RPS-BLAST 2.2.22 [Sep-27-2009]

Database: scop70_1_75 
           13,730 sequences; 2,407,596 total letters

Searching..................................................done

Query= gi|254780262|ref|YP_003064675.1| 30S ribosomal protein S10
[Candidatus Liberibacter asiaticus str. psy62]
         (104 letters)



>d2qalj1 d.58.15.1 (J:5-102) Ribosomal protein S10 {Escherichia coli
           [TaxId: 562]}
          Length = 98

 Score =  122 bits (309), Expect = 7e-30
 Identities = 56/98 (57%), Positives = 74/98 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I LKAFD R++D +  EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +RDQ
Sbjct: 1   RIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDARDQ 60

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R + RL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 61  YEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISL 98


>d2uubj1 d.58.15.1 (J:3-100) Ribosomal protein S10 {Thermus
           thermophilus [TaxId: 274]}
          Length = 98

 Score =  122 bits (308), Expect = 7e-30
 Identities = 44/97 (45%), Positives = 64/97 (65%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I L+ FD + LD+S ++IV   ++SG+Q+ GPIP P  +RRFTV R P   K SR+ 
Sbjct: 1   KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREH 60

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIK 103
            E+R + RL+ II P  +T++ LM LD+  GV + IK
Sbjct: 61  FELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIK 97


>d1a5ca_ c.1.10.1 (A:) Fructose-1,6-bisphosphate aldolase
           {Plasmodium falciparum [TaxId: 5833]}
          Length = 342

 Score = 29.6 bits (66), Expect = 0.075
 Identities = 16/73 (21%), Positives = 30/73 (41%), Gaps = 8/73 (10%)

Query: 11  CLKAFDSRILDSS------MREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD--KK 62
             K FD+  L+++       R+++  TK  G  I G I F  ++ +      P V+    
Sbjct: 33  IKKRFDNIKLENTIENRASYRDLLFGTKGLGKFISGAILFEETLFQKNEAGVPMVNLLHN 92

Query: 63  SRDQLEMRIYKRL 75
                 +++ K L
Sbjct: 93  ENIIPGIKVDKGL 105


>d2qapa1 c.1.10.1 (A:1-357) Fructose-1,6-bisphosphate aldolase
           {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
          Length = 357

 Score = 24.6 bits (53), Expect = 2.2
 Identities = 9/54 (16%), Positives = 18/54 (33%), Gaps = 6/54 (11%)

Query: 13  KAFDSRILDSS------MREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           K F    L ++       R ++L  +     I G I    ++ +   N     +
Sbjct: 51  KRFQPIGLSNTEEHRRQYRALMLEAEGFEQYISGVILHDETVGQKASNGQTFPE 104


>d1mqsa_ e.25.1.1 (A:) Sly1P protein {Baker's yeast (Saccharomyces
           cerevisiae) [TaxId: 4932]}
          Length = 653

 Score = 23.5 bits (50), Expect = 5.6
 Identities = 4/16 (25%), Positives = 10/16 (62%)

Query: 76  LYIIKPTPQTVDALMK 91
           +Y + PT + +D ++ 
Sbjct: 90  IYFVSPTKENIDIIVN 105


  Database: scop70_1_75
    Posted date:  Mar 27, 2010  6:21 PM
  Number of letters in database: 2,407,596
  Number of sequences in database:  13,730
  
Lambda     K      H
   0.326    0.139    0.393 

Gapped
Lambda     K      H
   0.267   0.0703    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 13730
Number of Hits to DB: 371,844
Number of extensions: 15086
Number of successful extensions: 40
Number of sequences better than 10.0: 1
Number of HSP's gapped: 40
Number of HSP's successfully gapped: 8
Length of query: 104
Length of database: 2,407,596
Length adjustment: 65
Effective length of query: 39
Effective length of database: 1,515,146
Effective search space: 59090694
Effective search space used: 59090694
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 47 (21.9 bits)