HHsearch alignment for GI: 254780263 and conserved domain: cd01342

>cd01342 Translation_Factor_II_like Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins. Elongation factor Tu consists of three structural domains, this family represents the second domain. Domain II adopts a beta barrel structure and is involved in binding to charged tRNA. Domain II is found in other proteins such as elongation factor G and translation initiation factor IF-2. This group also includes the C2 subdomain of domain IV of IF-2 that has the same fold as domain II of (EF-Tu). Like IF-2 from certain prokaryotes such as Thermus thermophilus, mitochondrial IF-2 lacks domain II, which is thought to be involved in binding of E.coli IF-2 to 30S subunits.
Probab=98.94  E-value=4.7e-10  Score=81.43  Aligned_cols=83  Identities=31%  Similarity=0.485  Sum_probs=73.1

Q ss_pred             CCEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCEEEC
Q ss_conf             10000000135544543014874245348967999506874321254121001211443210013666411245432202
Q gi|254780263|r  208 FLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPR  287 (392)
Q Consensus       208 ~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi~~~di~r  287 (392)
T Consensus         1 ~~~~v~~~~~~~~~g~v~~~rv~~G~l~~g~~v~~~~~-~~~~~~~v~~i~~~~~~~~~~~aG~~~~~~~~~~--~~~~~   77 (83)
T cd01342           1 LRALVFKVFKDKGRGTVATGRVESGTLKKGDKVRVGPG-GGGVKGKVKSLKRFKGEVDEAVAGDIVGIVLKDK--DDIKI   77 (83)
T ss_pred             CEEEEEEEEEECCCEEEEEEEECCCEEECCCEEEEECC-CCCEEEEEEEEEEECCCCCEECCCCEEEEEECCH--HHCCC
T ss_conf             91299999991896899999993429989999999709-9638999989999223777984898999997163--53479


Q ss_pred             HHEEEC
Q ss_conf             117732
Q gi|254780263|r  288 GRVVCA  293 (392)
Q Consensus       288 Gdvl~~  293 (392)
T Consensus        78 gd~~~~   83 (83)
T cd01342          78 GDTLTD   83 (83)
T ss_pred             CCEECC
T ss_conf             989829