HHsearch alignment for GI: 254780263 and conserved domain: KOG1532

>KOG1532 consensus.
Probab=97.51  E-value=0.00063  Score=43.40  Aligned_cols=126  Identities=21%  Similarity=0.321  Sum_probs=67.5

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHC--CCCC-------------C---CC--HH-HHH------CCCEEEEEE--
Q ss_conf             799999046898878999999876444200--1312-------------6---86--86-986------292063789--
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKE--YGDI-------------D---SA--PE-EKL------RGITIATAH--   63 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~--~~~~-------------D---~~--~~-E~~------rGiTi~~~~--   63 (392)
T Consensus        20 ~~ilVvGMAGSGKTTF~QrL~~hl~~~~~ppYviNLDPAv~~vpy~aniDIRDtVkYkEvMkqY~LGPNGgI~TsLNLF~   99 (366)
T KOG1532          20 VIILVVGMAGSGKTTFMQRLNSHLHAKKTPPYVINLDPAVRNVPYPANIDIRDTVKYKEVMKQYQLGPNGGIVTSLNLFA   99 (366)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEECCHHHHCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCHHHHHHHHH
T ss_conf             07999944778841399999999862369980886788885488866775665430999999838899864033589999


Q ss_pred             EEE---------ECCCEEEEEEECCCC-HHHH----HHHHH-HH--HCCCCEEEEECCCCCCCCCHHHH--HH---HHHH
Q ss_conf             998---------219908999847873-0246----77987-74--00233145201234433210677--88---8863
Q gi|254780263|r   64 VSY---------ETDKRFYSHIDCPGH-ADYV----KNMIT-GA--TQADGAILVCAAEDGPKPQTREH--IL---LARQ  121 (392)
Q Consensus        64 ~~~---------~~~~~~i~iiD~PGH-~~f~----~~mi~-g~--~~~D~ailvVda~~G~~~QT~eh--~~---l~~~  121 (392)
T Consensus       100 tk~dqv~~~iek~~~~~~~~liDTPGQIE~FtWSAsGsIIte~lass~ptvv~YvvDt~rs~~p~tFMSNMlYAcSilyk  179 (366)
T KOG1532         100 TKFDQVIELIEKRAEEFDYVLIDTPGQIEAFTWSASGSIITETLASSFPTVVVYVVDTPRSTSPTTFMSNMLYACSILYK  179 (366)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEECCCCCEEEEEECCCCCCHHHHHHHCCCEEEEEEECCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             87899999999742204779974888068998427850158667613985999994477678841699889999999986


Q ss_pred             CCCCCEEEEECCCCCCCC
Q ss_conf             187602331002333561
Q gi|254780263|r  122 IGISSIVVYMNKVDAVDD  139 (392)
Q Consensus       122 lgi~~iIv~iNKmD~v~~  139 (392)
T Consensus       180 tklp-~ivvfNK~Dv~d~  196 (366)
T KOG1532         180 TKLP-FIVVFNKTDVSDS  196 (366)
T ss_pred             CCCC-EEEEEECCCCCCC
T ss_conf             2687-6999714344561