HHsearch alignment for GI: 254780263 and conserved domain: PRK00741

>PRK00741 prfC peptide chain release factor 3; Provisional.
Probab=100.00  E-value=0  Score=348.64  Aligned_cols=265  Identities=26%  Similarity=0.362  Sum_probs=193.7

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHH------HH----HHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHH
Q ss_conf             999990468988789999998764------44----20013126868698629206378999821990899984787302
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYS------EE----KKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHAD   83 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~------~~----~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~   83 (392)
T Consensus        12 niaIi~H~dAGKTTLtE~lL~~~GaI~~~G~V~~~~~~~~~~sD~~~~E~~RgiSI~ssv~~~e~~~~~iNliDTPGh~D   91 (526)
T PRK00741         12 TFAIISHPDAGKTTLTEKLLLFGGAIQEAGTVKGRKSGRHATSDWMEMEKQRGISVTSSVMQFPYRDCLINLLDTPGHED   91 (526)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCHHHHHCCCEEECCEEEEEECCEEEEEEECCCCHH
T ss_conf             79999378989899999999746752448466314678864678858899759648615177867898999990989467


Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCC--CHHHHHHCCCCCCE---------
Q ss_conf             4677987740023314520123443321067788886318760233100233356--12221101232100---------
Q gi|254780263|r   84 YVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVD--DDELLDISEYEIRD---------  152 (392)
Q Consensus        84 f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~--~~~~~~~i~~~i~~---------  152 (392)
T Consensus        92 F~~e~~raL~a~D~Av~Vida~~GVe~qTe~~w~~~~~~~iP-~i~FINKmDR~~ad~~~~l~ei~~~lg~~~~p~~~Pi  170 (526)
T PRK00741         92 FSEDTYRTLTAVDSALMVIDAAKGVEPQTRKLMEVCRLRDTP-IFTFINKLDRDGREPLELLDEIEEVLGIACAPITWPI  170 (526)
T ss_pred             HHHHHHHHHHHHCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEEECCCCCCCCHHHHHHHHHHHHCCCCEEEEEEC
T ss_conf             789999999873759999977755233368999998863998-8999965676789878988778887478736888303


Q ss_pred             -----------EEEEE--EEE-------------------------------------------------------EEEE
Q ss_conf             -----------11101--453-------------------------------------------------------2210
Q gi|254780263|r  153 -----------LLKEH--KYS-------------------------------------------------------DDTP  164 (392)
Q Consensus       153 -----------~l~~~--~~~-------------------------------------------------------~~~p  164 (392)
T Consensus       171 g~g~~F~GvvDl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ee~el~~~~~~~~d~~~~~~G~l~P  250 (526)
T PRK00741        171 GMGKRFKGVYDLYNDEVELYQPGHGHTIQEFEIIKGLDNPELDEALGEDLAEQLREELELVQGASNEFDLEAFLAGELTP  250 (526)
T ss_pred             CCCCCEEEEEEECCCEEEECCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHCCCEEE
T ss_conf             67886037888013879980367788404660587787789998753899997553577773155510689997398028


Q ss_pred             CCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCCCC---------CCCCCCCEECCCCC--CC-CCCCCCEEEEEEEC
Q ss_conf             23311467641144456521233203443102522221---------00001100000001--35-54454301487424
Q gi|254780263|r  165 IIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQR---------SLDAPFLMHIEGSC--GI-EGRGTVVTGCIKRG  232 (392)
Q Consensus       165 ii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p~~---------~~~~p~r~~I~~vf--~i-~g~G~Vv~GrV~sG  232 (392)
T Consensus       251 Vf~GSA~~----------n~GV~~LLd~iv~~~PsP~~r~~~~~~v~p~~~~fsa~VFKiqanmDP~h~griaf~RV~SG  320 (526)
T PRK00741        251 VFFGSALN----------NFGVQEFLDAFVEWAPAPQPRQTDERVVEPTEEKFSGFVFKIQANMDPKHRDRIAFMRVCSG  320 (526)
T ss_pred             EEEEECCC----------CCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCEEEEEEEECCCCCCCCEEEEEEEEEE
T ss_conf             99620003----------65699999999997799877777765447877774359999984037542543799997511


Q ss_pred             CCCCCCEEEEEECCCCCCCEEEECCCC----CCCCCCCCCCCHHHHHHHCCCCCCEEECHHEEECCCC
Q ss_conf             534896799950687432125412100----1211443210013666411245432202117732677
Q gi|254780263|r  233 RIKAGSDVEIIGMGGKKLKVKCTDVEM----FRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGS  296 (392)
Q Consensus       233 ~l~~Gd~i~i~p~~~~~~~~kv~si~~----~~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~~~  296 (392)
T Consensus       321 ~l~~g~~v~n~r~gk---~eri~~l~~~~g~~r~~V~ea~AGDIvgl~----~~~~~~tGDTL~~~~~  381 (526)
T PRK00741        321 KFEKGMKVRHVRTGK---DVRISNALTFMAQDREHVEEAYAGDIIGLH----NHGTIQIGDTFTEGEK  381 (526)
T ss_pred             EECCCCEEEECCCCC---EEEHHHHHHHHCCCCEEEEEECCCCEEEEC----CCCCCCCCCEECCCCC
T ss_conf             885799898525795---366326778744352351387699899971----6663003755206885