HHsearch alignment for GI: 254780263 and conserved domain: PRK04213

>PRK04213 GTP-binding protein; Provisional.
Probab=99.65  E-value=8e-16  Score=117.17  Aligned_cols=159  Identities=25%  Similarity=0.342  Sum_probs=100.8

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCC-------HH---
Q ss_conf             99999046898878999999876444200131268686986292063789998219908999847873-------02---
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGH-------AD---   83 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH-------~~---   83 (392)
T Consensus         3 ~VaivGRpNVGKSTL~N~L~g~k~~-------vs-----~~pg~Tr~~~~--~~~~--~~~~vDtPG~g~~~~~~~~~~~   66 (195)
T PRK04213          3 EIIFVGRSNVGKSTLIRALTGKKVR-------VG-----KRPGVTLKPNE--YDWG--DFILVDLPGFGFMSGVPKKVQE   66 (195)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCCC-------CC-----CCCCEEEEEEE--EECC--CEEEEECCCCCCCCCCCHHHHH
T ss_conf             7999769998899999999689851-------34-----89964873458--8508--8999999996222458888999


Q ss_pred             HHH-HHH----HHHHCCCCEEEEECCCCCC-----------CCCHHHHHHHHHHCCCCCEEEEECCCCCCCC-HHHHHHC
Q ss_conf             467-798----7740023314520123443-----------3210677888863187602331002333561-2221101
Q gi|254780263|r   84 YVK-NMI----TGATQADGAILVCAAEDGP-----------KPQTREHILLARQIGISSIVVYMNKVDAVDD-DELLDIS  146 (392)
Q Consensus        84 f~~-~mi----~g~~~~D~ailvVda~~G~-----------~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~-~~~~~~i  146 (392)
T Consensus        67 ~~~~~~~~~~~~~~~~~~~~~~vvD~~~~~~~~dr~~~~~~~~~D~~i~~~l~~~~~p-~ilv~NKiD~i~~~~~~l~~i  145 (195)
T PRK04213         67 RIKDEIVHYIEDNADRIAAAVLVVDGKSFPEIIERWESRGEIPIDVEMFDFLRELGIN-PIVAVNKMDKIKNSEEVLDEI  145 (195)
T ss_pred             HHHHHHHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCC-EEEEEECHHHCCCHHHHHHHH
T ss_conf             9999999999998851789999995786544211234456777789999999874998-799998733058778889999


Q ss_pred             CCCCCEEEEEEEEEEEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCCCC
Q ss_conf             23210011101453221023311467641144456521233203443102522221
Q gi|254780263|r  147 EYEIRDLLKEHKYSDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQR  202 (392)
Q Consensus       147 ~~~i~~~l~~~~~~~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p~~  202 (392)
T Consensus       146 ~e~~~~~~~~~~~~--~~iv~iSakk~-----------Gid~L~~~I~~~L~E~~~  188 (195)
T PRK04213        146 AERLGLYPPWRQWL--DIIAPISAKKG-----------GIEALKGLINKRLREFKR  188 (195)
T ss_pred             HHHHHCCCCHHHCC--CEEEEEECCCC-----------CHHHHHHHHHHHCHHHCC
T ss_conf             99982576156569--87999845779-----------999999999996755374