ATCC 49030]
          Length = 114

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 44/98 (44%), Positives = 68/98 (69%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++D++ R+IV T  ++G+ +VGP+P P     + V RSPH  K SR+ 
Sbjct: 17  KIRIRLKSYDHAVIDNAARKIVDTVTRAGATVVGPVPLPTEKNVYCVIRSPHKYKDSREH 76

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTP+ +D+LM +D+A  VN+ IKL
Sbjct: 77  FEMRTHKRLIDIVDPTPKAIDSLMHIDLADDVNIEIKL 114


>gi|237736169|ref|ZP_04566650.1| SSU ribosomal protein S10P [Fusobacterium mortiferum ATCC 9817]
 gi|229421722|gb|EEO36769.1| SSU ribosomal protein S10P [Fusobacterium mortiferum ATCC 9817]
          Length = 103

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 46/103 (44%), Positives = 70/103 (67%), Gaps = 2/103 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S  +RI   LKA+D  +LD S ++I    KKSG++I GP+P P  IR++TV RS HV+
Sbjct: 1   MASNKLRIY--LKAYDHTLLDQSAKKIAEVAKKSGAEIAGPMPLPTKIRKYTVLRSVHVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           K SR+Q EMR+++R++ I   T +T+ +L  +++ AGV + IK
Sbjct: 59  KDSREQFEMRVHRRMVEINNSTQKTIASLTAVNLPAGVGIEIK 101


>gi|311748515|ref|ZP_07722300.1| ribosomal protein S10 [Algoriphagus sp. PR1]
 gi|126577031|gb|EAZ81279.1| ribosomal protein S10 [Algoriphagus sp. PR1]
          Length = 101

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 70/100 (70%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LK++D  ++D S  +IV   K +G+ +VGPIP P    +FTV +SPHV KK+R
Sbjct: 2   NQKIRIKLKSYDHSLVDKSSEKIVKAVKATGAVVVGPIPLPTKKEKFTVLKSPHVSKKAR 61

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           DQ ++  YKRL+ I   + +TVDALMK+++ +GV+V IK+
Sbjct: 62  DQYQLCTYKRLVDIYSNSSKTVDALMKIELPSGVDVEIKV 101


>gi|119025338|ref|YP_909183.1| 30S ribosomal protein S10 [Bifidobacterium adolescentis ATCC 15703]
 gi|166231242|sp|A1A068|RS10_BIFAA RecName: Full=30S ribosomal protein S10
 gi|118764922|dbj|BAF39101.1| 30S ribosomal protein S10 [Bifidobacterium adolescentis ATCC 15703]
          Length = 102

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 45/98 (45%), Positives = 65/98 (66%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++D S ++IV T   +G+ +VGP+P P       V RSPH  K SR+ 
Sbjct: 5   KIRIRLKSYDHEVIDQSAKKIVETVTNAGATVVGPVPLPTEKNVLVVIRSPHKYKDSREH 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I+ PTP+ VD+LM +D+ A VN+ IKL
Sbjct: 65  FEMRTHKRLIDIVDPTPKAVDSLMHIDLPADVNIEIKL 102


>gi|87301868|ref|ZP_01084702.1| 30S ribosomal protein S10 [Synechococcus sp. WH 5701]
 gi|87283436|gb|EAQ75391.1| 30S ribosomal protein S10 [Synechococcus sp. WH 5701]
          Length = 106

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 46/98 (46%), Positives = 67/98 (68%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD R+LD S  +I+ T   + +  +GPIP P   + + V RSPHVDK SR+ 
Sbjct: 9   KIRIRLKAFDRRMLDLSCEKIIETADHTAATAIGPIPLPTKRKIYCVLRSPHVDKDSREH 68

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R ++R++ I  PT +T+DALMKLD+ +GV++ +KL
Sbjct: 69  FETRTHRRIIDIYSPTAKTIDALMKLDLPSGVDIEVKL 106


>gi|315225400|ref|ZP_07867214.1| 30S ribosomal protein S10 [Capnocytophaga ochracea F0287]
 gi|314944673|gb|EFS96708.1| 30S ribosomal protein S10 [Capnocytophaga ochracea F0287]
          Length = 103

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 46/98 (46%), Positives = 69/98 (70%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++D S  +IV T K +G+ + GPIP P   + FTV RSPHV+KK+R+Q
Sbjct: 6   KIRIKLKSYDHNLVDKSAEKIVKTVKATGAVVTGPIPLPTHKKIFTVLRSPHVNKKAREQ 65

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            ++  +KRLL I   + +T+DALMKL++ +GV V IK+
Sbjct: 66  FQLSSHKRLLDIYSSSSKTIDALMKLELPSGVEVEIKV 103


>gi|7388123|sp|Q9ZI51|RS10_AQUPY RecName: Full=30S ribosomal protein S10
 gi|4165864|gb|AAD08784.1| ribosomal protein S10 [Aquifex pyrophilus]
          Length = 104

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 44/98 (44%), Positives = 71/98 (72%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD R+LD S+++I+ T K++G  + GPIP P   R++ V RSPH   +SR+ 
Sbjct: 5   KIRIKLKAFDHRVLDQSVKQIIETVKRTGGVVRGPIPLPTRKRKWCVLRSPHKFDQSREH 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R + R++ I + TPQT++ALM++++ AGV+V +K+
Sbjct: 65  FEIRAFSRIIDITRFTPQTIEALMEINLPAGVDVEVKM 102


>gi|282898983|ref|ZP_06306965.1| Ribosomal protein S10 [Cylindrospermopsis raciborskii CS-505]
 gi|281196123|gb|EFA71038.1| Ribosomal protein S10 [Cylindrospermopsis raciborskii CS-505]
          Length = 131

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 46/103 (44%), Positives = 72/103 (69%)

Query: 2   TSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDK 61
           T +  +I I L+AFD R+LD+S  +IV T  ++ +  +GPIP P   + + V RSPHVDK
Sbjct: 29  TLQQQKIRIRLQAFDRRLLDTSCEKIVDTANRTNATAIGPIPLPTKRKIYCVLRSPHVDK 88

Query: 62  KSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            SR+  E R ++R++ I +P+ +T+DALMKLD+ +GV++ +KL
Sbjct: 89  DSREHFETRTHRRIIDIHQPSSKTIDALMKLDLPSGVDIEVKL 131


>gi|57234687|ref|YP_181217.1| 30S ribosomal protein S10 [Dehalococcoides ethenogenes 195]
 gi|270307841|ref|YP_003329899.1| ribosomal protein S10 [Dehalococcoides sp. VS]
 gi|115305618|sp|Q3Z982|RS10_DEHE1 RecName: Full=30S ribosomal protein S10
 gi|57225135|gb|AAW40192.1| ribosomal protein S10 [Dehalococcoides ethenogenes 195]
 gi|270153733|gb|ACZ61571.1| ribosomal protein S10 [Dehalococcoides sp. VS]
          Length = 102

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 73/104 (70%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           MT + IRI   LK FD +ILD S  +IV   +++G+ I GP+P P  I+R++V RS  +D
Sbjct: 1   MTKQKIRIK--LKGFDHKILDQSALQIVEALERTGATISGPVPLPTRIQRYSVIRSSFID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K S++Q E+R +KRL+ I++ T +T+DAL  L++ AGV++ IKL
Sbjct: 59  KDSQEQFEIRTHKRLIDIVETTSKTIDALTNLNLPAGVSIDIKL 102


>gi|312889372|ref|ZP_07748926.1| SSU ribosomal protein S10P [Mucilaginibacter paludis DSM 18603]
 gi|311298249|gb|EFQ75364.1| SSU ribosomal protein S10P [Mucilaginibacter paludis DSM 18603]
          Length = 111

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 68/98 (69%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I LK++D  ++D S  +IV T K +G+ + GPIP P   + FTV RSPHV+KK+R+Q
Sbjct: 14  RIRIKLKSYDYNLVDKSAEKIVKTVKPTGAVVSGPIPLPTEKKIFTVLRSPHVNKKAREQ 73

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            ++  YKRLL I     +TVDALMKL++ +GV V IK+
Sbjct: 74  FQLCSYKRLLDIYSSNSKTVDALMKLELPSGVEVEIKV 111


>gi|154498882|ref|ZP_02037260.1| hypothetical protein BACCAP_02874 [Bacteroides capillosus ATCC
           29799]
 gi|150271722|gb|EDM98948.1| hypothetical protein BACCAP_02874 [Bacteroides capillosus ATCC
           29799]
          Length = 104

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 70/104 (67%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M ++   I I LKA+D +++D S  +IV T K++G+ + GPIP P      T+ R+ H  
Sbjct: 1   MAAQKEMIRIRLKAYDHQLIDQSAEKIVETAKRTGASVSGPIPLPTKKEVVTILRAVHKY 60

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K SR+Q E R +KRL+ I+KP+P+TV+ALM L++ AGV + IKL
Sbjct: 61  KDSREQFERRTHKRLIDILKPSPKTVEALMSLELPAGVEIEIKL 104


>gi|119510869|ref|ZP_01629993.1| 30S ribosomal protein S10 [Nodularia spumigena CCY9414]
 gi|119464478|gb|EAW45391.1| 30S ribosomal protein S10 [Nodularia spumigena CCY9414]
          Length = 105

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 45/103 (43%), Positives = 72/103 (69%)

Query: 2   TSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDK 61
           T +  +I I L+AFD R+LD+S  +IV T  ++ +  +GPIP P   + + V RSPHVDK
Sbjct: 3   TLQQQKIRIRLQAFDRRLLDTSCEKIVDTANRTNATAIGPIPLPTKRKIYCVLRSPHVDK 62

Query: 62  KSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            +R+  E R ++R++ I +P+ +T+DALMKLD+ +GV++ +KL
Sbjct: 63  DAREHFETRTHRRIIDIYQPSSKTIDALMKLDLPSGVDIEVKL 105


>gi|110639536|ref|YP_679745.1| 30S ribosomal protein S10 [Cytophaga hutchinsonii ATCC 33406]
 gi|118597173|sp|Q11QB1|RS10_CYTH3 RecName: Full=30S ribosomal protein S10
 gi|110282217|gb|ABG60403.1| SSU ribosomal protein S10P [Cytophaga hutchinsonii ATCC 33406]
          Length = 101

 Score = 95.1 bits (235), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 68/100 (68%)

Query: 5   NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR 64
           N +I I LK++D  ++D S   IV   K +G+ + GPIP P     FTV RSPHV+KKSR
Sbjct: 2   NQKIRIKLKSYDHNLVDKSSERIVRAVKATGAVVSGPIPLPTEKEIFTVLRSPHVNKKSR 61

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           DQ ++  YKRL+ I   + +TVDALMKL++ +GV+V IK+
Sbjct: 62  DQYQLCTYKRLVDIYSTSSKTVDALMKLELPSGVDVEIKV 101


>gi|257463960|ref|ZP_05628345.1| SSU ribosomal protein S10P [Fusobacterium sp. D12]
 gi|317061483|ref|ZP_07925968.1| SSU ribosomal protein S10P [Fusobacterium sp. D12]
 gi|313687159|gb|EFS23994.1| SSU ribosomal protein S10P [Fusobacterium sp. D12]
          Length = 103

 Score = 95.1 bits (235), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 43/103 (41%), Positives = 72/103 (69%), Gaps = 2/103 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S  +RI   LKA+D  +LD S ++IV   +KSG+++VGP+P P  I+++TV RS HV+
Sbjct: 1   MASNKLRIY--LKAYDHSLLDESAKKIVEVARKSGAEVVGPMPLPTKIKKYTVLRSVHVN 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           K SR+Q EMR+++R++ ++  T + + +L  +++ AGV + IK
Sbjct: 59  KDSREQFEMRVHRRMVELVNSTDKAIASLTAVNLPAGVGIEIK 101


>gi|296392584|ref|YP_003657468.1| 30S ribosomal protein S10 [Segniliparus rotundus DSM 44985]
 gi|296179731|gb|ADG96637.1| ribosomal protein S10 [Segniliparus rotundus DSM 44985]
          Length = 101

 Score = 95.1 bits (235), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/103 (45%), Positives = 70/103 (67%), Gaps = 2/103 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M  + IRI   LKA+D   +D+S R+IV T  ++G+ +VGP+P P     + V RSPH  
Sbjct: 1   MAGQKIRIR--LKAYDHEAIDASARKIVETVTRTGASVVGPVPLPTEKNVYCVIRSPHKY 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
           K SR+  EMR +KR++ I+ PTP+TVDALM++++ A V+V I+
Sbjct: 59  KDSREHFEMRTHKRMIDILDPTPKTVDALMRINLPASVDVNIQ 101


>gi|78779983|ref|YP_398095.1| 30S ribosomal protein S10 [Prochlorococcus marinus str. MIT 9312]
 gi|115305643|sp|Q318N6|RS10_PROM9 RecName: Full=30S ribosomal protein S10
 gi|78713482|gb|ABB50659.1| SSU ribosomal protein S10P [Prochlorococcus marinus str. MIT 9312]
          Length = 106

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 46/98 (46%), Positives = 67/98 (68%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD R+LD S  +I+ T   + +  +GPIP P   + + V RSPHVDK SR+ 
Sbjct: 9   KIRIRLKAFDRRMLDLSCEKIIQTADTTSASAIGPIPLPTKRKIYCVLRSPHVDKDSREH 68

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R ++RL+ I  P+ +T+DALMKLD+ +GV++ +KL
Sbjct: 69  FETRTHRRLIDIYSPSAKTIDALMKLDLPSGVDIEVKL 106


>gi|268316407|ref|YP_003290126.1| 30S ribosomal protein S10 [Rhodothermus marinus DSM 4252]
 gi|262333941|gb|ACY47738.1| ribosomal protein S10 [Rhodothermus marinus DSM 4252]
          Length = 102

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 73/104 (70%), Gaps = 2/104 (1%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           M S+ IRI   LK++D  ++D S  +I+ T K +G+ + GPIP P      TV RSPH+D
Sbjct: 1   MASQKIRIK--LKSYDHTLIDRSAEKIIRTVKATGAVVSGPIPLPTERTVITVLRSPHID 58

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           K+SR+Q E+R +KRL+ I+  + +TVDALMKL++ +GV+V IK+
Sbjct: 59  KESREQFEIRRHKRLIDILSTSSKTVDALMKLELPSGVDVEIKV 102


>gi|51894211|ref|YP_076902.1| 30S ribosomal protein S10 [Symbiobacterium thermophilum IAM 14863]
 gi|81610341|sp|Q67JU2|RS10_SYMTH RecName: Full=30S ribosomal protein S10
 gi|51857900|dbj|BAD42058.1| 30S ribosomal protein S10 [Symbiobacterium thermophilum IAM 14863]
          Length = 102

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 47/98 (47%), Positives = 70/98 (71%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I L+AFD +ILDSS  +IV T  ++G+ + GPIP P     +T+  +P+ +K  R+Q
Sbjct: 5   KIRIRLRAFDHKILDSSAAKIVETAIRTGATVSGPIPLPTEKSIYTILTAPNGEKDIREQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            EMR +KRL+ I++P  +TV+ALMKLD+ AGV++ IKL
Sbjct: 65  FEMRTHKRLIDIVEPGSKTVEALMKLDLPAGVDIEIKL 102


>gi|193214799|ref|YP_001995998.1| 30S ribosomal protein S10 [Chloroherpeton thalassium ATCC 35110]
 gi|226705421|sp|B3QY23|RS10_CHLT3 RecName: Full=30S ribosomal protein S10
 gi|193088276|gb|ACF13551.1| ribosomal protein S10 [Chloroherpeton thalassium ATCC 35110]
          Length = 103

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 68/97 (70%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D  ++D    +I+   K++ + I GPIP P   + FTVNRSPHVDKKSR+Q
Sbjct: 6   KIRIKLKSYDHSLVDKWAEKIIEAVKQTDAIISGPIPLPTESQVFTVNRSPHVDKKSREQ 65

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
             +  +KRL+ II P+ +T+D LMKL++ +GV+V IK
Sbjct: 66  FMVASHKRLIEIINPSSKTIDLLMKLELPSGVDVEIK 102


>gi|148243270|ref|YP_001228427.1| 30S ribosomal protein S10 [Synechococcus sp. RCC307]
 gi|166231791|sp|A5GW15|RS10_SYNR3 RecName: Full=30S ribosomal protein S10
 gi|147851580|emb|CAK29074.1| 30S ribosomal protein S10 [Synechococcus sp. RCC307]
          Length = 106

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 46/98 (46%), Positives = 67/98 (68%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LKAFD R+LD S  +I+ T   + +  +GPIP P   + + V RSPHVDK SR+ 
Sbjct: 9   KIRIRLKAFDRRMLDLSCDKIIETADHTAATAIGPIPLPTKRKIYCVLRSPHVDKDSREH 68

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E R ++RL+ I  P+ +T+DALMKLD+ +GV++ +KL
Sbjct: 69  FETRTHRRLIDIFNPSSKTIDALMKLDLPSGVDIEVKL 106


>gi|288801097|ref|ZP_06406553.1| ribosomal protein S10 [Prevotella sp. oral taxon 299 str. F0039]
 gi|288332031|gb|EFC70513.1| ribosomal protein S10 [Prevotella sp. oral taxon 299 str. F0039]
          Length = 101

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 68/98 (69%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I LK++D +++D S  +IV   K +G+ + GPIP P   R FTVNRS  V+KKSR+Q
Sbjct: 4   KIRIKLKSYDHKLVDKSAEKIVKAVKATGAIVSGPIPLPTHKRIFTVNRSTFVNKKSREQ 63

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            ++  YKRL+ I   T +TVDALMKL++ +GV V IK+
Sbjct: 64  FQLSDYKRLIDIYSSTAKTVDALMKLELPSGVEVEIKV 101


>gi|313680516|ref|YP_004058255.1| SSU ribosomal protein s10p [Oceanithermus profundus DSM 14977]
 gi|313153231|gb|ADR37082.1| SSU ribosomal protein S1