HHsearch alignment for GI: 254780263 and conserved domain: KOG3887

>KOG3887 consensus.
Probab=95.45  E-value=0.0078  Score=36.64  Aligned_cols=119  Identities=23%  Similarity=0.308  Sum_probs=76.8

Q ss_pred             CCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHH--
Q ss_conf             038827999990468988789999998764442001312686869862920637899982199089998478730246--
Q gi|254780263|r    8 RNKESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYV--   85 (392)
Q Consensus         8 ~~k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~--   85 (392)
T Consensus        25 ~~kp--~ilLMG~rRsGKsSI~KVVFhkMsPn-------eTlflESTski~~d~----is~sfinf~v~dfPGQ~~~Fd~   91 (347)
T KOG3887          25 GMKP--RILLMGLRRSGKSSIQKVVFHKMSPN-------ETLFLESTSKITRDH----ISNSFINFQVWDFPGQMDFFDP   91 (347)
T ss_pred             CCCC--EEEEEEECCCCCCHHHHEEEECCCCC-------CEEEEECCCCCCHHH----HHHHHCCEEEEECCCCCCCCCC
T ss_conf             8886--58997301047320031123326987-------436764257533766----5332034377515886566787


Q ss_pred             ---HHHHHHHHCCCCEEEEECCCCC-CCCCHHHHHHHHHHCCCCC---EEEEECCCCCCCCHH
Q ss_conf             ---7798774002331452012344-3321067788886318760---233100233356122
Q gi|254780263|r   86 ---KNMITGATQADGAILVCAAEDG-PKPQTREHILLARQIGISS---IVVYMNKVDAVDDDE  141 (392)
Q Consensus        86 ---~~mi~g~~~~D~ailvVda~~G-~~~QT~eh~~l~~~lgi~~---iIv~iNKmD~v~~~~  141 (392)
T Consensus        92 s~D~e~i--F~~~gALifvIDaQddy~eala~L~~~v~raykvNp~in~EVfiHKvDGLsdd~  152 (347)
T KOG3887          92 SFDYEMI--FRGVGALIFVIDAQDDYMEALARLHMTVERAYKVNPNINFEVFIHKVDGLSDDF  152 (347)
T ss_pred             CCCHHHH--HHCCCEEEEEEECHHHHHHHHHHHHHHHHHEEECCCCCEEEEEEEECCCCCHHH
T ss_conf             6588998--741474999993658899999999987653055179844999997346775454