HHsearch alignment for GI: 254780263 and conserved domain: cd04092

>cd04092 mtEFG2_II_like mtEFG2_C: C-terminus of mitochondrial Elongation factor G2 (mtEFG2)-like proteins found in eukaryotes. Eukaryotic cells harbor 2 protein synthesis systems: one localized in the cytoplasm, the other in the mitochondria. Most factors regulating mitochondrial protein synthesis are encoded by nuclear genes, translated in the cytoplasm, and then transported to the mitochondria. The eukaryotic system of elongation factor (EF) components is more complex than that in prokaryotes, with both cytoplasmic and mitochondrial elongation factors and multiple isoforms being expressed in certain species. Eukaryotic EF-2 operates in the cytosolic protein synthesis machinery of eukaryotes, EF-Gs in protein synthesis in bacteria. Eukaryotic mtEFG1 proteins show significant homology to bacterial EF-Gs. No clear phenotype has been found for mutants in the yeast homologue of mtEFG2, MEF2. There are two forms of mtEFG present in mammals (designated mtEFG1s and mtEFG2s) mtEFG1s are n
Probab=98.65  E-value=2.1e-08  Score=71.13  Aligned_cols=80  Identities=14%  Similarity=0.053  Sum_probs=59.0

Q ss_pred             EECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCC-CCCCCCCCCCCHHHHHHHCCCCCCEEECH
Q ss_conf             00000013554454301487424534896799950687432125412100-12114432100136664112454322021
Q gi|254780263|r  210 MHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEM-FRKKLDEAIAGDNVGLLLRGVNRADVPRG  288 (392)
Q Consensus       210 ~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~-~~~~v~~a~aGd~v~l~Lkgi~~~di~rG  288 (392)
T Consensus         3 AlVFK~~~D~~~G~ls~vRVysG~l~~g~~v~n~~~~~~ekv~~l~~~~g~~~~~v~~~~AGdI~av~----gl~~~~tG   78 (83)
T cd04092           3 ALAFKVVHDPQRGPLTFVRVYSGTLKRGSALYNTNTGKKERISRLLQPFADQYQEIPSLSAGNIGVIT----GLKQTRTG   78 (83)
T ss_pred             EEEEEEECCCCCCCEEEEEEEECEECCCCEEEECCCCCEEEEEEEEEEECCCCEECCEECCCCEEEEE----CCCCCCCC
T ss_conf             99998650798440999999707897899999688996297308889757993299789699899997----87786038


Q ss_pred             HEEEC
Q ss_conf             17732
Q gi|254780263|r  289 RVVCA  293 (392)
Q Consensus       289 dvl~~  293 (392)
T Consensus        79 DTltt   83 (83)
T cd04092          79 DTLVT   83 (83)
T ss_pred             CEECC
T ss_conf             89759