HHsearch alignment for GI: 254780263 and conserved domain: COG1100

>COG1100 GTPase SAR1 and related small G proteins [General function prediction only].
Probab=98.72  E-value=8e-08  Score=67.57  Aligned_cols=116  Identities=20%  Similarity=0.185  Sum_probs=74.5

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECC--CEEEEEEECCCCHHHHHHHHH
Q ss_conf             799999046898878999999876444200131268686986292063789998219--908999847873024677987
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETD--KRFYSHIDCPGHADYVKNMIT   90 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~--~~~i~iiD~PGH~~f~~~mi~   90 (392)
T Consensus         6 ~kivv~G~~g~GKTtl~~~l~~~~~~------------~~~~~t~~~~~~~~~~~~~~~~~~~~~~Dt~gq~~~~~~~~~   73 (219)
T COG1100           6 FKIVVLGDGGVGKTTLLNRLVGDEFP------------EGYPPTIGNLDPAKTIEPYRRNIKLQLWDTAGQEEYRSLRPE   73 (219)
T ss_pred             EEEEEECCCCCCHHHHHHHHHCCCCC------------CCCCCCEEECCCCCEEECCCCCEEEEEEECCCHHHHHHHHHH
T ss_conf             79999999999889999999647676------------556761454043203622666002676767986999998875


Q ss_pred             HHHCCCCEEEEECCCC--CCCCCHHHHHHHHHHC---CCCCEEEEECCCCCCCCHH
Q ss_conf             7400233145201234--4332106778888631---8760233100233356122
Q gi|254780263|r   91 GATQADGAILVCAAED--GPKPQTREHILLARQI---GISSIVVYMNKVDAVDDDE  141 (392)
Q Consensus        91 g~~~~D~ailvVda~~--G~~~QT~eh~~l~~~l---gi~~iIv~iNKmD~v~~~~  141 (392)
T Consensus        74 y~~~~~~~l~~~d~~~~~~~~~~~~~~~~~l~~~~~~~~~-iilv~nK~Dl~~~~~  128 (219)
T COG1100          74 YYRGANGILIVYDSTLRESSDELTEEWLEELRELAPDDVP-ILLVGNKIDLFDEQS  128 (219)
T ss_pred             CCCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCE-EEEECCCCCCCCCHH
T ss_conf             0438978999997620565788999999999874668867-999697610554301