HHsearch alignment for GI: 254780263 and conserved domain: COG0532

>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis].
Probab=97.49  E-value=6.9e-05  Score=49.36  Aligned_cols=82  Identities=16%  Similarity=0.335  Sum_probs=68.1

Q ss_pred             EECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCEEECHH
Q ss_conf             00000013554454301487424534896799950687432125412100121144321001366641124543220211
Q gi|254780263|r  210 MHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGR  289 (392)
Q Consensus       210 ~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi~~~di~rGd  289 (392)
T Consensus       416 a~~r~v~~~~k~g~IaG~~V~~G~ikr~~~v~~~rd~~vi~~G~i~sLk~~kddv~ev~~G~ecgI~i~~--~~di~~gD  493 (509)
T COG0532         416 AEVRAVFKLPKVGAIAGCMVTEGVIKRGAPVRVVRDGVVIYEGEVESLKRFKDDVKEVRKGQECGIAIEN--YRDIKEGD  493 (509)
T ss_pred             EEEEEEEECCCCCEEEEEEEECCEEECCCCEEEEECCEEEEEEEEEEEECCCCCHHHHCCCCEEEEEECC--CCCCCCCC
T ss_conf             6788999848997399999865789459807997389089844886412467647672168679999247--56589887


Q ss_pred             EEEC
Q ss_conf             7732
Q gi|254780263|r  290 VVCA  293 (392)
Q Consensus       290 vl~~  293 (392)
T Consensus       494 ~le~  497 (509)
T COG0532         494 ILEV  497 (509)
T ss_pred             EEEE
T ss_conf             7999