HHsearch alignment for GI: 254780263 and conserved domain: cd04104

>cd04104 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase family consists of several highly homologous proteins, including IGTP, TGTP/Mg21, IRG-47, GTPI, LRG-47, and IIGP1. They are found in higher eukaryotes where they play a role in immune resistance against intracellular pathogens. p47 proteins exist at low resting levels in mouse cells, but are strongly induced by Type II interferon (IFN-gamma). ITGP is critical for resistance to Toxoplasma gondii infection and in involved in inhibition of Coxsackievirus-B3-induced apoptosis. TGTP was shown to limit vesicular stomatitis virus (VSV) infection of fibroblasts in vitro. IRG-47 is involved in resistance to T. gondii infection. LRG-47 has been implicated in resistance to T. gondii, Listeria monocytogenes, Leishmania, and mycobacterial infections. IIGP1 has been shown to localize to the ER and to the Golgi membranes in IFN-induced cells and inflamed tissues. In macrophages, IIGP1 interacts with hook3, a microtubule binding protei
Probab=98.78  E-value=5.9e-09  Score=74.57  Aligned_cols=165  Identities=18%  Similarity=0.252  Sum_probs=97.3

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEE-EEEEEEC-CCEEEEEEECCC-------CHH
Q ss_conf             7999990468988789999998764442001312686869862920637-8999821-990899984787-------302
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIAT-AHVSYET-DKRFYSHIDCPG-------HAD   83 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~-~~~~~~~-~~~~i~iiD~PG-------H~~   83 (392)
T Consensus         2 l~iaVtGesGaGKSSfINAlRGl-~~~d~~aA~t---------Gv~eTT~~~~~Y~~p~~pnv~lwDlPG~Gt~~f~~~~   71 (197)
T cd04104           2 LNIAVTGESGAGKSSFINALRGV-GHEEEGAAPT---------GVVETTMKRTPYPHPKFPNVTLWDLPGIGSTAFPPDD   71 (197)
T ss_pred             EEEEEECCCCCCHHHHHHHHHCC-CCCCCCCCCC---------CCCCCCCCCEECCCCCCCCCEEECCCCCCCCCCCHHH
T ss_conf             17999558998689999998688-9887775888---------8874677862047999998769728999987659899


Q ss_pred             HHHHHHHHHHCCCCEEEEECCCCCCCCCHHHH-HHHHHHCCCCCEEEEECCCCCCCC------------HHHHHHCCCCC
Q ss_conf             46779877400233145201234433210677-888863187602331002333561------------22211012321
Q gi|254780263|r   84 YVKNMITGATQADGAILVCAAEDGPKPQTREH-ILLARQIGISSIVVYMNKVDAVDD------------DELLDISEYEI  150 (392)
Q Consensus        84 f~~~mi~g~~~~D~ailvVda~~G~~~QT~eh-~~l~~~lgi~~iIv~iNKmD~v~~------------~~~~~~i~~~i  150 (392)
T Consensus        72 Yl~~~--~~~~yD~fiiiss~---rf~~nd~~la~~i~~~gK~-fyfVRsK~D~dl~n~~~~~p~~f~~e~~L~~IR~~c  145 (197)
T cd04104          72 YLEEM--KFSEYDFFIIISST---RFSSNDVKLAKAIQCMGKK-FYFVRTKVDRDLSNEQRSKPRSFNREQVLQEIRDNC  145 (197)
T ss_pred             HHHHC--CCCCCCEEEEEECC---CCCHHHHHHHHHHHHCCCC-EEEEEECCCCCCCHHHHCCCCCCCHHHHHHHHHHHH
T ss_conf             99865--85545789998388---6414269999999980992-899986121400056637876659999999999999


Q ss_pred             CEEEEEEEEEEEEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCCCCCCC
Q ss_conf             0011101453221023311467641144456521233203443102522221
Q gi|254780263|r  151 RDLLKEHKYSDDTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHIPTPQR  202 (392)
Q Consensus       151 ~~~l~~~~~~~~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~~~p~~  202 (392)
T Consensus       146 ~~~L~~~gv~-~p~VFLvS~~--------~~~~yDFp~L~~tl~~~Lp~~kr  188 (197)
T cd04104         146 LENLQEAGVS-EPPVFLVSNF--------DPSDYDFPKLRETLLKDLPAHKR  188 (197)
T ss_pred             HHHHHHCCCC-CCCEEEEECC--------CCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             9999986999-9998999379--------82207768999999998089889