HHsearch alignment for GI: 254780263 and conserved domain: PTZ00141

>PTZ00141 elongation factor 1 alpha; Provisional.
Probab=100.00  E-value=0  Score=695.31  Aligned_cols=377  Identities=32%  Similarity=0.509  Sum_probs=334.0

Q ss_pred             HCCCCEEEEEEEECCCCCHHHHHHHHHHH-----------HHHHHHCCCC--------CCCCHHHHHCCCEEEEEEEEEE
Q ss_conf             10388279999904689887899999987-----------6444200131--------2686869862920637899982
Q gi|254780263|r    7 VRNKESLGLSTIGHVDHGKTTLTAAITKY-----------YSEEKKEYGD--------IDSAPEEKLRGITIATAHVSYE   67 (392)
Q Consensus         7 ~~~k~~~ni~~iGhvd~GKSTL~~~L~~~-----------~~~~~~~~~~--------~D~~~~E~~rGiTi~~~~~~~~   67 (392)
T Consensus         2 ~~~k~~l~i~~~GhVD~GKSTL~G~Ll~~~g~v~~~~~~~~~~~~~~~g~~~~~~a~~~D~~~~Er~rGiTidv~~~~f~   81 (443)
T PTZ00141          2 GKEKTHINLVVIGHVDSGKSTTTGHLIYKLGGIDKRTIEKFEKESAEMGKGSFKYAWVLDKLKAERERGITIDIALWKFE   81 (443)
T ss_pred             CCCCCEEEEEEECCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCEEHHHHCCCHHHHHCCCEEEEEEEEEE
T ss_conf             98887659999947798288889999987388468899999888887178720004453077667636710734799994


Q ss_pred             CCCEEEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCC-------CHHHHHHHHHHCCCCCEEEEECCCCCCCCH
Q ss_conf             1990899984787302467798774002331452012344332-------106778888631876023310023335612
Q gi|254780263|r   68 TDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKP-------QTREHILLARQIGISSIVVYMNKVDAVDDD  140 (392)
Q Consensus        68 ~~~~~i~iiD~PGH~~f~~~mi~g~~~~D~ailvVda~~G~~~-------QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~  140 (392)
T Consensus        82 t~~~~~~iiD~PGH~~fi~nmi~Gas~aD~ailvVdA~~G~~e~gf~~~gQTreH~~i~~~lgv~~iIVaVNKmD~v~~~  161 (443)
T PTZ00141         82 TPKYYYTVIDAPGHRDFIKNMITGTSQADVALLVVPAEVGGFEGAFSKEGQTREHALLAFTLGVKQIIVGINKMDTCDYK  161 (443)
T ss_pred             CCCEEEEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHCCCCEEEEEEEEECCCCCH
T ss_conf             39889999989972888999996341077589999867785213466678639999999973997599999962156660


Q ss_pred             -HHHHHCCCCCCEEEEEEEEEE-EEECCCCEEEEEEECC--CCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCEECCCCC
Q ss_conf             -221101232100111014532-2102331146764114--445652123320344310252222100001100000001
Q gi|254780263|r  141 -ELLDISEYEIRDLLKEHKYSD-DTPIIRGSALCALQGT--NKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEGSC  216 (392)
Q Consensus       141 -~~~~~i~~~i~~~l~~~~~~~-~~pii~~sa~~g~~~~--n~~~~~~~~~~Ll~~i~~~~~~p~~~~~~p~r~~I~~vf  216 (392)
T Consensus       162 e~~f~~i~~~~~~~l~~~g~~~~~i~~iPiSa~~Gdni~~~s~~~~Wy~G~tLle~Ld~-~~~~~~~~~~p~r~pI~~v~  240 (443)
T PTZ00141        162 EDRYEEIQKEVCGYLKKVGYNAEKVPFVPISGFEGDNMIEKSDKMPWYKGKTLVEALDT-MEPPKRPVDKPLRLPLQGVY  240 (443)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCEEHHHHHHHHHHC-CCCCCCCCCCCCCCCEEEEE
T ss_conf             99999999999999997399956661896341246653246655644235689999856-89875655566534050388


Q ss_pred             CCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCEEECHHEEECCC-
Q ss_conf             3554454301487424534896799950687432125412100121144321001366641124543220211773267-
Q gi|254780263|r  217 GIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAPG-  295 (392)
Q Consensus       217 ~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~~-  295 (392)
T Consensus       241 ~~~g~gtvv~G~V~sG~i~~Gd~v~i~Ps~---~~~~VksI~~~~~~v~~A~aG~~V~i~L~~i~~~dI~rG~Vl~~~~~  317 (443)
T PTZ00141        241 KIGGIGTVPVGRVETGILKAGMVLTFAPSA---VTTECKSVEMHHEVVEEARPGDNVGFNVKNVSTKDIKRGHVASDSKN  317 (443)
T ss_pred             EECCCCEEEEEEEEEEEEECCCEEEECCCC---CEEEEEEEEECCCEECEECCCCEEEEECCCCCHHHCCCCEEEECCCC
T ss_conf             616873278767615699569789987799---88999899989969087869983799458986530278619766999


Q ss_pred             -CCCCCEEEEEEEEEEECCCCCCCCCCCCCCEEEEEECCEEEEEEEEE-------------CCCHHHHCCCCEEEEEEEE
Q ss_conf             -77630001689997105678755551159789999541477799996-------------1895570789769999997
Q gi|254780263|r  296 -SIQEYSRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIIL-------------SPGSQAVMPGDRVDLEVEL  361 (392)
Q Consensus       296 -~~~~~~~f~A~i~il~~~~~~~~~~~~~~~~~~~~~~~~~v~~~i~~-------------~~~~~~i~~g~~~~v~l~l  361 (392)
T Consensus       318 ~P~~~~~~F~A~v~~l~-----~~~~i~~G~~~~l~~~t~~~~~~i~~I~~~id~~t~~~~~~~p~~l~~nd~a~V~l~~  392 (443)
T PTZ00141        318 DPAKGCSKFTAQVIVLN-----HPGEIKNGYSPVVDCHTAHISCKFLNIDSKMDKRSGKVLEENPKTIKSGDAALVSLKP  392 (443)
T ss_pred             CCCCCCCEEEEEEEEEC-----CCCCCCCCCCEEEEECCCEEEEEEEEEEEEECCCCCCCCCCCCCCCCCCCEEEEEEEE
T ss_conf             99762068999999968-----9876589963699934457999999988998678776547784364999889999998


Q ss_pred             CCCEEECCC------CEEEEEECCEEEEEEEEEEEEC
Q ss_conf             781775469------8499998996999899955319
Q gi|254780263|r  362 IYPIAMEPN------QTFSMREGGKTVGAGLILEIIE  392 (392)
Q Consensus       362 ~~pi~~e~~------~rfilRd~~~tig~G~I~~v~e  392 (392)
T Consensus       393 ~~pi~~e~y~~~~~lGrFiLrd~~~Tva~G~I~~V~~  429 (443)
T PTZ00141        393 KKPMVVETFTEYPPLGRFAVRDMKQTVAVGVIKSVEK  429 (443)
T ss_pred             CCEEEECCCCCCCCCCCEEEEECCEEEEEEEEEEEEC
T ss_conf             9856783677678876199998995799999999954