HHsearch alignment for GI: 254780263 and conserved domain: cd01863

>cd01863 Rab18 Rab18 subfamily. Mammalian Rab18 is implicated in endocytic transport and is expressed most highly in polarized epithelial cells. However, trypanosomal Rab, TbRAB18, is upregulated in the BSF (Blood Stream Form) stage and localized predominantly to elements of the Golgi complex. In human and mouse cells, Rab18 has been identified in lipid droplets, organelles that store neutral lipids. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of mos
Probab=98.99  E-value=1.4e-09  Score=78.47  Aligned_cols=142  Identities=18%  Similarity=0.147  Sum_probs=85.0

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEE--EEEEECCCEEEEEEECCCCHHHHHHHHH
Q ss_conf             79999904689887899999987644420013126868698629206378--9998219908999847873024677987
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATA--HVSYETDKRFYSHIDCPGHADYVKNMIT   90 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~--~~~~~~~~~~i~iiD~PGH~~f~~~mi~   90 (392)
T Consensus         1 ~KivvvG~~~vGKTsli~r~~~~------------~f~~~~~~ti~~~~~~~~~~~~~~~~~l~iwDt~g~~~~~~~~~~   68 (161)
T cd01863           1 LKILLIGDSGVGKSSLLLRFTDD------------TFDPDLAATIGVDFKVKTLTVDGKKVKLAIWDTAGQERFRTLTSS   68 (161)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHC------------CCCCCCCCCCCCCCEEEEEEECCEEEEEEEEECCCCCCCCCCHHH
T ss_conf             98999997995799999999639------------999984873133423899999999999999999998423534224


Q ss_pred             HHHCCCCEEEEECCCCCCCCCHHHHH-HHHHHC----CCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEEC
Q ss_conf             74002331452012344332106778-888631----8760233100233356122211012321001110145322102
Q gi|254780263|r   91 GATQADGAILVCAAEDGPKPQTREHI-LLARQI----GISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPI  165 (392)
Q Consensus        91 g~~~~D~ailvVda~~G~~~QT~eh~-~l~~~l----gi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pi  165 (392)
T Consensus        69 ~~~~a~~~ilvfd~~~~~Sf~~i~~~~~~i~~~~~~~~~~-~ilVgnK~D~~~~~----v~~~~~~~~a~~~----~~~y  139 (161)
T cd01863          69 YYRGAQGVILVYDVTRRDTFTNLETWLNELETYSTNNDIV-KMLVGNKIDKENRE----VTREEGLKFARKH----NMLF  139 (161)
T ss_pred             HHHHCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCE-EEEEEECCCCCCCC----CCHHHHHHHHHHC----CCEE
T ss_conf             4132153489976782656999999999999856888873-78873104400068----9999999999986----9999


Q ss_pred             CCCEEEEEEE
Q ss_conf             3311467641
Q gi|254780263|r  166 IRGSALCALQ  175 (392)
Q Consensus       166 i~~sa~~g~~  175 (392)
T Consensus       140 ~e~Sak~g~n  149 (161)
T cd01863         140 IETSAKTRDG  149 (161)
T ss_pred             EEECCCCCCC
T ss_conf             9971586815