HHsearch alignment for GI: 254780263 and conserved domain: cd04110

>cd04110 Rab35 Rab35 subfamily. Rab35 is one of several Rab proteins to be found to participate in the regulation of osteoclast cells in rats. In addition, Rab35 has been identified as a protein that interacts with nucleophosmin-anaplastic lymphoma kinase (NPM-ALK) in human cells. Overexpression of NPM-ALK is a key oncogenic event in some anaplastic large-cell lymphomas; since Rab35 interacts with N|PM-ALK, it may provide a target for cancer treatments. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is
Probab=98.72  E-value=4.6e-08  Score=69.06  Aligned_cols=143  Identities=15%  Similarity=0.134  Sum_probs=82.0

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEEC--CCEEEEEEECCCCHHHHHHHHH
Q ss_conf             79999904689887899999987644420013126868698629206378999821--9908999847873024677987
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYET--DKRFYSHIDCPGHADYVKNMIT   90 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~--~~~~i~iiD~PGH~~f~~~mi~   90 (392)
T Consensus         7 ~KIvlvGd~~VGKTSli~r~~~~------------~F~~~~~~Tig~d~~~k~v~i~~~~v~l~iwDtaGqe~~~~l~~~   74 (199)
T cd04110           7 FKLLIIGDSGVGKSSLLLRFADN------------TFSGSYITTIGVDFKIRTVEINGERVKLQIWDTAGQERFRTITST   74 (199)
T ss_pred             EEEEEECCCCCCHHHHHHHHHCC------------CCCCCCCCCCCEEEEEEEEEECCEEEEEEEEECCCCCCCCCCHHH
T ss_conf             79999997998889999999509------------999986897555878999999999999999989998123535266


Q ss_pred             HHHCCCCEEEEECCCCCCCC-CHHHHHHHH-HHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECCCC
Q ss_conf             74002331452012344332-106778888-6318760233100233356122211012321001110145322102331
Q gi|254780263|r   91 GATQADGAILVCAAEDGPKP-QTREHILLA-RQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIRG  168 (392)
Q Consensus        91 g~~~~D~ailvVda~~G~~~-QT~eh~~l~-~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii~~  168 (392)
T Consensus        75 ~~~~a~~~ilvyDit~~~Sf~~l~~w~~~i~~~~~~~~~ilVGNK~Dl~~~r~-v--~~~e~~~~a~~~----~~~f~E~  147 (199)
T cd04110          75 YYRGTHGVIVVYDVTNGESFVNVKRWLQEIEQNCDDVCKVLVGNKNDDPERKV-V--ETEDAYKFAGQM----GISLFET  147 (199)
T ss_pred             HHHCCCCCEEEEECCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCHHHHCC-C--CHHHHHHHHHHC----CCEEEEE
T ss_conf             64246542389717988999999999999997599875799988554475469-9--999999999986----9979998


Q ss_pred             EEEEEE
Q ss_conf             146764
Q gi|254780263|r  169 SALCAL  174 (392)
Q Consensus       169 sa~~g~  174 (392)
T Consensus       148 SAktg~  153 (199)
T cd04110         148 SAKENI  153 (199)
T ss_pred             ECCCCC
T ss_conf             689992