HHsearch alignment for GI: 254780263 and conserved domain: PRK13351

>PRK13351 elongation factor G; Reviewed.
Probab=100.00  E-value=0  Score=352.21  Aligned_cols=265  Identities=26%  Similarity=0.353  Sum_probs=200.0

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHH------HHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHH
Q ss_conf             999990468988789999998764------44200131268686986292063789998219908999847873024677
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYS------EEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKN   87 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~------~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~   87 (392)
T Consensus        10 Ni~IiaHvd~GKTTL~d~Ll~~~g~i~~~g~v~~g~t~~D~~~~E~eRgITikss~~sl~~~~~~iNlIDTPGHvDF~~E   89 (687)
T PRK13351         10 NIGIMAHIDAGKTTLTERILFYTGKIHKMGSVEDGNTVSDWMPQEQERGISIESAAATCDWKNHRINLIDTPGHIDFTGE   89 (687)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHCCCCEEEEEEEEEECCEEEEEEECCCCCCHHHH
T ss_conf             89999179989899999999974998758715478744788299997498776215999889989999809797430999


Q ss_pred             HHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCC--HHHHHHCCCCCCEEEE--E-------
Q ss_conf             9877400233145201234433210677888863187602331002333561--2221101232100111--0-------
Q gi|254780263|r   88 MITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDD--DELLDISEYEIRDLLK--E-------  156 (392)
Q Consensus        88 mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~--~~~~~~i~~~i~~~l~--~-------  156 (392)
T Consensus        90 v~~aLr~~DgallVVDaveGv~~qT~~v~r~a~~~~lp-~il~iNK~DR~~~d~~~~l~~i~~~l~~~~~~~~~p~~~~~  168 (687)
T PRK13351         90 VERSLRVLDGAVVVIDAVTGVQPQTETVWEQADKYKIP-RLIFINKMDRVGADLFDVLEDIEEKFGKRPLPLQLPIGSGD  168 (687)
T ss_pred             HHHHHHHHCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEEECCCCCCCCHHHHHHHHHHHHCCCEEEEEECCCCCC
T ss_conf             99999987868999978999868899999999987998-59999797789987667788999984896477860013565


Q ss_pred             -------------EEEEEE-------------------------------------------------------------
Q ss_conf             -------------145322-------------------------------------------------------------
Q gi|254780263|r  157 -------------HKYSDD-------------------------------------------------------------  162 (392)
Q Consensus       157 -------------~~~~~~-------------------------------------------------------------  162 (392)
T Consensus       169 ~~~~~id~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~e~~~~~dd~lle~~l~~~~~~~~~l~~~l~~~~~  248 (687)
T PRK13351        169 SFEGVVDLITEKELHFKEGDGGDTVEERPIPEELLEEVASAREKLIDALLEFDDELLELYLEGEEITAEQLRAPFRRGLR  248 (687)
T ss_pred             CCCCEEEECCCHHHCCCCCCCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCCCCHHHHHHHHHHHHH
T ss_conf             55641663110122002455685057725628889999999999999998308999999874887889999999999998


Q ss_pred             ----EECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCCC------------------CCCCCCCCEECCCCCCCCC
Q ss_conf             ----102331146764114445652123320344310252222------------------1000011000000013554
Q gi|254780263|r  163 ----TPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQ------------------RSLDAPFLMHIEGSCGIEG  220 (392)
Q Consensus       163 ----~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p~------------------~~~~~p~r~~I~~vf~i~g  220 (392)
T Consensus       249 ~~~~~Pv~~gsa~~----------~~Gv~~LLd~i~~~lPsP~e~~~~~~~~~~~~~~~~~~~~~~p~~a~V~K~~~~~~  318 (687)
T PRK13351        249 SGHLVPVLFGSALK----------NIGIRPLLDAVVEYLPSPLEGNPPAGSKGTEKKVLVNPDPEKPLLALVFKVQYDPY  318 (687)
T ss_pred             HCCCCHHHCCCCCC----------CCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEECCC
T ss_conf             48724123030335----------87858899999870899210345456566664001457999870899999787488


Q ss_pred             CCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCCC----CCCCCCCCCCHHHHHHHCCCCCCEEECHHEEECCCC
Q ss_conf             4543014874245348967999506874321254121001----211443210013666411245432202117732677
Q gi|254780263|r  221 RGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMF----RKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPGS  296 (392)
Q Consensus       221 ~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~----~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~~~  296 (392)
T Consensus       319 ~g~~s~~RV~sGtL~~g~~v~~~~~~---~~e~i~~l~~~~g~~~~~v~~~~aG~Iv~i~--gl--~~~~~g~tl~~~~~  391 (687)
T PRK13351        319 AGKLTYLRVYQGTLRSGSQLYNGSGR---KREKVGRIFRLQGNKREEVDEAKAGDIVAVA--GL--KELETGDTLHDEEG  391 (687)
T ss_pred             CCEEEEEEEECCEECCCCEEEECCCC---CEEEECCEEEECCCCCCCCCEECCCCEEEEE--CC--CCCCCCCEECCCCC
T ss_conf             97589999853454579877634898---3599676146426775414886779889995--87--64756887058998