HHsearch alignment for GI: 254780263 and conserved domain: COG0486

>COG0486 ThdF Predicted GTPase [General function prediction only].
Probab=99.36  E-value=6.4e-12  Score=92.99  Aligned_cols=154  Identities=23%  Similarity=0.221  Sum_probs=102.7

Q ss_pred             CCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCC---CHHHHH
Q ss_conf             88279999904689887899999987644420013126868698629206378999821990899984787---302467
Q gi|254780263|r   10 KESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPG---HADYVK   86 (392)
Q Consensus        10 k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PG---H~~f~~   86 (392)
T Consensus       215 r~G~kvvIiG~PNvGKSSLLNaL~~~d~AI-----VTd------I~GTTRDviee~i~i~G~pv~l~DTAGiRet~d~VE  283 (454)
T COG0486         215 REGLKVVIIGRPNVGKSSLLNALLGRDRAI-----VTD------IAGTTRDVIEEDINLNGIPVRLVDTAGIRETDDVVE  283 (454)
T ss_pred             HCCCEEEEECCCCCCHHHHHHHHHCCCCEE-----ECC------CCCCCCCEEEEEEEECCEEEEEEECCCCCCCCCHHH
T ss_conf             458649998799886799999886678667-----428------999741037899998988999985677666734899


Q ss_pred             H--H---HHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEE
Q ss_conf             7--9---8774002331452012344332106778888631876023310023335612221101232100111014532
Q gi|254780263|r   87 N--M---ITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSD  161 (392)
Q Consensus        87 ~--m---i~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~  161 (392)
T Consensus       284 ~iGIeRs~~~i~~ADlvL~v~D~~~~~~~~d~~~~~-~~~~~-~~~i~v~NK~DL~~~~~----~-~~~-------~~~~  349 (454)
T COG0486         284 RIGIERAKKAIEEADLVLFVLDASQPLDKEDLALIE-LLPKK-KPIIVVLNKADLVSKIE----L-ESE-------KLAN  349 (454)
T ss_pred             HHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHH-HCCCC-CCEEEEEECHHCCCCCC----C-CHH-------HCCC
T ss_conf             999999999998599899997088777601177887-24368-97799996021156432----1-012-------0267


Q ss_pred             EEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCC
Q ss_conf             2102331146764114445652123320344310252
Q gi|254780263|r  162 DTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIP  198 (392)
Q Consensus       162 ~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~  198 (392)
T Consensus       350 ~~~~i~iSa~t~----------~Gl~~L~~~i~~~~~  376 (454)
T COG0486         350 GDAIISISAKTG----------EGLDALREAIKQLFG  376 (454)
T ss_pred             CCCEEEEEECCC----------CCHHHHHHHHHHHHH
T ss_conf             882699982576----------579999999999986