HHsearch alignment for GI: 254780263 and conserved domain: KOG0463

>KOG0463 consensus.
Probab=100.00  E-value=0  Score=379.03  Aligned_cols=359  Identities=24%  Similarity=0.350  Sum_probs=296.0

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCC--CCCCHHHHHCCCEEEEEEE-------------------EEEC---
Q ss_conf             799999046898878999999876444200131--2686869862920637899-------------------9821---
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGD--IDSAPEEKLRGITIATAHV-------------------SYET---   68 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~--~D~~~~E~~rGiTi~~~~~-------------------~~~~---   68 (392)
T Consensus       134 ~RVAVVGNVDAGKSTLLGVLTHgeLDnGRG~ARqkLFRHKHEiESGRTSSVGNDILGFD~~GNvVNKPD~Hg~~LdWvkI  213 (641)
T KOG0463         134 ARVAVVGNVDAGKSTLLGVLTHGELDNGRGAARQKLFRHKHEIESGRTSSVGNDILGFDVHGNVVNKPDPHGHNLDWVKI  213 (641)
T ss_pred             EEEEEEECCCCCCCEEEEEEEECCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCEEE
T ss_conf             79899712247722167665304434672277887765223103675445566202002546421588988886431343


Q ss_pred             ---CCEEEEEEECCCCHHHHHHHHHHHHC--CCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHH
Q ss_conf             ---99089998478730246779877400--2331452012344332106778888631876023310023335612221
Q gi|254780263|r   69 ---DKRFYSHIDCPGHADYVKNMITGATQ--ADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELL  143 (392)
Q Consensus        69 ---~~~~i~iiD~PGH~~f~~~mi~g~~~--~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~  143 (392)
T Consensus       214 ce~saKviTFIDLAGHEkYLKTTvFGMTGH~PDf~MLMiGaNaGIiGmTKEHLgLALaL~VPV-fvVVTKIDMCPANiLq  292 (641)
T KOG0463         214 CEDSAKVITFIDLAGHEKYLKTTVFGMTGHMPDFTMLMIGANAGIIGMTKEHLGLALALHVPV-FVVVTKIDMCPANILQ  292 (641)
T ss_pred             CCCCCEEEEEEECCCHHHHHHEEEECCCCCCCCCEEEEECCCCCCEECCHHHHHHHHHHCCCE-EEEEEEECCCCHHHHH
T ss_conf             136422689886154155231144103367887258985166651114477654556426857-9999850558178999


Q ss_pred             HHCCCCCCEEEEEEEEE--------------------E--EEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCC-C
Q ss_conf             10123210011101453--------------------2--21023311467641144456521233203443102522-2
Q gi|254780263|r  144 DISEYEIRDLLKEHKYS--------------------D--DTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPT-P  200 (392)
Q Consensus       144 ~~i~~~i~~~l~~~~~~--------------------~--~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~-p  200 (392)
T Consensus       293 EtmK-ll~rllkS~gcrK~PvlVrs~DDVv~~A~NF~Ser~CPIFQvSNVt---G~N--------L~LLkmFLNlls~R~  360 (641)
T KOG0463         293 ETMK-LLTRLLKSPGCRKLPVLVRSMDDVVHAAVNFPSERVCPIFQVSNVT---GTN--------LPLLKMFLNLLSLRR  360 (641)
T ss_pred             HHHH-HHHHHHCCCCCCCCCEEEECCCCEEEEECCCCCCCCCCEEEECCCC---CCC--------HHHHHHHHHHCCCCC
T ss_conf             9999-9999862877650757885156447861358621235407861566---778--------389999986437445


Q ss_pred             CCCCCCCCCEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEE-CCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCC
Q ss_conf             21000011000000013554454301487424534896799950-68743212541210012114432100136664112
Q gi|254780263|r  201 QRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIG-MGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRG  279 (392)
Q Consensus       201 ~~~~~~p~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p-~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkg  279 (392)
T Consensus       361 ~~~E~~PAeFQIDD~Y~VpGVGTvvSGT~L~GtIrLND~LlLGPd~~G~F~pI~iKSIHRKRMpV~~VrcGQtASFALKK  440 (641)
T KOG0463         361 QLNENDPAEFQIDDIYWVPGVGTVVSGTLLSGTIRLNDILLLGPDSNGDFMPIPIKSIHRKRMPVGIVRCGQTASFALKK  440 (641)
T ss_pred             CCCCCCCCCEEECCEEECCCCCEEEECCEEEEEEEECCEEEECCCCCCCEEEEEHHHHHHCCCCCEEEECCCHHHHHHHH
T ss_conf             66657973035222485178522764225521577522788667888876453456645403661487526404367663


Q ss_pred             CCCCEEECHHEEECCC-CCCCCEEEEEEEEEEECCCCCCCCCCCCCCEEEEEECCEEEEEEEEECCCHHHHCCCCEEEEE
Q ss_conf             4543220211773267-776300016899971056787555511597899995414777999961895570789769999
Q gi|254780263|r  280 VNRADVPRGRVVCAPG-SIQEYSRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIILSPGSQAVMPGDRVDLE  358 (392)
Q Consensus       280 i~~~di~rGdvl~~~~-~~~~~~~f~A~i~il~~~~~~~~~~~~~~~~~~~~~~~~~v~~~i~~~~~~~~i~~g~~~~v~  358 (392)
T Consensus       441 Ikr~~vRKGMVmVsp~lkPqAsweFEaEILVLH-----HPTTIsprYQAMvHcGSiRQTAtivsM-~kdcLRTGDka~V~  514 (641)
T KOG0463         441 IKRKDVRKGMVMVSPKLKPQASWEFEAEILVLH-----HPTTISPRYQAMVHCGSIRQTATIVSM-GKDCLRTGDKAKVQ  514 (641)
T ss_pred             CCHHHHHCCEEEECCCCCCCEEEEEEEEEEEEE-----CCCCCCCCHHHEEEECCCCCEEEEEEC-CHHHHHCCCCCEEE
T ss_conf             546665364188668778632357754689984-----687558141320342340012243314-75665337744389


Q ss_pred             EEEC-CCEEECCCCEEEEEECCEEEEEEEEEEEE
Q ss_conf             9977-81775469849999899699989995531
Q gi|254780263|r  359 VELI-YPIAMEPNQTFSMREGGKTVGAGLILEII  391 (392)
Q Consensus       359 l~l~-~pi~~e~~~rfilRd~~~tig~G~I~~v~  391 (392)
T Consensus       515 FrFIkqPEYir~gqrlVFRE-GRTKAVGti~~~l  547 (641)
T KOG0463         515 FRFIKQPEYIRPGQRLVFRE-GRTKAVGTISSVL  547 (641)
T ss_pred             EEEECCCCEECCCCEEEEEC-CCCEEEEEECCCC
T ss_conf             99856832325774688623-6530101340236