HHsearch alignment for GI: 254780263 and conserved domain: KOG0466

>KOG0466 consensus.
Probab=100.00  E-value=0  Score=334.68  Aligned_cols=354  Identities=26%  Similarity=0.416  Sum_probs=282.8

Q ss_pred             HHCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEE---ECC-------------
Q ss_conf             2103882799999046898878999999876444200131268686986292063789998---219-------------
Q gi|254780263|r    6 YVRNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSY---ETD-------------   69 (392)
Q Consensus         6 ~~~~k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~---~~~-------------   69 (392)
T Consensus        32 visRQATiNIGTIGHVAHGKSTvVkAiSGv---------~TvrFK~ELERNITIKLGYANAKIYkc~~~kCprP~cy~s~  102 (466)
T KOG0466          32 VISRQATINIGTIGHVAHGKSTVVKAISGV---------HTVRFKNELERNITIKLGYANAKIYKCDDPKCPRPGCYRSF  102 (466)
T ss_pred             HHHHEEEEEECCEECCCCCCCEEEEEECCC---------EEEEEHHHHHCCEEEEECCCCCEEEECCCCCCCCCCHHHCC
T ss_conf             951201443021110025740244540461---------48871334421526885135445785589889996630204


Q ss_pred             ---------------------CEEEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCC-CCCCCHHHHHHHHHHCCCCCE
Q ss_conf             ---------------------9089998478730246779877400233145201234-433210677888863187602
Q gi|254780263|r   70 ---------------------KRFYSHIDCPGHADYVKNMITGATQADGAILVCAAED-GPKPQTREHILLARQIGISSI  127 (392)
Q Consensus        70 ---------------------~~~i~iiD~PGH~~f~~~mi~g~~~~D~ailvVda~~-G~~~QT~eh~~l~~~lgi~~i  127 (392)
T Consensus       103 gS~k~d~~~c~~~g~~~~~klvRHVSfVDCPGHDiLMaTMLnGaAvmDaalLlIA~NEsCPQPQTsEHLaaveiM~Lkhi  182 (466)
T KOG0466         103 GSSKEDRPPCDRPGCEGKMKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAVEIMKLKHI  182 (466)
T ss_pred             CCCCCCCCCCCCCCCCCCEEEEEEEEECCCCCHHHHHHHHHCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHCEE
T ss_conf             78999999865689987458999877514796188998874326775433410104888989850667888778631418


Q ss_pred             EEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCC
Q ss_conf             33100233356122211012321001110145322102331146764114445652123320344310252222100001
Q gi|254780263|r  128 VVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQRSLDAP  207 (392)
Q Consensus       128 Iv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p~~~~~~p  207 (392)
T Consensus       183 iilQNKiDli~e~~A~eq~-e~I~kFi~~t-~ae~aPiiPisAQ----------lkyNId~v~eyivkkIPvPvRdf~s~  250 (466)
T KOG0466         183 IILQNKIDLIKESQALEQH-EQIQKFIQGT-VAEGAPIIPISAQ----------LKYNIDVVCEYIVKKIPVPVRDFTSP  250 (466)
T ss_pred             EEEECHHHHHHHHHHHHHH-HHHHHHHHCC-CCCCCCEEEEHHH----------HCCCHHHHHHHHHHCCCCCCCCCCCC
T ss_conf             9982123354377889889-9999997456-5579952101364----------33676799999986189882014789


Q ss_pred             CCEECCCCCCC--CC------CCCCEEEEEEECCCCCCCEEEEEEC------C----CCCCCEEEECCCCCCCCCCCCCC
Q ss_conf             10000000135--54------4543014874245348967999506------8----74321254121001211443210
Q gi|254780263|r  208 FLMHIEGSCGI--EG------RGTVVTGCIKRGRIKAGSDVEIIGM------G----GKKLKVKCTDVEMFRKKLDEAIA  269 (392)
Q Consensus       208 ~r~~I~~vf~i--~g------~G~Vv~GrV~sG~l~~Gd~i~i~p~------~----~~~~~~kv~si~~~~~~v~~a~a  269 (392)
T Consensus       251 prlIVIRSFDVNkPG~ev~~lkGgvaggsil~Gvlkvg~~IEiRPGiv~kd~~g~~~C~Pi~SrI~sL~AE~n~L~~AvP  330 (466)
T KOG0466         251 PRLIVIRSFDVNKPGSEVDDLKGGVAGGSILKGVLKVGQEIEIRPGIVTKDENGNIKCRPIFSRIVSLFAEQNDLQFAVP  330 (466)
T ss_pred             CCEEEEEEECCCCCCCHHHCCCCCCCCCHHHHHHHHCCCEEEECCCEEEECCCCCEEEEEHHHHHHHHHHHHCCCEEECC
T ss_conf             72899986236899841221457420305543242048588862761555589967875678877888753235024258


Q ss_pred             CHHHHHHHC---CCCCCEEECHHEEECCCCCC-CCEEEEEEEEEEECCCCCCCCC---------CCCCCEEEEEECCEEE
Q ss_conf             013666411---24543220211773267776-3000168999710567875555---------1159789999541477
Q gi|254780263|r  270 GDNVGLLLR---GVNRADVPRGRVVCAPGSIQ-EYSRFRASVYILTASEGGRTTG---------FMDNYRPQFFMDTADV  336 (392)
Q Consensus       270 Gd~v~l~Lk---gi~~~di~rGdvl~~~~~~~-~~~~f~A~i~il~~~~~~~~~~---------~~~~~~~~~~~~~~~v  336 (392)
T Consensus       331 GGLIGVGT~~DPtlcraDrlVGqVlG~~G~LP~if~elei~y~Llrrllgvrt~~~~k~~kv~kL~k~E~lmvNIGS~sT  410 (466)
T KOG0466         331 GGLIGVGTKMDPTLCRADRLVGQVLGAVGTLPDIFTELEISYFLLRRLLGVRTKGDKKQAKVSKLVKNEILMVNIGSTST  410 (466)
T ss_pred             CCEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCCEEEEEEEHHHHHHHHCCCCCCCCCCCHHHHCCCCCEEEEEECCCCC
T ss_conf             85564125328540026678888875126776102677761555667762113564332013322668579998535655


Q ss_pred             EEEEEECCCHHHHCCCCEEEEEEEECCCEEECCCCEEEE--EE--CCEEEEEEEEEE
Q ss_conf             799996189557078976999999778177546984999--98--996999899955
Q gi|254780263|r  337 TGRIILSPGSQAVMPGDRVDLEVELIYPIAMEPNQTFSM--RE--GGKTVGAGLILE  389 (392)
Q Consensus       337 ~~~i~~~~~~~~i~~g~~~~v~l~l~~pi~~e~~~rfil--Rd--~~~tig~G~I~~  389 (392)
T Consensus       411 G~~v~~vk~---------d~~k~~Lt~P~CteigEkiAlSRrvekhWRLIGwg~I~~  458 (466)
T KOG0466         411 GGRVSAVKA---------DMAKIQLTSPVCTEIGEKIALSRRVEKHWRLIGWGQIKA  458 (466)
T ss_pred             CCEEEEEEC---------CEEEEEECCCHHCCCCHHHHHHHHHHHHEEEECCEEEEC
T ss_conf             736898833---------211368537122011112445566543307730036707