HHsearch alignment for GI: 254780263 and conserved domain: KOG0076

>KOG0076 consensus.
Probab=97.79  E-value=4.5e-05  Score=50.54  Aligned_cols=169  Identities=21%  Similarity=0.221  Sum_probs=96.3

Q ss_pred             HCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHH
Q ss_conf             10388279999904689887899999987644420013126868698629206378999821990899984787302467
Q gi|254780263|r    7 VRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVK   86 (392)
Q Consensus         7 ~~~k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~   86 (392)
T Consensus        12 ~~~Ke~y~vlIlgldnAGKttfLe~~Kt~~~~~~~~---l~--~~ki~--~tvgLnig~i~v~~~~l~fwdlgGQe~l-r   83 (197)
T KOG0076          12 MFKKEDYSVLILGLDNAGKTTFLEALKTDFSKAYGG---LN--PSKIT--PTVGLNIGTIEVCNAPLSFWDLGGQESL-R   83 (197)
T ss_pred             HHHHHHHHHEEECCCCCCCHHHHHHHHHHHHHHHCC---CC--HHHEE--CCCCEEECCEEECCCEEEEEECCCHHHH-H
T ss_conf             750320310024244578520898877788765168---88--88810--1224031316412541677886780878-9


Q ss_pred             HHHHHH-HCCCCEEEEECCCCCC-C----CCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEE---EE
Q ss_conf             798774-0023314520123443-3----2106778888631876023310023335612221101232100111---01
Q gi|254780263|r   87 NMITGA-TQADGAILVCAAEDGP-K----PQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLK---EH  157 (392)
Q Consensus        87 ~mi~g~-~~~D~ailvVda~~G~-~----~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~---~~  157 (392)
T Consensus        84 Slw~~yY~~~H~ii~viDa~~~eR~~~~~t~~~~v~~~E~leg~p-~L~lankqd~q~~~~~~-----El~~~~~~~e~~  157 (197)
T KOG0076          84 SLWKKYYWLAHGIIYVIDATDRERFEESKTAFEKVVENEKLEGAP-VLVLANKQDLQNAMEAA-----ELDGVFGLAELI  157 (197)
T ss_pred             HHHHHHHHHHCEEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCC-HHHHCCHHHHHHHHHHH-----HHHHHHHHHHHC
T ss_conf             999999997263477641777788888799999999878762871-54340043303056689-----898774266536


Q ss_pred             EEEEEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCC
Q ss_conf             453221023311467641144456521233203443102
Q gi|254780263|r  158 KYSDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDTH  196 (392)
Q Consensus       158 ~~~~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~  196 (392)
T Consensus       158 ~-~rd~~~~pvSal~ge---gv---~egi~w~v~~~~kn  189 (197)
T KOG0076         158 P-RRDNPFQPVSALTGE---GV---KEGIEWLVKKLEKN  189 (197)
T ss_pred             C-CCCCCCCCCHHHHCC---CH---HHHHHHHHHHHHHC
T ss_conf             8-865764421454055---67---78899999998623