HHsearch alignment for GI: 254780263 and conserved domain: PRK05506

>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional.
Probab=100.00  E-value=0  Score=624.97  Aligned_cols=369  Identities=26%  Similarity=0.336  Sum_probs=318.3

Q ss_pred             CCCCEEEEEEEECCCCCHHHHHHHHHH-----------HHHHHHHCCCC----------CCCCHHHHHCCCEEEEEEEEE
Q ss_conf             038827999990468988789999998-----------76444200131----------268686986292063789998
Q gi|254780263|r    8 RNKESLGLSTIGHVDHGKTTLTAAITK-----------YYSEEKKEYGD----------IDSAPEEKLRGITIATAHVSY   66 (392)
Q Consensus         8 ~~k~~~ni~~iGhvd~GKSTL~~~L~~-----------~~~~~~~~~~~----------~D~~~~E~~rGiTi~~~~~~~   66 (392)
T Consensus         3 ~~k~~l~~~~~G~VD~GKSTliGrlL~dt~~i~~d~~~~~~~~s~~~g~~~~~~~~a~l~D~l~~EreqGiTIDva~~~F   82 (613)
T PRK05506          3 ERKTLLRFITCGSVDDGKSTLIGRLLYDSKMIFEDQLAALERDSKKVGTQGDEIDLALLVDGLAAEREQGITIDVAYRYF   82 (613)
T ss_pred             CCCCEEEEEEECCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCCHHHHHCCCEEEEEEEEE
T ss_conf             77762589999366797888988999981996789999999999981898886035442148888985597168567788


Q ss_pred             ECCCEEEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCH-HHHHH
Q ss_conf             21990899984787302467798774002331452012344332106778888631876023310023335612-22110
Q gi|254780263|r   67 ETDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDD-ELLDI  145 (392)
Q Consensus        67 ~~~~~~i~iiD~PGH~~f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~-~~~~~  145 (392)
T Consensus        83 ~t~~r~~~i~DaPGH~~y~rNMitgAs~ad~AilliDa~~G~~~QTrrH~~i~~llGI~~iivaVNKMDlV~y~~~~f~~  162 (613)
T PRK05506         83 STPKRKFIVADTPGHEQYTRNMATGASTADLAIILVDARKGVLTQTRRHSFIASLLGIRHIVLAVNKMDLVDYDQEVFDR  162 (613)
T ss_pred             ECCCEEEEEECCCCHHHHHHHHHHHHHHCCEEEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCHHHHHHH
T ss_conf             43870599942896798998999878653879999988879515518999999872987599998520124781999999


Q ss_pred             CCCCCCEEEEEEEEEEEEECCCCEEEEEEECC--CCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCEECCCCCCCCCCCC
Q ss_conf             12321001110145322102331146764114--4456521233203443102522221000011000000013554454
Q gi|254780263|r  146 SEYEIRDLLKEHKYSDDTPIIRGSALCALQGT--NKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSCGIEGRGT  223 (392)
Q Consensus       146 i~~~i~~~l~~~~~~~~~pii~~sa~~g~~~~--n~~~~~~~~~~Ll~~i~~~~~~p~~~~~~p~r~~I~~vf~i~g~G~  223 (392)
T Consensus       163 I~~~~~~~~~~l~~~-~~~~IPISAl~GDNVv~~S~~m~WY~GptLle~Le~~-~~~~~~~~~~fR~PVQ~V~Rp~~dfR  240 (613)
T PRK05506        163 IVADYLAFAAKLGLT-DVTFIPISALKGDNVVTRSARTPWYEGPSLLEHLETV-EIAGDRNLKDFRFPVQYVNRPNLDFR  240 (613)
T ss_pred             HHHHHHHHHHHCCCC-CCEEEECCCCCCCEEEECCCCCCCCCCCCHHHHHHCC-CCCCCCCCCCCEEEEEEEECCCCCEE
T ss_conf             999999999657998-8759967357487476788788666786589997377-87866445671211178744787505


Q ss_pred             CEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCEEECHHEEECCCC-CCCCEE
Q ss_conf             3014874245348967999506874321254121001211443210013666411245432202117732677-763000
Q gi|254780263|r  224 VVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGS-IQEYSR  302 (392)
Q Consensus       224 Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~~~-~~~~~~  302 (392)
T Consensus       241 gyaGrI~sG~ikvGD~V~vlPSg---~~s~Vk~I~~~~~~~~~A~agqSVtltL~--dEIDISRGDvI~~~~~~p~~s~~  315 (613)
T PRK05506        241 GFAGTVASGVVRPGDEVVVLPSG---KTSRVKRIVTYDGELDEAFAGQAVTLTLA--DEIDISRGDMLARADNPPEVADQ  315 (613)
T ss_pred             EEEEEECCEEECCCCEEEECCCC---CEEEEEEEECCCCCHHHCCCCCEEEEEEC--CCEECCCCCEEECCCCCCCCCCE
T ss_conf             79999841367269989987899---87999999868997641338980899974--62643798689648998870108


Q ss_pred             EEEEEEEEECCCCCCCCCCCCCCEEEEEECCEEEEEEEEE-----------CCCHHHHCCCCEEEEEEEECCCEEECCC-
Q ss_conf             1689997105678755551159789999541477799996-----------1895570789769999997781775469-
Q gi|254780263|r  303 FRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIIL-----------SPGSQAVMPGDRVDLEVELIYPIAMEPN-  370 (392)
Q Consensus       303 f~A~i~il~~~~~~~~~~~~~~~~~~~~~~~~~v~~~i~~-----------~~~~~~i~~g~~~~v~l~l~~pi~~e~~-  370 (392)
T Consensus       316 f~A~lvWm~e~------pL~~gr~YllK~~t~~v~a~I~~I~~~iDinTl~~~~a~~L~lNdIg~V~l~l~~pI~~D~Y~  389 (613)
T PRK05506        316 FDATLVWMAEE------PLLPGRPYLLKHGTRTVPASVAAIKHRVDVNTLERLAAKRLELNEIGRCNLSLDAPIAFDPYA  389 (613)
T ss_pred             EEEEEEEECCC------CCCCCCEEEEEECCEEEEEEEEEEEEEECCCCCCCCCCCCCCCCCCEEEEEEECCCCCCCCHH
T ss_conf             78999994498------767998899998777999999621689726751324435337874189999958973468365


Q ss_pred             -----CEEEEEE--CCEEEEEEEEEE
Q ss_conf             -----8499998--996999899955
Q gi|254780263|r  371 -----QTFSMRE--GGKTVGAGLILE  389 (392)
Q Consensus       371 -----~rfilRd--~~~tig~G~I~~  389 (392)
T Consensus       390 ~n~~tGsFILID~~tn~TVaAGmI~~  415 (613)
T PRK05506        390 RNRTTGSFILIDRLTNATVGAGMIDF  415 (613)
T ss_pred             HCCCCCCEEEEECCCCCEEEEEEECH
T ss_conf             68666658999889995788983705