HHsearch alignment for GI: 254780263 and conserved domain: cd04091

>cd04091 mtEFG1_II_like mtEFG1_C: C-terminus of mitochondrial Elongation factor G1 (mtEFG1)-like proteins found in eukaryotes. Eukaryotic cells harbor 2 protein synthesis systems: one localized in the cytoplasm, the other in the mitochondria. Most factors regulating mitochondrial protein synthesis are encoded by nuclear genes, translated in the cytoplasm, and then transported to the mitochondria. The eukaryotic system of elongation factor (EF) components is more complex than that in prokaryotes, with both cytoplasmic and mitochondrial elongation factors and multiple isoforms being expressed in certain species. Eukaryotic EF-2 operates in the cytosolic protein synthesis machinery of eukaryotes, EF-Gs in protein synthesis in bacteria. Eukaryotic mtEFG1 proteins show significant homology to bacterial EF-Gs. Mutants in yeast mtEFG1 have impaired mitochondrial protein synthesis, respiratory defects and a tendency to lose mitochondrial DNA. There are two forms of mtEFG present in mammals
Probab=98.51  E-value=6.5e-08  Score=68.14  Aligned_cols=76  Identities=20%  Similarity=0.204  Sum_probs=53.6

Q ss_pred             CCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCC-CCCCCCCCCCCHHHHHHHCCCCCCEEECHHE
Q ss_conf             000013554454301487424534896799950687432125412100-1211443210013666411245432202117
Q gi|254780263|r  212 IEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEM-FRKKLDEAIAGDNVGLLLRGVNRADVPRGRV  290 (392)
Q Consensus       212 I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~-~~~~v~~a~aGd~v~l~Lkgi~~~di~rGdv  290 (392)
T Consensus         5 vFK~~~d~~-G~lsf~RVysG~l~~g~~v~n~~~~~~eri~~l~~~~~~~~~~v~~a~aGDIvav~--gl---~~~tGDT   78 (81)
T cd04091           5 AFKLEEGRF-GQLTYMRIYQGKLKKGDTIYNVRTGKKVRVPRLVRMHSNEMEEVEEAGAGDICAIF--GI---DCASGDT   78 (81)
T ss_pred             EEEEECCCC-CCEEEEEEEEEEECCCCEEEECCCCCEEEEEEEEEEECCCCEECCEECCCCEEEEE--CC---CCCCCCC
T ss_conf             998761899-88999999672887999999786891687202289978985076568799899998--99---9674776


Q ss_pred             EEC
Q ss_conf             732
Q gi|254780263|r  291 VCA  293 (392)
Q Consensus       291 l~~  293 (392)
T Consensus        79 L~d   81 (81)
T cd04091          79 FTD   81 (81)
T ss_pred             CCC
T ss_conf             359