HHsearch alignment for GI: 254780263 and conserved domain: cd01897

>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans. NOG1 is functionally linked to ribosome biogenesis and found in association with the nuclear pore complexes and identified in many preribosomal complexes. Thus, defects in NOG1 can lead to defects in 60S biogenesis. The S. cerevisiae NOG1 gene is essential for cell viability, and mutations in the predicted G motifs abrogate function. It is a member of the ODN family of GTP-binding proteins that also includes the bacterial Obg and DRG proteins.
Probab=99.58  E-value=1.4e-14  Score=109.40  Aligned_cols=150  Identities=17%  Similarity=0.180  Sum_probs=93.0

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHH----HH----
Q ss_conf             9999904689887899999987644420013126868698629206378999821990899984787302----46----
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHAD----YV----   85 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~----f~----   85 (392)
T Consensus         2 ~VaivG~pNvGKStL~N~L~g~~~~v------~~------~p~TTr~~~~~~~~~~~~~~~liDTpGi~~~~~~~~~~ie   69 (168)
T cd01897           2 TLVIAGYPNVGKSSLVNKLTRAKPEV------AP------YPFTTKSLFVGHFDYKYLRWQVIDTPGLLDRPLEERNTIE   69 (168)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEE------CC------CCCCCCCCEEEEEEECCCEEEEECCCCCCCCCHHHHHHHH
T ss_conf             79998899988999999995898602------37------5872357436899983727687248865567478888999


Q ss_pred             HHHHHHHH-CCCCEEEEECCCCCCCCCHHHHHHHHH---H--CCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEE
Q ss_conf             77987740-023314520123443321067788886---3--18760233100233356122211012321001110145
Q gi|254780263|r   86 KNMITGAT-QADGAILVCAAEDGPKPQTREHILLAR---Q--IGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKY  159 (392)
Q Consensus        86 ~~mi~g~~-~~D~ailvVda~~G~~~QT~eh~~l~~---~--lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~  159 (392)
T Consensus        70 ~~~~~~l~~~~d~il~viD~~~~~~~~~~~~~~l~~~i~~~~~~~-p~i~v~NK~Dl~~~~~~~~~-----~~~~~~---  140 (168)
T cd01897          70 MQAITALAHLRAAVLFLFDPSETCGYSLEEQLSLFEEIKPLFKNK-PVIVVLNKIDLLTFEDLSEI-----EEEEEL---  140 (168)
T ss_pred             HHHHHHHHHCCCEEEEEEECCCCCCCCHHHHHHHHHHHHHHHCCC-CEEEEEECCCCCCCCCHHHH-----HHHHHC---
T ss_conf             999999983577689999688767848999999999877652588-87999947534581007999-----999970---


Q ss_pred             EEEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHC
Q ss_conf             322102331146764114445652123320344310
Q gi|254780263|r  160 SDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDT  195 (392)
Q Consensus       160 ~~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~  195 (392)
T Consensus       141 -~~~~vi~ISA~~g~----------Gi~~L~~~i~e  165 (168)
T cd01897         141 -EGEEVLKISTLTEE----------GVDEVKNKACE  165 (168)
T ss_pred             -CCCCEEEEECCCCC----------CHHHHHHHHHH
T ss_conf             -89988999815896----------99999999999