PSIBLAST alignment of GI: 254780262 and protein with PDB id: 2gy9

>gi|116667419|pdb|2GY9|J Chain J, Structure Of The 30s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 Length = 96
>gi|116667471|pdb|2GYB|J Chain J, Structure Of The 30s Subunit Of A Secm-Stalled E. Coli Ribosome Complex Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1143 Length = 96
 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 55/96 (57%), Positives = 73/96 (76%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I LKAFD R++D +  EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +RDQ
Sbjct: 1   RIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDARDQ 60

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVI 102
            E+R + RL+ I++PT +TVDALM+LD+AAGV+V I
Sbjct: 61  YEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQI 96