RPS-BLAST 2.2.22 [Sep-27-2009]

Database: mmdb70 
           33,805 sequences; 4,956,049 total letters

Searching..................................................done

Query= gi|254780262|ref|YP_003064675.1| 30S ribosomal protein S10
[Candidatus Liberibacter asiaticus str. psy62]
         (104 letters)



>3i1m_J 30S ribosomal protein S10; ribosome structure, protein-RNA
           complex, ribonucleoprotein, ribosomal protein,
           RNA-binding, rRNA-binding, antibiotic resistance; 3.19A
           {Escherichia coli k-12} PDB: 1p6g_J 1p87_J* 1vs7_J*
           2avy_J 2aw7_J 1vs5_J 2i2u_J 2i2p_J* 2qan_J* 2qb9_J*
           2qbb_J* 2qbd_J 2qbf_J 2qbh_J* 2qbj_J* 2qou_J* 2qow_J*
           2qoy_J* 2qp0_J* 2vho_J ... (J:)
          Length = 103

 Score =  107 bits (269), Expect = 6e-25
 Identities = 56/98 (57%), Positives = 74/98 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I LKAFD R++D +  EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +RDQ
Sbjct: 5   RIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDARDQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R + RL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 65  YEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISL 102


>2vqe_J 30S ribosomal protein S10, 30S ribosomal protein S6;
           tRNA-binding, rRNA-binding, metal-binding, zinc-finger,
           translation; HET: TM2 PAR; 2.5A {Thermus thermophilus}
           (J:)
          Length = 105

 Score =  106 bits (267), Expect = 8e-25
 Identities = 44/98 (44%), Positives = 64/98 (65%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I L+ FD + LD+S ++IV   ++SG+Q+ GPIP P  +RRFTV R P   K SR+ 
Sbjct: 3   KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREH 62

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R + RL+ II P  +T++ LM LD+  GV + IK 
Sbjct: 63  FELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT 100


>3bbn_J Ribosomal protein S10; small ribosomal subunit, spinach
           chloroplast ribosome, ribonucleoprotein particle,
           macromolecular complex; 9.40A {Mesembryanthemum
           crystallinum} (J:)
          Length = 197

 Score =  103 bits (258), Expect = 7e-24
 Identities = 38/98 (38%), Positives = 67/98 (68%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I L+++   +++ S ++I+   + + ++ +GP+P P   R F V +SPHV K +R  
Sbjct: 100 KIRIKLRSYWVPLIEDSCKQIMDAARTTNAKTMGPVPLPTKKRIFCVLKSPHVHKDARFH 159

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R ++RL+ I+ PT QT+D+LM+LD+ AGV+V +KL
Sbjct: 160 FEIRTHQRLIDILYPTAQTIDSLMQLDLPAGVDVEVKL 197


>2zkq_j 40S ribosomal protein S20E; protein-RNA complex, 40S
           ribosomal subunit, ribosomal protein/RNA complex; 8.70A
           {Canis familiaris} (j:)
          Length = 119

 Score = 99.5 bits (248), Expect = 2e-22
 Identities = 25/99 (25%), Positives = 49/99 (49%), Gaps = 2/99 (2%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHV-DKKSRD 65
           RI I L + + + L+    +++   K+   ++ GP+  P    R T  ++P     K+ D
Sbjct: 19  RIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRITTRKTPCGEGSKTWD 78

Query: 66  QLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           + +MRI+KRL+  +    + V  +  + I  GV V + +
Sbjct: 79  RFQMRIHKRLID-LHSPSEIVKQITSISIEPGVEVEVTI 116


>3jyv_J 40S ribosomal protein S20; eukaryotic ribosome, RACK1
           protein, flexible fitting; HET: 2MG H2U M2G OMC OMG YYG
           PSU 5MC 7MG 5MU 1MA; 8.90A {Thermomyces lanuginosus}
           PDB: 1s1h_J (J:)
          Length = 96

 Score = 96.7 bits (241), Expect = 8e-22
 Identities = 23/97 (23%), Positives = 49/97 (50%), Gaps = 2/97 (2%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD-KKSRD 65
           +I I L +   + L++    IV   ++      GP+  P  + + +  ++P+ +  K+ +
Sbjct: 1   KIRITLTSTKVKQLENVSSNIVKNAEQHNLVKKGPVRLPTKVLKISTRKTPNGEGSKTWE 60

Query: 66  QLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVI 102
             EMRI+KR +  ++   Q V  + ++ I  GV+V +
Sbjct: 61  TYEMRIHKRYID-LEAPVQIVKRITQITIEPGVDVEV 96


>3d3b_J 30S ribosomal protein S10, N utilization substance protein
           B; NUSB, NUSE, NUT site, phage lambda, lambdan
           antitermination; HET: NHE; 1.30A {Escherichia coli K12}
           PDB: 3imq_J 3d3c_J (J:)
          Length = 87

 Score = 76.2 bits (188), Expect = 1e-15
 Identities = 43/98 (43%), Positives = 58/98 (59%), Gaps = 21/98 (21%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I LKAFD R++D +  EIV T K++G+Q+ GPIP P                     
Sbjct: 10  RIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPT-------------------- 49

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
              R + RL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 50  -RSRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISL 86


>2pc4_A 41 kDa antigen, fructose-bisphosphate aldolase; invasion
           machinery, structural genomics, PSI, protein structure
           initiative; 2.40A {Plasmodium falciparum} PDB: 2eph_A
           1a5c_A (A:)
          Length = 369

 Score = 28.8 bits (64), Expect = 0.25
 Identities = 11/38 (28%), Positives = 18/38 (47%)

Query: 23  SMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           S R+++  TK  G  I G I F  ++ +      P V+
Sbjct: 64  SYRDLLFGTKGLGKFISGAILFEETLFQKNEAGVPMVN 101


>2qap_A Fructose-1,6-bisphosphate aldolase; beta barrel, C-teminal
           tail, lyase; 1.59A {Leishmania mexicana} (A:)
          Length = 391

 Score = 28.0 bits (62), Expect = 0.50
 Identities = 6/38 (15%), Positives = 13/38 (34%)

Query: 23  SMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
             R ++L  +     I G I    ++ +   N     +
Sbjct: 87  QYRALMLEAEGFEQYISGVILHDETVGQKASNGQTFPE 124


>2pff_A Fatty acid synthase subunit alpha,
          3-oxoacyl-[acyl-carrier-; fatty acid synthase,
          acyl-carrier-protein, beta-ketoacyl reductase,
          beta-ketoacyl synthase, dehydratase; 4.00A
          {Saccharomyces cerevisiae} (A:1221-1330,A:1541-1688)
          Length = 258

 Score = 27.9 bits (62), Expect = 0.53
 Identities = 10/45 (22%), Positives = 18/45 (40%), Gaps = 14/45 (31%)

Query: 28 VLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSR-DQLEMRI 71
          +LTT +   +    + +           SP+++ K R  QL  R 
Sbjct: 6  ILTTAR---EHHSSVKYA----------SPNLNMKYRKRQLVTRE 37


>1y7l_A O-acetylserine sulfhydrylase, O-acetylserine (thiol)-lyase;
           X-RAY crystallography, sulfhydrylase; HET: LLP; 1.55A
           {Haemophilus influenzae} (A:1-38,A:144-316)
          Length = 211

 Score = 27.7 bits (61), Expect = 0.62
 Identities = 13/37 (35%), Positives = 17/37 (45%), Gaps = 6/37 (16%)

Query: 69  MRIYKRLLYIIKPTPQTVDALMKLD-IAAGVNVVIKL 104
           M IY    Y I  TP     L++L       NVV+K+
Sbjct: 1   MAIYADNSYSIGNTP-----LVRLKHFGHNGNVVVKI 32


>3kx6_A Fructose-bisphosphate aldolase; ssgcid, NIH, niaid, SBRI,
           UW, emerald biostructures, glycolysis, lyase, structural
           genomics; HET: CIT; 2.10A {Babesia bovis} (A:)
          Length = 379

 Score = 27.3 bits (60), Expect = 0.74
 Identities = 13/38 (34%), Positives = 17/38 (44%)

Query: 23  SMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
             R I+ TTK  G  I G I F  ++ +   N    VD
Sbjct: 76  EYRSILFTTKGLGKYISGCILFEETLFQQAPNGQNMVD 113


>2q3b_A Cysteine synthase A; pyridoxal-5'-phosphate, sulphur
           metabolism, cysteine biosynthesis, transferase; HET:
           LLP; 1.80A {Mycobacterium tuberculosis} PDB: 2q3c_A*
           2q3d_A* (A:1-43,A:149-313)
          Length = 208

 Score = 25.4 bits (55), Expect = 2.8
 Identities = 10/36 (27%), Positives = 18/36 (50%), Gaps = 2/36 (5%)

Query: 69  MRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           M I + +  +I  TP  +  L ++   A  ++V KL
Sbjct: 4   MSIAEDITQLIGRTP--LVRLRRVTDGAVADIVAKL 37


>2q1f_A Chondroitinase; alpha plus beta, lyase; 2.85A {Bacteroides
           thetaiotaomicron} (A:867-1022)
          Length = 156

 Score = 25.2 bits (55), Expect = 3.2
 Identities = 8/42 (19%), Positives = 11/42 (26%)

Query: 50  RFTVNRSPHVDKKSRDQLEMRIYKRLLYIIKPTPQTVDALMK 91
                 S     K   + E  IY R     +     V   +K
Sbjct: 68  ALYRGPSDEAFDKDGKRXERSIYSRPWIDNESGEIPVTVTLK 109


  Database: mmdb70
    Posted date:  Jun 20, 2010  3:12 AM
  Number of letters in database: 4,956,049
  Number of sequences in database:  33,805
  
Lambda     K      H
   0.326    0.139    0.393 

Gapped
Lambda     K      H
   0.267   0.0565    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33805
Number of Hits to DB: 749,735
Number of extensions: 28959
Number of successful extensions: 90
Number of sequences better than 10.0: 1
Number of HSP's gapped: 87
Number of HSP's successfully gapped: 16
Length of query: 104
Length of database: 4,956,049
Length adjustment: 61
Effective length of query: 43
Effective length of database: 2,893,944
Effective search space: 124439592
Effective search space used: 124439592
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 50 (23.4 bits)