RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780262|ref|YP_003064675.1| 30S ribosomal protein S10 [Candidatus Liberibacter asiaticus str. psy62] (104 letters) >gnl|CDD|179076 PRK00596, rpsJ, 30S ribosomal protein S10; Reviewed. Length = 102 Score = 154 bits (392), Expect = 5e-39 Identities = 62/104 (59%), Positives = 79/104 (75%), Gaps = 2/104 (1%) Query: 1 MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60 M + IRI LKAFD R+LD S ++IV T K++G+Q+ GPIP P RFTV RSPHV+ Sbjct: 1 MAKQKIRIR--LKAFDHRLLDQSAKKIVETAKRTGAQVRGPIPLPTKKERFTVLRSPHVN 58 Query: 61 KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104 K SR+Q E+R +KRL+ I+ PTP+TVDALMKLD+ AGV+V IKL Sbjct: 59 KDSREQFEIRTHKRLIDIVDPTPKTVDALMKLDLPAGVDVEIKL 102 >gnl|CDD|130121 TIGR01049, rpsJ_bact, ribosomal protein S10, bacterial/organelle. This model describes bacterial 30S ribosomal protein S10. In species that have a transcription antitermination complex, or N utilization substance, with NusA, NusB, NusG, and NusE, this ribosomal protein is responsible for NusE activity. Included in the family are one member each from Saccharomyces cerevisiae and Schizosaccharomyces pombe. These proteins lack an N-terminal mitochondrial transit peptide but contain additional sequence C-terminal to the ribosomal S10 protein region. Length = 99 Score = 125 bits (317), Expect = 2e-30 Identities = 55/98 (56%), Positives = 76/98 (77%) Query: 7 RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66 +I I LK++D R+LD S ++IV T K++G+Q+ GPIP P R+TV RSPHV+K SR+Q Sbjct: 2 KIRIKLKSYDHRLLDQSTKKIVETAKRTGAQVKGPIPLPTKKERYTVLRSPHVNKDSREQ 61 Query: 67 LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104 E+R +KRL+ II P P+T+DALMKLD+ AGV++ IKL Sbjct: 62 FEIRTHKRLIDIIDPNPKTIDALMKLDLPAGVDIEIKL 99 >gnl|CDD|183392 PRK12271, rps10p, 30S ribosomal protein S10P; Reviewed. Length = 102 Score = 48.4 bits (116), Expect = 4e-07 Identities = 28/96 (29%), Positives = 46/96 (47%), Gaps = 2/96 (2%) Query: 10 ICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD-KKSRDQLE 68 I L + + LD +I +K+G + GPIP P +SP + + D E Sbjct: 6 IRLSSTNPEDLDEVCDQIKEIAEKTGVDMSGPIPLPTKRLVVPTRKSPDGEGTATWDHWE 65 Query: 69 MRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104 MRI+KRL+ I + + LM++ + V + I+L Sbjct: 66 MRIHKRLI-DIDADERALRQLMRIRVPEDVQIEIEL 100 >gnl|CDD|130118 TIGR01046, S10_Arc_S20_Euk, ribosomal protein S10(archaeal)/S20(eukaryotic). its equivalents in eukaryotes. Length = 99 Score = 47.8 bits (114), Expect = 5e-07 Identities = 28/99 (28%), Positives = 51/99 (51%), Gaps = 2/99 (2%) Query: 7 RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD-KKSRD 65 + I L + + R L+ +I +K+G ++ GP+P P R +SP + K+ D Sbjct: 2 KARIKLTSTNVRSLEKVCAQIKRIAEKTGVRMSGPVPLPTKRLRVPTRKSPDGEGSKTWD 61 Query: 66 QLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104 + EMRI+KRL+ I + + +M++ + V + I L Sbjct: 62 RWEMRIHKRLIDIEADE-RALRQIMRISVPEDVEIEITL 99 >gnl|CDD|173336 PTZ00039, PTZ00039, 40S ribosomal protein S20; Provisional. Length = 115 Score = 38.3 bits (89), Expect = 5e-04 Identities = 25/95 (26%), Positives = 48/95 (50%), Gaps = 2/95 (2%) Query: 7 RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD-KKSRD 65 +I I L + + + ++ +I+ K+ ++ GP+ P R T +SP + + D Sbjct: 18 KIRITLTSKNLKSIEKVCADIITGAKEKNLKVTGPVRMPVKTLRITTRKSPCGEGTNTWD 77 Query: 66 QLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNV 100 + EMRIYKR++ + + V + ++I GV V Sbjct: 78 RFEMRIYKRVIDLYS-SSDVVTQITSINIDPGVEV 111 >gnl|CDD|152031 pfam11595, DUF3245, Protein of unknown function (DUF3245). This is a family of proteins conserved in fungi. The function is not known, and there is no S. cerevisiae member. Length = 147 Score = 28.0 bits (62), Expect = 0.60 Identities = 12/49 (24%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Query: 43 PFPRSIRRFTVNRSPHV-DKKSRDQLEMRIYKRLLYIIKPTPQTVDALM 90 P P + NR+ + K R QL + YK+++ V+A Sbjct: 55 PLPTQAADGSWNRTELDSNDKLRRQLLGKNYKKVMSEKSKANAPVNAGK 103 >gnl|CDD|183907 PRK13235, nifH, nitrogenase reductase; Reviewed. Length = 274 Score = 27.5 bits (61), Expect = 0.82 Identities = 24/96 (25%), Positives = 43/96 (44%), Gaps = 12/96 (12%) Query: 10 ICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNR------SP-HVDKK 62 IC +SR +D+ I +K G+Q++ +P ++R +NR P H Sbjct: 182 IC----NSRKVDNEREMIEELARKIGTQMIHFVPRDNFVQRAEINRKTVIEYDPTHPQAD 237 Query: 63 SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGV 98 L +I + +++I P P ++ L L I G+ Sbjct: 238 EYRALARKIDENEMFVI-PKPLEIEELESLLIEFGI 272 >gnl|CDD|179750 PRK04148, PRK04148, hypothetical protein; Provisional. Length = 134 Score = 26.9 bits (60), Expect = 1.0 Identities = 11/35 (31%), Positives = 19/35 (54%), Gaps = 2/35 (5%) Query: 71 IYK--RLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103 IYK +L+Y I+P +++L V ++IK Sbjct: 74 IYKNAKLIYSIRPPRDLQPFILELAKKINVPLIIK 108 >gnl|CDD|163393 TIGR03680, eif2g_arch, translation initiation factor 2 subunit gamma. eIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA. Length = 406 Score = 26.6 bits (59), Expect = 1.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Query: 81 PTPQTVDALMKLDIAAGVNVVI 102 P PQT + LM L+I N+VI Sbjct: 118 PQPQTKEHLMALEIIGIKNIVI 139 >gnl|CDD|179703 PRK04000, PRK04000, translation initiation factor IF-2 subunit gamma; Validated. Length = 411 Score = 26.4 bits (59), Expect = 1.6 Identities = 12/22 (54%), Positives = 14/22 (63%) Query: 81 PTPQTVDALMKLDIAAGVNVVI 102 P PQT + LM LDI N+VI Sbjct: 123 PQPQTKEHLMALDIIGIKNIVI 144 >gnl|CDD|106194 PRK13232, nifH, nitrogenase reductase; Reviewed. Length = 273 Score = 26.5 bits (58), Expect = 1.6 Identities = 20/90 (22%), Positives = 41/90 (45%), Gaps = 8/90 (8%) Query: 16 DSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQLEMRIYKRL 75 +SR +D + KK GSQ++ +P ++R +NR +D + + + Y L Sbjct: 182 NSRNVDGERELLEAFAKKLGSQLIHFVPRDNIVQRAEINRKTVID-FDPESNQAKEYLTL 240 Query: 76 LY-------IIKPTPQTVDALMKLDIAAGV 98 + ++ PTP ++ L + + G+ Sbjct: 241 AHNVQNNDKLVVPTPLPMEELEAMMVEFGI 270 >gnl|CDD|183851 PRK13028, PRK13028, tryptophan synthase subunit beta; Provisional. Length = 402 Score = 26.4 bits (59), Expect = 1.6 Identities = 16/37 (43%), Positives = 24/37 (64%), Gaps = 8/37 (21%) Query: 35 GSQIVGPIPFPRSIRRF-TVNRSPHVDKKSRDQ-LEM 69 GS +VGP PFP +R F +V + +++R+Q LEM Sbjct: 196 GS-VVGPHPFPMMVRDFQSV-----IGEEAREQFLEM 226 >gnl|CDD|177753 PLN00149, PLN00149, potassium transporter; Provisional. Length = 779 Score = 26.4 bits (58), Expect = 1.9 Identities = 10/28 (35%), Positives = 18/28 (64%) Query: 41 PIPFPRSIRRFTVNRSPHVDKKSRDQLE 68 P+ P+ RF V SP +D+ +R++L+ Sbjct: 685 PVSRPKKRVRFVVPESPKIDRGAREELQ 712 >gnl|CDD|132291 TIGR03247, glucar-dehydr, glucarate dehydratase. Glucarate dehydratase converts D-glucarate (and L-idarate, a stereoisomer) to 5-dehydro-4-deoxyglucarate which is subsequently acted on by GarL, tartronate semialdehyde reductase and glycerate kinase (, GenProp0716). The E. coli enzyme has been well-characterized. Length = 441 Score = 25.2 bits (55), Expect = 4.1 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 7/42 (16%) Query: 16 DSRILDSS-------MREIVLTTKKSGSQIVGPIPFPRSIRR 50 DS +L+ S R IV+ T SG+ VG +P IR Sbjct: 18 DSMLLNLSGAHAPFFTRNIVILTDSSGNTGVGEVPGGEKIRA 59 >gnl|CDD|178822 PRK00048, PRK00048, dihydrodipicolinate reductase; Provisional. Length = 257 Score = 24.7 bits (55), Expect = 5.2 Identities = 5/21 (23%), Positives = 10/21 (47%) Query: 82 TPQTVDALMKLDIAAGVNVVI 102 TP+ ++ + G +VI Sbjct: 69 TPEATLENLEFALEHGKPLVI 89 >gnl|CDD|184583 PRK14237, PRK14237, phosphate transporter ATP-binding protein; Provisional. Length = 267 Score = 24.3 bits (53), Expect = 6.6 Identities = 11/30 (36%), Positives = 16/30 (53%), Gaps = 3/30 (10%) Query: 41 PIPFPRSIRR---FTVNRSPHVDKKSRDQL 67 P PF +SI F + R+ DKK D++ Sbjct: 110 PNPFAKSIYENITFALERAGVKDKKVLDEI 139 >gnl|CDD|149066 pfam07796, DUF1638, Protein of unknown function (DUF1638). This family contains sequences covering an approximately 270 amino acid stretch of a group of hypothetical proteins. These proteins are expressed by archaeal species of the Methanosarcina genus. Length = 166 Score = 24.5 bits (54), Expect = 6.8 Identities = 11/52 (21%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Query: 46 RSIRRFTVNRSPHVDKKSRDQLEMRIYKRLLYIIKPTPQTVDALMKL-DIAA 96 R F + R + Y++++YI QT D K + A Sbjct: 92 RQWDAFVIKRLGLDRHPELRDMYFGHYRKVVYIDTGLYQTDDFEAKAREFAD 143 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.326 0.139 0.393 Gapped Lambda K H 0.267 0.0704 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,644,138 Number of extensions: 90561 Number of successful extensions: 242 Number of sequences better than 10.0: 1 Number of HSP's gapped: 239 Number of HSP's successfully gapped: 27 Length of query: 104 Length of database: 5,994,473 Length adjustment: 71 Effective length of query: 33 Effective length of database: 4,460,305 Effective search space: 147190065 Effective search space used: 147190065 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 50 (23.1 bits)