HHsearch alignment for GI: 254780263 and conserved domain: COG3276

>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis].
Probab=100.00  E-value=0  Score=464.40  Aligned_cols=335  Identities=29%  Similarity=0.475  Sum_probs=288.6

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHHHHHHHH
Q ss_conf             99999046898878999999876444200131268686986292063789998219908999847873024677987740
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMITGAT   93 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~mi~g~~   93 (392)
T Consensus         2 ii~t~GhidHgkT~L~~altg~---------~~d~l~EekKRG~TiDlg~~y~~~~d~~~~fIDvpgh~~~i~~miag~~   72 (447)
T COG3276           2 IIGTAGHIDHGKTTLLKALTGG---------VTDRLPEEKKRGITIDLGFYYRKLEDGVMGFIDVPGHPDFISNLLAGLG   72 (447)
T ss_pred             EEEEEEEEECCCHHHHHHHCCC---------CCCCCHHHHHCCCEEEEEEEECCCCCCCEEEEECCCCHHHHHHHHHHHC
T ss_conf             6997400201430223330255---------3320545661584684205732577773688618984788999985405


Q ss_pred             CCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECCCCEEEEE
Q ss_conf             02331452012344332106778888631876023310023335612221101232100111014532210233114676
Q gi|254780263|r   94 QADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIRGSALCA  173 (392)
Q Consensus        94 ~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii~~sa~~g  173 (392)
T Consensus        73 ~~d~alLvV~~deGl~~qtgEhL~iLdllgi~~giivltk~D~~d~~r~e~----~i~~Il~~l~-l~~~~i~~~s~~~g  147 (447)
T COG3276          73 GIDYALLVVAADEGLMAQTGEHLLILDLLGIKNGIIVLTKADRVDEARIEQ----KIKQILADLS-LANAKIFKTSAKTG  147 (447)
T ss_pred             CCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHH----HHHHHHHHCC-CCCCCCCCCCCCCC
T ss_conf             774589998475576643688999998619873289996223446788999----9999986502-00032301101257


Q ss_pred             EECCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEE
Q ss_conf             41144456521233203443102522221000011000000013554454301487424534896799950687432125
Q gi|254780263|r  174 LQGTNKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVK  253 (392)
Q Consensus       174 ~~~~n~~~~~~~~~~Ll~~i~~~~~~p~~~~~~p~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~k  253 (392)
T Consensus       148 ----------~Gi~~Lk~~l~~L~~~~e~d~~~~fri~IDraFtVKGvGTVVtGtv~sG~V~v~D~L~l~p~~---k~v~  214 (447)
T COG3276         148 ----------RGIEELKNELIDLLEEIERDEQKPFRIAIDRAFTVKGVGTVVTGTVLSGEVKVGDKLYLSPIN---KEVR  214 (447)
T ss_pred             ----------CCHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEEEECCCCEEEEEEEEEEEEEECCEEEEECCC---CEEE
T ss_conf             ----------877999999987520055404786599975579951331799867864358878889990589---7689


Q ss_pred             EECCCCCCCCCCCCCCCHHHHHHHCCCCCCEEECHHEEECCCCCCCCEEEEEEEEEEECCCCCCCCCCCCCCEEEEEECC
Q ss_conf             41210012114432100136664112454322021177326777630001689997105678755551159789999541
Q gi|254780263|r  254 CTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGSIQEYSRFRASVYILTASEGGRTTGFMDNYRPQFFMDT  333 (392)
Q Consensus       254 v~si~~~~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~~~~~~~~~f~A~i~il~~~~~~~~~~~~~~~~~~~~~~~  333 (392)
T Consensus       215 VRsIq~~d~d~~~a~AG~RVglaL~~v~~eei~RG~~L~~~~~~~v~~~~~~~~~i~~~----~~~~l~~~~~~hi~~g~  290 (447)
T COG3276         215 VRSIQAHDVDVEEAKAGQRVGLALKGVEKEEIERGDWLLKPEPLEVTTRLIVELEIDPL----FKKTLKQGQPVHIHVGL  290 (447)
T ss_pred             EEEEEECCCCHHHCCCCCEEEEECCCCCHHHHHCCCEECCCCCCCCCEEEEEEEEECCC----CCCCCCCCCEEEEEEEC
T ss_conf             98632068645550122514542378877885112275157777762489999871401----03245789538999813


Q ss_pred             EEEEEEEEECCCHHHHCCCCEEEEEEEECCCEEECCCCEEEEEECC--EEEEEEEEEE
Q ss_conf             4777999961895570789769999997781775469849999899--6999899955
Q gi|254780263|r  334 ADVTGRIILSPGSQAVMPGDRVDLEVELIYPIAMEPNQTFSMREGG--KTVGAGLILE  389 (392)
Q Consensus       334 ~~v~~~i~~~~~~~~i~~g~~~~v~l~l~~pi~~e~~~rfilRd~~--~tig~G~I~~  389 (392)
T Consensus       291 ~~~~~~i~~l~~~----------~~l~~~k~i~~~~~~~l~lr~~~a~~~~~g~rvl~  338 (447)
T COG3276         291 RSVTGRIVPLEKN----------AELNLVKPIALGDNDRLVLRDNSAVIKLAGARVLS  338 (447)
T ss_pred             CCCCEEEEECCCC----------CEEEEECCCCCCCCCEEEEECCCCEEEECCCEEEE
T ss_conf             5663576531465----------40455045455657459997266135633645985