HHsearch alignment for GI: 254780263 and conserved domain: cd01870

>cd01870 RhoA_like RhoA-like subfamily. The RhoA subfamily consists of RhoA, RhoB, and RhoC. RhoA promotes the formation of stress fibers and focal adhesions, regulating cell shape, attachment, and motility. RhoA can bind to multiple effector proteins, thereby triggering different downstream responses. In many cell types, RhoA mediates local assembly of the contractile ring, which is necessary for cytokinesis. RhoA is vital for muscle contraction; in vascular smooth muscle cells, RhoA plays a key role in cell contraction, differentiation, migration, and proliferation. RhoA activities appear to be elaborately regulated in a time- and space-dependent manner to control cytoskeletal changes. Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Rho proteins. RhoA and RhoC are observed only in geranyl
Probab=98.59  E-value=1.8e-07  Score=65.46  Aligned_cols=140  Identities=21%  Similarity=0.167  Sum_probs=79.9

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEE-EEEECCC--EEEEEEECCCCHHHHHHHHH
Q ss_conf             99999046898878999999876444200131268686986292063789-9982199--08999847873024677987
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAH-VSYETDK--RFYSHIDCPGHADYVKNMIT   90 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~-~~~~~~~--~~i~iiD~PGH~~f~~~mi~   90 (392)
T Consensus         3 Ki~liGd~~VGKTsli~r~~~~------------~F~~~--y~pTi~~~~~~~i~~~~~~v~l~iwDtaG~e~~~~~~~~   68 (175)
T cd01870           3 KLVIVGDGACGKTCLLIVFSKD------------QFPEV--YVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPL   68 (175)
T ss_pred             EEEEECCCCCCHHHHHHHHHCC------------CCCCC--CCCCEEEEEEEEEEECCEEEEEEEEECCCCCCCCCCHHH
T ss_conf             9999998996699999999709------------89998--478436899999999999999999977766132324044


Q ss_pred             HHHCCCCEEEEECCCCCCCCCHHHHH-----HHHHH--CCCCCEEEEECCCCCCCCHHHHHH---------CCCCCCEEE
Q ss_conf             74002331452012344332106778-----88863--187602331002333561222110---------123210011
Q gi|254780263|r   91 GATQADGAILVCAAEDGPKPQTREHI-----LLARQ--IGISSIVVYMNKVDAVDDDELLDI---------SEYEIRDLL  154 (392)
Q Consensus        91 g~~~~D~ailvVda~~G~~~QT~eh~-----~l~~~--lgi~~iIv~iNKmD~v~~~~~~~~---------i~~~i~~~l  154 (392)
T Consensus        69 ~~~~a~~~ilvydi~~~---~Sf~~~~~~w~~~i~~~~~~~p-iilVgnK~DL~~~~~~~~~~~~~~~~~V~~~eg~~~a  144 (175)
T cd01870          69 SYPDTDVILMCFSIDSP---DSLENIPEKWTPEVKHFCPNVP-IILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMA  144 (175)
T ss_pred             HHCCCCEEEEEEECCCH---HHHHHHHHHHHHHHHHHCCCCC-EEEEEECCCCCCCHHHHHHHHHHCCCCCCHHHHHHHH
T ss_conf             31488789999865987---9999999999999997298998-9999872433433234566654025566899999999


Q ss_pred             EEEEEEEEEECCCCEEEEEE
Q ss_conf             10145322102331146764
Q gi|254780263|r  155 KEHKYSDDTPIIRGSALCAL  174 (392)
Q Consensus       155 ~~~~~~~~~pii~~sa~~g~  174 (392)
T Consensus       145 ~~~~---~~~f~EtSAk~~~  161 (175)
T cd01870         145 NKIG---AFGYMECSAKTKE  161 (175)
T ss_pred             HHCC---CCEEEEECCCCCC
T ss_conf             9749---9789997689997