HHsearch alignment for GI: 254780263 and conserved domain: cd04112

>cd04112 Rab26 Rab26 subfamily. First identified in rat pancreatic acinar cells, Rab26 is believed to play a role in recruiting mature granules to the plasma membrane upon beta-adrenergic stimulation. Rab26 belongs to the Rab functional group III, which are considered key regulators of intracellular vesicle transport during exocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=98.75  E-value=2.1e-08  Score=71.13  Aligned_cols=153  Identities=18%  Similarity=0.177  Sum_probs=86.4

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHHHHHHHH
Q ss_conf             99999046898878999999876444200131268686986292063789998219908999847873024677987740
Q gi|254780263|r   14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMITGAT   93 (392)
Q Consensus        14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~mi~g~~   93 (392)
T Consensus         2 KIv~vGd~~VGKTsli~r~~~~~f--------~~~~-~~~Ti~~~~~~k~~~~~~~~v~l~iwDtaG~e~~~~l~~~~~~   72 (191)
T cd04112           2 KVMLLGDSGVGKTCLLVRFKDGAF--------LNGN-FIATVGIDFRNKVVTVDGVKVKLQIWDTAGQERFRSVTHAYYR   72 (191)
T ss_pred             EEEEECCCCCCHHHHHHHHHHCCC--------CCCC-CCCCCCEEEEEEEEEECCEEEEEEEEECCCCCCCCCCHHHHHH
T ss_conf             899999499879999999995978--------9998-6776524779999999999999999979986334646477711


Q ss_pred             CCCCEEEEECCCCCCCCCHHHHH----HHHHH---CCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECC
Q ss_conf             02331452012344332106778----88863---187602331002333561222110123210011101453221023
Q gi|254780263|r   94 QADGAILVCAAEDGPKPQTREHI----LLARQ---IGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPII  166 (392)
Q Consensus        94 ~~D~ailvVda~~G~~~QT~eh~----~l~~~---lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii  166 (392)
T Consensus        73 ~a~~~ilvydit~~---~Sf~~l~~w~~~i~~~~~~~~~-iilVGNK~DL~~~r~---V~~~e~~~~a~~~----~~~f~  141 (191)
T cd04112          73 DAHALLLLYDITNK---ASFDNIRAWLTEIKEYAQEDVV-IMLLGNKADMSGERV---VKREDGERLAKEY----GVPFM  141 (191)
T ss_pred             CCCEEEEEEECCCH---HHHHHHHHHHHHHHHHCCCCCE-EEEECCCCCCCCCCC---CCHHHHHHHHHHC----CCEEE
T ss_conf             77778999727988---9999999999999986667853-898612465530267---9999999999982----99799


Q ss_pred             CCEEEEEEECCCCCCCCCCCCCHHHHHHCC
Q ss_conf             311467641144456521233203443102
Q gi|254780263|r  167 RGSALCALQGTNKELGEDSIHALMKAVDTH  196 (392)
Q Consensus       167 ~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~  196 (392)
T Consensus       142 EtSAkt~~----------nI~e~F~~i~~~  161 (191)
T cd04112         142 ETSAKTGL----------NVELAFTAVAKE  161 (191)
T ss_pred             EECCCCCC----------CHHHHHHHHHHH
T ss_conf             98548980----------979999999999