HHsearch alignment for GI: 254780263 and conserved domain: PTZ00336

>PTZ00336 elongation factor 1-alpha; Provisional.
Probab=100.00  E-value=0  Score=695.17  Aligned_cols=377  Identities=31%  Similarity=0.457  Sum_probs=333.9

Q ss_pred             HCCCCEEEEEEEECCCCCHHHHHHHHHH-----------HHHHHHHCCCC--------CCCCHHHHHCCCEEEEEEEEEE
Q ss_conf             1038827999990468988789999998-----------76444200131--------2686869862920637899982
Q gi|254780263|r    7 VRNKESLGLSTIGHVDHGKTTLTAAITK-----------YYSEEKKEYGD--------IDSAPEEKLRGITIATAHVSYE   67 (392)
Q Consensus         7 ~~~k~~~ni~~iGhvd~GKSTL~~~L~~-----------~~~~~~~~~~~--------~D~~~~E~~rGiTi~~~~~~~~   67 (392)
T Consensus         2 ~~~K~~lni~~~GhVD~GKSTL~G~Ll~~~~~v~~~~l~~~~~~~~~~g~~s~~~a~~~D~~~~Er~rGiTid~~~~~f~   81 (449)
T PTZ00336          2 GKDKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKASFKYAWVLDKLKAERERGITIDIALWKFE   81 (449)
T ss_pred             CCCCCEEEEEEEECCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHCCCHHHHCCCEEEEEEEEEEE
T ss_conf             99886439999927789688889999987488478999999999987187514325451277223228758986799997


Q ss_pred             CCCEEEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCC-------CHHHHHHHHHHCCCCCEEEEECCCC--CCC
Q ss_conf             1990899984787302467798774002331452012344332-------1067788886318760233100233--356
Q gi|254780263|r   68 TDKRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPKP-------QTREHILLARQIGISSIVVYMNKVD--AVD  138 (392)
Q Consensus        68 ~~~~~i~iiD~PGH~~f~~~mi~g~~~~D~ailvVda~~G~~~-------QT~eh~~l~~~lgi~~iIv~iNKmD--~v~  138 (392)
T Consensus        82 t~~~~~~iiD~PGH~~fi~nmi~Gas~aD~aiLVVdA~~G~~e~g~~~~gQTreHl~i~~~Lgv~~iiV~vNKmD~~~v~  161 (449)
T PTZ00336         82 SPKSVFTIIDAPGHRDFIKNMITGTSQADAAILMIDSTHGGFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKTVT  161 (449)
T ss_pred             CCCEEEEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCCCEECCCCCCCCCHHHHHHHHHCCCCEEEEEEECCCCCCCC
T ss_conf             49848999868946888999997650067679999878774103556677539999999866997799998620156621


Q ss_pred             CH-HHHHHCCCCCCEEEEEEEEEE-EEECCCCEEEEEEECC--CCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCEECCC
Q ss_conf             12-221101232100111014532-2102331146764114--4456521233203443102522221000011000000
Q gi|254780263|r  139 DD-ELLDISEYEIRDLLKEHKYSD-DTPIIRGSALCALQGT--NKELGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEG  214 (392)
Q Consensus       139 ~~-~~~~~i~~~i~~~l~~~~~~~-~~pii~~sa~~g~~~~--n~~~~~~~~~~Ll~~i~~~~~~p~~~~~~p~r~~I~~  214 (392)
T Consensus       162 ~~~~r~~~i~~e~~~~l~~~g~~~~~v~~IPiSa~~Gdni~~~s~~~~Wy~GptLl~~Ld~-~~~~~r~~~~p~r~pV~~  240 (449)
T PTZ00336        162 YAQSRYDEISKEVGAYLKRVGYNPEKVRFIPISGWQGDNMIEKSDNMPWYKGPTLLDALDM-LEPPVRPVDKPLRLPLQD  240 (449)
T ss_pred             CCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCHHHHHHHC-CCCCCCCCCCCCCCCCCE
T ss_conf             1378999999999999987499900054354201047775326555754105248999754-489877566764234010


Q ss_pred             CCCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCEEECHHEEECC
Q ss_conf             01355445430148742453489679995068743212541210012114432100136664112454322021177326
Q gi|254780263|r  215 SCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAP  294 (392)
Q Consensus       215 vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~  294 (392)
T Consensus       241 vf~~~g~gtvv~G~V~sG~v~~Gd~V~i~Ps~---~~~~VksI~~~~~~v~~A~aG~~V~i~L~~i~~~dI~rGdVl~~~  317 (449)
T PTZ00336        241 VYKIGGIGTVPVGRVETGIMKPGDVVTFAPAN---VTTEVKSIEMHHEQLAEAQPGDNVGFNVKNVSVKDIRRGNVCGNS  317 (449)
T ss_pred             EEECCCCCEEEEEEEECCCCCCCCEEEECCCC---CEEEEEEEEECCCEECEECCCCEEEEECCCCCHHCCCCCCEEECC
T ss_conf             77327883188899943630589999991799---879998999899385967799847892488735307886399628


Q ss_pred             --CCCCCCEEEEEEEEEEECCCCCCCCCCCCCCEEEEEECCEEEEEEEEE-------------CCCHHHHCCCCEEEEEE
Q ss_conf             --777630001689997105678755551159789999541477799996-------------18955707897699999
Q gi|254780263|r  295 --GSIQEYSRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVTGRIIL-------------SPGSQAVMPGDRVDLEV  359 (392)
Q Consensus       295 --~~~~~~~~f~A~i~il~~~~~~~~~~~~~~~~~~~~~~~~~v~~~i~~-------------~~~~~~i~~g~~~~v~l  359 (392)
T Consensus       318 ~~~~p~~~~~F~A~v~~l~~-----~~~i~~Gy~~~l~~~t~~v~~~i~~I~~kid~~tg~~~~~~p~~l~~ndia~v~l  392 (449)
T PTZ00336        318 KNDPPKEAADFTAQVIVLNH-----PGQISNGYAPVLDCHTSHIACRFAEIESKIDRRSGKELEKNPKAIKSGDAAIVKM  392 (449)
T ss_pred             CCCCCCCCCEEEEEEEEECC-----CCCCCCCCCEEEECCCCEEEEEEEEEEEEECCCCCCEECCCCCCCCCCCEEEEEE
T ss_conf             99998414579999999678-----8765899426999653689999999889985899858056833549999899999


Q ss_pred             EECCCEEECCC------CEEEEEECCEEEEEEEEEEEEC
Q ss_conf             97781775469------8499998996999899955319
Q gi|254780263|r  360 ELIYPIAMEPN------QTFSMREGGKTVGAGLILEIIE  392 (392)
Q Consensus       360 ~l~~pi~~e~~------~rfilRd~~~tig~G~I~~v~e  392 (392)
T Consensus       393 ~~~~pi~~e~y~~~~~lGrFiLrd~~~TVa~G~I~~v~~  431 (449)
T PTZ00336        393 VPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKGVNK  431 (449)
T ss_pred             EECCCEEEECCCCCCCCCCEEEEECCEEEEEEEEEEEEC
T ss_conf             989928881356687876489998992799999999974