HHsearch alignment for GI: 254780263 and conserved domain: PRK12299

>PRK12299 obgE GTPase ObgE; Reviewed.
Probab=99.08  E-value=4e-10  Score=81.85  Aligned_cols=150  Identities=17%  Similarity=0.273  Sum_probs=86.9

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCC-----CH------
Q ss_conf             9999904689887899999987644420013126868698629206378999821990899984787-----30------
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPG-----HA------   82 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PG-----H~------   82 (392)
T Consensus       160 DVgLVG~PNaGKSTLl~~is~A~pkIa~Y---pFTT-------l~P~lGvv~~~-d~~~~~iaDiPGlIegA~~g~GLG~  228 (334)
T PRK12299        160 DVGLVGLPNAGKSTLISSVSAAKPKIADY---PFTT-------LHPNLGVVRVD-DYKSFVIADIPGLIEGASEGAGLGH  228 (334)
T ss_pred             CCEEEECCCCCHHHHHHHHHCCCCCCCCC---CCEE-------CCCEEEEEEEC-CCCEEEEEECCCCCCCCCCCCCCHH
T ss_conf             30146369874669999876476433578---7300-------38754799946-8867899866743355234777478


Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCC-CCCCH---HHHHHH--HHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEE
Q ss_conf             2467798774002331452012344-33210---677888--86318760233100233356122211012321001110
Q gi|254780263|r   83 DYVKNMITGATQADGAILVCAAEDG-PKPQT---REHILL--ARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKE  156 (392)
Q Consensus        83 ~f~~~mi~g~~~~D~ailvVda~~G-~~~QT---~eh~~l--~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~  156 (392)
T Consensus       229 ~FLrH----ieR~~~L~~viD~s~~d~~~~~~~l~~EL~~y~~~L~~-Kp~ivvlNK~Dl~~~~~~~~~~~----~~~~~  299 (334)
T PRK12299        229 RFLKH----IERTRLLLHLVDASSEDPVEDYKTIRNELEKYSPELAD-KPRILVLNKIDLLDEEERKEKIK----ELIKA  299 (334)
T ss_pred             HHHHH----HHHCCEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHCC-CCEEEEEECCCCCCHHHHHHHHH----HHHHH
T ss_conf             99876----65343699999799889899999999999985065536-98799998810688567899999----99987


Q ss_pred             EEEEEEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCC
Q ss_conf             14532210233114676411444565212332034431025
Q gi|254780263|r  157 HKYSDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHI  197 (392)
Q Consensus       157 ~~~~~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~  197 (392)
T Consensus       300 ~----~~~v~~ISA~~g~----------Gl~eL~~~i~~~L  326 (334)
T PRK12299        300 L----GGPVFLISAVTGE----------GLDELLRALWEFL  326 (334)
T ss_pred             C----CCCEEEEECCCCC----------CHHHHHHHHHHHH
T ss_conf             0----9968999787784----------9999999999999