HHsearch alignment for GI: 254780263 and conserved domain: PRK09435

>PRK09435 arginine/ornithine transport system ATPase; Provisional.
Probab=98.04  E-value=1.7e-05  Score=53.10  Aligned_cols=170  Identities=18%  Similarity=0.146  Sum_probs=90.2

Q ss_pred             CEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCC---------------CCCHHH---HHCCCEEEEEEE--------
Q ss_conf             827999990468988789999998764442001312---------------686869---862920637899--------
Q gi|254780263|r   11 ESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDI---------------DSAPEE---KLRGITIATAHV--------   64 (392)
Q Consensus        11 ~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~---------------D~~~~E---~~rGiTi~~~~~--------   64 (392)
T Consensus        48 ~a~~iGiTG~pG~GKStli~~l~~~~~~~g~~v~vlavDPsS~~sgGaiLGDr~Rm~~~~~~~~~fiRs~~srg~lgg~~  127 (325)
T PRK09435         48 NALRIGITGVPGVGKSTFIEALGMHLIEQGHKVAVLAVDPSSTRTGGSILGDKTRMERLSRHPNAFIRPSPSSGTLGGVA  127 (325)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCC
T ss_conf             82599742799986889999999999967985899997899998886101038888761479984884067788867733


Q ss_pred             --------EEECCCEEEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCC
Q ss_conf             --------982199089998478730246779877400233145201234433210677888863187602331002333
Q gi|254780263|r   65 --------SYETDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDA  136 (392)
Q Consensus        65 --------~~~~~~~~i~iiD~PGH~~f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~  136 (392)
T Consensus       128 ~~~~~~~~~~~a~g~d~i~iETvGvGQ---~e~~v~~~~d~~~~~~~p~~GD~~Q~----~K~GImEiaDi~-vVNKaDg  199 (325)
T PRK09435        128 RKTRETMLLCEAAGFDVILVETVGVGQ---SETAVAGMVDFFLLLQLPGAGDELQG----IKKGIMELADLI-VINKADG  199 (325)
T ss_pred             HHHHHHHHHHHHCCCCEEEEEECCCCH---HHHHHHHHCCEEEEEECCCCCCHHHH----HHHHHHHHCCEE-EEECCCC
T ss_conf             549999999997799989997067771---48899874266888835887608899----886577504268-9977675


Q ss_pred             CCCHHHHHHCCCCCCEEEEEEEEE---EEEECCCCEEEEEEECCCCCCCCCCCCCHHHH
Q ss_conf             561222110123210011101453---22102331146764114445652123320344
Q gi|254780263|r  137 VDDDELLDISEYEIRDLLKEHKYS---DDTPIIRGSALCALQGTNKELGEDSIHALMKA  192 (392)
Q Consensus       137 v~~~~~~~~i~~~i~~~l~~~~~~---~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~  192 (392)
T Consensus       200 d~~~~-A~~t~~e~~~aL~l~~~~~~~W~ppVl~~SA~~---g~GI~eL~~~I~~h~~~  254 (325)
T PRK09435        200 DNHTA-ARRAAAEYRSALRLLRPKDPGWQPPVLTCSALE---GEGIDELWQAIEDHRAA  254 (325)
T ss_pred             CCHHH-HHHHHHHHHHHHHCCCCCCCCCCCCEEEEEECC---CCCHHHHHHHHHHHHHH
T ss_conf             56589-999999999998607887899999989998158---99879999999999999