RPSBLAST alignment for GI: 254780262 and conserved domain: pfam00338

>gnl|CDD|144070 pfam00338, Ribosomal_S10, Ribosomal protein S10p/S20e. This family includes small ribosomal subunit S10 from prokaryotes and S20 from eukaryotes. Length = 97
 Score =  120 bits (303), Expect = 1e-28
 Identities = 50/95 (52%), Positives = 69/95 (72%)

Query: 10  ICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQLEM 69
           I LK++D ++L+S ++ IV   K+ G ++ GPIP P    R TV RSPHVDKKSR+Q EM
Sbjct: 3   IKLKSYDHKLLESYVKFIVEAAKRLGIKVSGPIPLPTKRLRVTVLRSPHVDKKSREQFEM 62

Query: 70  RIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           R +KRL+ I   TP+TVDAL+++D+  GV+V IKL
Sbjct: 63  RTHKRLIDIYDATPETVDALLRIDLPEGVDVEIKL 97