RPSBLAST alignment for GI: 254780262 and conserved domain: PRK12271

>gnl|CDD|183392 PRK12271, rps10p, 30S ribosomal protein S10P; Reviewed. Length = 102
 Score = 48.4 bits (116), Expect = 4e-07
 Identities = 28/96 (29%), Positives = 46/96 (47%), Gaps = 2/96 (2%)

Query: 10  ICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD-KKSRDQLE 68
           I L + +   LD    +I    +K+G  + GPIP P         +SP  +   + D  E
Sbjct: 6   IRLSSTNPEDLDEVCDQIKEIAEKTGVDMSGPIPLPTKRLVVPTRKSPDGEGTATWDHWE 65

Query: 69  MRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           MRI+KRL+  I    + +  LM++ +   V + I+L
Sbjct: 66  MRIHKRLI-DIDADERALRQLMRIRVPEDVQIEIEL 100