HHsearch alignment for GI: 254780263 and conserved domain: cd03692

>cd03692 mtIF2_IVc mtIF2_IVc: this family represents the C2 subdomain of domain IV of mitochondrial translation initiation factor 2 (mtIF2) which adopts a beta-barrel fold displaying a high degree of structural similarity with domain II of the translation elongation factor EF-Tu. The C-terminal part of mtIF2 contains the entire fMet-tRNAfmet binding site of IF-2 and is resistant to proteolysis. This C-terminal portion consists of two domains, IF2 C1 and IF2 C2. IF2 C2 been shown to contain all molecular determinants necessary and sufficient for the recognition and binding of fMet-tRNAfMet. Like IF2 from certain prokaryotes such as Thermus thermophilus, mtIF2lacks domain II which is thought to be involved in binding of E.coli IF-2 to 30S subunits.
Probab=97.73  E-value=2.4e-05  Score=52.19  Aligned_cols=81  Identities=19%  Similarity=0.348  Sum_probs=69.5

Q ss_pred             EECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCEEECHH
Q ss_conf             00000013554454301487424534896799950687432125412100121144321001366641124543220211
Q gi|254780263|r  210 MHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGR  289 (392)
Q Consensus       210 ~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi~~~di~rGd  289 (392)
T Consensus         3 a~V~~vF~~~k~~~IAGc~V~~G~i~~~~~vrv~R~~~~i~~G~I~sLk~~K~~V~eV~~G~ECGi~l~~--~~d~~~GD   80 (84)
T cd03692           3 AEVRAVFKISKVGNIAGCYVTDGKIKRNAKVRVLRNGEVIYEGKISSLKRFKDDVKEVKKGYECGITLEN--FNDIKVGD   80 (84)
T ss_pred             EEEEEEEECCCCEEEEEEEEEECEEECCCEEEEEECCEEEEEEEEHHHHHCCCCCCEECCCCEEEEEECC--CCCCCCCC
T ss_conf             9999999989960898999980999729959999899999983666560034355787688186799578--47677798


Q ss_pred             EEE
Q ss_conf             773
Q gi|254780263|r  290 VVC  292 (392)
Q Consensus       290 vl~  292 (392)
T Consensus        81 ~ie   83 (84)
T cd03692          81 IIE   83 (84)
T ss_pred             EEE
T ss_conf             980