PSIBLAST alignment of GI: 254780262 and protein with PDB id: 2zkq

gi|187609263|pdb|2ZKQ|JJ Chain j, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 119
 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 26/100 (26%), Positives = 52/100 (52%), Gaps = 2/100 (2%)

Query: 6   IRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDK-KSR 64
            RI I L + + + L+    +++   K+   ++ GP+  P    R T  ++P  +  K+ 
Sbjct: 18  HRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRITTRKTPCGEGSKTW 77

Query: 65  DQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           D+ +MRI+KRL+ +  P+ + V  +  + I  GV V + +
Sbjct: 78  DRFQMRIHKRLIDLHSPS-EIVKQITSISIEPGVEVEVTI 116