HHsearch alignment for GI: 254780263 and conserved domain: KOG0447

>KOG0447 consensus.
Probab=94.59  E-value=0.3  Score=26.83  Aligned_cols=127  Identities=20%  Similarity=0.299  Sum_probs=66.3

Q ss_pred             CEE-EEEEEECCCCCHHHHHHHHHHH--HHH-----------------------HHH-CCCCCCCCHH--------H---
Q ss_conf             827-9999904689887899999987--644-----------------------420-0131268686--------9---
Q gi|254780263|r   11 ESL-GLSTIGHVDHGKTTLTAAITKY--YSE-----------------------EKK-EYGDIDSAPE--------E---   52 (392)
Q Consensus        11 ~~~-ni~~iGhvd~GKSTL~~~L~~~--~~~-----------------------~~~-~~~~~D~~~~--------E---   52 (392)
T Consensus       306 DhLPRVVVVGDQSaGKTSVLEmiAqARIFPRGSGEMMTRaPVKVTLsEGPyHVAqFrDSsREfDLTKE~DLq~LR~e~E~  385 (980)
T KOG0447         306 DHLPRVVVVGDQSAGKTSVLEMIAQARIFPRGSGEMMTRSPVKVTLSEGPHHVALFKDSSREFDLTKEEDLAALRHEIEL  385 (980)
T ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHCCCCCCCCCEECCCCEEEEECCCCCHHHHHCCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             46862799756666622899999874307688853100377478814686034542465422465415579999888889


Q ss_pred             -----HHCCCEEEEEEEEEECCC---EEEEEEECCCCHH--------HHHHHHHHHH-----CCCCEEEEEC-CC-CCCC
Q ss_conf             -----862920637899982199---0899984787302--------4677987740-----0233145201-23-4433
Q gi|254780263|r   53 -----KLRGITIATAHVSYETDK---RFYSHIDCPGHAD--------YVKNMITGAT-----QADGAILVCA-AE-DGPK  109 (392)
Q Consensus        53 -----~~rGiTi~~~~~~~~~~~---~~i~iiD~PGH~~--------f~~~mi~g~~-----~~D~ailvVd-a~-~G~~  109 (392)
T Consensus       386 RMr~sVr~GkTVSnEvIsltVKGPgLqRMVLVDLPGvIsTvT~dMA~dTKd~I~~msKayM~NPNAIILCIQDGSVDAER  465 (980)
T KOG0447         386 RMRKNVKEGCTVSPETISLNVKGPGLQRMVLVDLPGVINTVTSGMAPDTKETIFSISKAYMQNPNAIILCIQDGSVDAER  465 (980)
T ss_pred             HHHHCCCCCCCCCCCEEEEEECCCCCCEEEEECCCCHHHHHCCCCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCHHH
T ss_conf             98850357851451216897218996236886377325440023464316779999999745998389995168730555


Q ss_pred             CCHHHHHHHHHHCCCCCEEEEECCCCCCC
Q ss_conf             21067788886318760233100233356
Q gi|254780263|r  110 PQTREHILLARQIGISSIVVYMNKVDAVD  138 (392)
Q Consensus       110 ~QT~eh~~l~~~lgi~~iIv~iNKmD~v~  138 (392)
T Consensus       466 SnVTDLVsq~DP~GrR-TIfVLTKVDlAE  493 (980)
T KOG0447         466 SIVTDLVSQMDPHGRR-TIFVLTKVDLAE  493 (980)
T ss_pred             HHHHHHHHHCCCCCCE-EEEEEEECCHHH
T ss_conf             1388898713877873-699985111564