HHsearch alignment for GI: 254780263 and conserved domain: PRK12312

>PRK12312 infB translation initiation factor IF-2; Provisional.
Probab=97.96  E-value=6.5e-06  Score=55.75  Aligned_cols=91  Identities=14%  Similarity=0.218  Sum_probs=74.3

Q ss_pred             CCCCCCCCCCEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCC
Q ss_conf             22100001100000001355445430148742453489679995068743212541210012114432100136664112
Q gi|254780263|r  200 PQRSLDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRG  279 (392)
Q Consensus       200 p~~~~~~p~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkg  279 (392)
T Consensus       511 p~~~E~~iG~AeV~~vF~~sk~g~IAGc~V~~G~i~r~~~vRVlR~~~vI~eG~I~SLrr~KddVkEV~~G~ECGI~l~~  590 (610)
T PRK12312        511 PVYEEVVIGQAEVRKLFKHSKVGTIAGCYVTSGKVKRNAKVRVIRNGKVIHEGKIASLKHLKDDVKEVEKGKECGIHIKN  590 (610)
T ss_pred             CCEEEEEEEEEEEEEEEECCCCEEEEEEEEEECEEEECCEEEEEECCEEEEEEEEHHHHHCCCCCCHHCCCCCCEEEECC
T ss_conf             72479998999988888648861789999974689719848998899999971677740201021120589532488327


Q ss_pred             CCCCEEECHHEEE
Q ss_conf             4543220211773
Q gi|254780263|r  280 VNRADVPRGRVVC  292 (392)
Q Consensus       280 i~~~di~rGdvl~  292 (392)
T Consensus       591 --f~di~~GDiIE  601 (610)
T PRK12312        591 --FNDIKENDIIE  601 (610)
T ss_pred             --CCCCCCCCEEE
T ss_conf             --35687698999