HHsearch alignment for GI: 254780263 and conserved domain: PRK05124

>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional.
Probab=100.00  E-value=0  Score=685.22  Aligned_cols=373  Identities=25%  Similarity=0.337  Sum_probs=326.6

Q ss_pred             CCCCEEEEEEEECCCCCHHHHHHHHHH-----------HHHHHHHCCCC----------CCCCHHHHHCCCEEEEEEEEE
Q ss_conf             038827999990468988789999998-----------76444200131----------268686986292063789998
Q gi|254780263|r    8 RNKESLGLSTIGHVDHGKTTLTAAITK-----------YYSEEKKEYGD----------IDSAPEEKLRGITIATAHVSY   66 (392)
Q Consensus         8 ~~k~~~ni~~iGhvd~GKSTL~~~L~~-----------~~~~~~~~~~~----------~D~~~~E~~rGiTi~~~~~~~   66 (392)
T Consensus        23 ~~k~~l~~v~~GhVD~GKSTl~GrlL~~~~~v~~~~~~~~~~~s~~~g~~~~~~~~a~l~D~l~~ERe~GiTIdva~~~f  102 (475)
T PRK05124         23 QHKSLLRFLTCGSVDDGKSTLIGRLLHDTKQIYEDQLASLHNDSKRHGTQGEKLDLALLVDGLQAEREQGITIDVAYRYF  102 (475)
T ss_pred             CCCCEEEEEEECCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEEECCCHHHHHCCCEEEEEEEEE
T ss_conf             47985799999055797788889999981997889999999999982887772224442059988986697169567899


Q ss_pred             ECCCEEEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCH-HHHHH
Q ss_conf             21990899984787302467798774002331452012344332106778888631876023310023335612-22110
Q gi|254780263|r   67 ETDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDD-ELLDI  145 (392)
Q Consensus        67 ~~~~~~i~iiD~PGH~~f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~-~~~~~  145 (392)
T Consensus       103 ~t~~r~~~i~DaPGH~~f~~NMitGas~aD~aiLvVdA~~G~~~QTreH~~i~~llGI~~iIVaVNKMDlV~~~~~~f~~  182 (475)
T PRK05124        103 STEKRKFIIADTPGHEQYTRNMATGASTCDLAILLIDARKGVLDQTRRHSFIATLLGIKHLVVAVNKMDLVDYSEEVFER  182 (475)
T ss_pred             ECCCEEEEEEECCCHHHHHHHHHHHHHHCCEEEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEEEECHHCCCCCHHHHHH
T ss_conf             53876899973796387788898888767889999989889478889999999865998599998504313543999999


Q ss_pred             CCCCCCEEEEEEEEEEEEECCCCEEEEEEECCC--CCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCEECCCCCCCCCCCC
Q ss_conf             123210011101453221023311467641144--456521233203443102522221000011000000013554454
Q gi|254780263|r  146 SEYEIRDLLKEHKYSDDTPIIRGSALCALQGTN--KELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGT  223 (392)
Q Consensus       146 i~~~i~~~l~~~~~~~~~pii~~sa~~g~~~~n--~~~~~~~~~~Ll~~i~~~~~~p~~~~~~p~r~~I~~vf~i~g~G~  223 (392)
T Consensus       183 I~~e~~~~l~~~g~~~~v~~IPISal~GdNIv~~S~~m~WY~GptLle~Le~-~~~~~~~~~~pfRlPVq~V~r~~~~~r  261 (475)
T PRK05124        183 IREDYLTFAEQLPGNLDIRFVPLSALEGDNVVSQSESMPWYSGPTLLEVLET-VDIQREVDAQPFRFPVQYVNRPNLDFR  261 (475)
T ss_pred             HHHHHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCHHHHHHC-CCCCCCCCCCCCCCCCEEEECCCCCCE
T ss_conf             9999999999749988850775413457676215667874567539999855-888876555665566579862687731


Q ss_pred             CEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCEEECHHEEECCCC-CCCCEE
Q ss_conf             3014874245348967999506874321254121001211443210013666411245432202117732677-763000
Q gi|254780263|r  224 VVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGS-IQEYSR  302 (392)
Q Consensus       224 Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~~~-~~~~~~  302 (392)
T Consensus       262 g~~G~I~sG~i~~GD~V~vlPsg---~~a~Vk~I~~~~~~~~~A~aG~sV~l~L~--deiDIsRGdVl~~~~~~p~~s~~  336 (475)
T PRK05124        262 GYAGTLASGVVKVGDRVKVLPSG---KESNVARIVTFDGDLEEAFAGEAITLVLE--DEIDISRGDLLVAADEAPPAAQH  336 (475)
T ss_pred             EEEEEEEECEECCCCEEEECCCC---CEEEEEEEEECCCCCCCCCCCCEEEEEEE--CCCCCCCCCEEECCCCCCCCCCE
T ss_conf             68899713327179989993899---75898999965865254389987999960--34468998389738998670258


Q ss_pred             EEEEEEEEECCCCCCCCCCCCCCEEEEEECCEEEEEEEEEC-----------CCHHHHCCCCEEEEEEEECCCEEECCC-
Q ss_conf             16899971056787555511597899995414777999961-----------895570789769999997781775469-
Q gi|254780263|r  303 FRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIILS-----------PGSQAVMPGDRVDLEVELIYPIAMEPN-  370 (392)
Q Consensus       303 f~A~i~il~~~~~~~~~~~~~~~~~~~~~~~~~v~~~i~~~-----------~~~~~i~~g~~~~v~l~l~~pi~~e~~-  370 (392)
T Consensus       337 F~A~Ivwm~~------~pL~~G~~y~lk~~t~~v~a~i~~I~~kiD~~T~~~~~~~~L~~Ndia~V~i~~~~pI~~d~y~  410 (475)
T PRK05124        337 ASADVVWMAE------QPLQPGQSYDIKIAGKKTRARVDAIRYQVDINTLTQRDVENLPLNGIGLVELTFDEPLVLDPYQ  410 (475)
T ss_pred             EEEEEEEECC------CCCCCCCEEEEEECCCEEEEEEEEEEEEECCCCCCCCCCCCCCCCCEEEEEEEECCCEEECCHH
T ss_conf             8999999548------7677998689998474998999873478857866717877118998899999989902612162


Q ss_pred             -----CEEEEE--ECCEEEEEEEEEEEEC
Q ss_conf             -----849999--8996999899955319
Q gi|254780263|r  371 -----QTFSMR--EGGKTVGAGLILEIIE  392 (392)
Q Consensus       371 -----~rfilR--d~~~tig~G~I~~v~e  392 (392)
T Consensus       411 ~~~~lGrFILIDr~t~~TVAaGmI~~~l~  439 (475)
T PRK05124        411 QNRDTGGFILIDRLTNVTVGAGMVREPVE  439 (475)
T ss_pred             HCCCCCCEEEEECCCCCEEEEEEEHHHHH
T ss_conf             39677858999879997899994803734