HHsearch alignment for GI: 254780263 and conserved domain: cd04116

>cd04116 Rab9 Rab9 subfamily. Rab9 is found in late endosomes, together with mannose 6-phosphate receptors (MPRs) and the tail-interacting protein of 47 kD (TIP47). Rab9 is a key mediator of vesicular transport from late endosomes to the trans-Golgi network (TGN) by redirecting the MPRs. Rab9 has been identified as a key component for the replication of several viruses, including HIV1, Ebola, Marburg, and measles, making it a potential target for inhibiting a variety of viruses. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CX
Probab=98.88  E-value=5.3e-09  Score=74.87  Aligned_cols=143  Identities=19%  Similarity=0.170  Sum_probs=82.9

Q ss_pred             CCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEEC--CCEEEEEEECCCCHHHHHH
Q ss_conf             88279999904689887899999987644420013126868698629206378999821--9908999847873024677
Q gi|254780263|r   10 KESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYET--DKRFYSHIDCPGHADYVKN   87 (392)
Q Consensus        10 k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~--~~~~i~iiD~PGH~~f~~~   87 (392)
T Consensus         3 ~~~~KivvlGd~~VGKTsli~r~~~~------------~f~~~~~~Tig~~~~~k~i~~~~~~v~l~iwDtaG~e~~~~l   70 (170)
T cd04116           3 SSLLKVILLGDGGVGKSSLMNRYVTN------------KFDTQLFHTIGVEFLNKDLEVDGHFVTLQIWDTAGQERFRSL   70 (170)
T ss_pred             CEEEEEEEECCCCCCHHHHHHHHHHC------------CCCCCCCCCCEEEEEEEEEEECCEEEEEEEEECCCCCCCCCC
T ss_conf             60899999999997899999999739------------899988887607989999999999999999989997243524


Q ss_pred             HHHHHHCCCCEEEEECCCCCCCCCHHHHHH-----HHHH------CCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEE
Q ss_conf             987740023314520123443321067788-----8863------18760233100233356122211012321001110
Q gi|254780263|r   88 MITGATQADGAILVCAAEDGPKPQTREHIL-----LARQ------IGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKE  156 (392)
Q Consensus        88 mi~g~~~~D~ailvVda~~G~~~QT~eh~~-----l~~~------lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~  156 (392)
T Consensus        71 ~~~~~~~a~~~ilvydit~~---~Sf~~~~~w~~~~~~~~~~~~~~~~p-iilvgnK~Dl~~r~----v~~~e~~~~a~~  142 (170)
T cd04116          71 RTPFYRGSDCCLLTFAVDDS---QSFQNLSNWKKEFIYYADVKEPESFP-FVVLGNKNDIPERQ----VSTEEAQAWCRE  142 (170)
T ss_pred             HHHHEECCCEEEEEEECCCH---HHHHHHHHHHHHHHHHHCCCCCCCCE-EEEEECCCHHHHCC----CCHHHHHHHHHH
T ss_conf             17660047733999978887---99999999999999971445788840-99996111130378----899999999998


Q ss_pred             EEEEEEEECCCCEEEEEEE
Q ss_conf             1453221023311467641
Q gi|254780263|r  157 HKYSDDTPIIRGSALCALQ  175 (392)
Q Consensus       157 ~~~~~~~pii~~sa~~g~~  175 (392)
T Consensus       143 ~---~~~~~~E~SAk~g~n  158 (170)
T cd04116         143 N---GDYPYFETSAKDATN  158 (170)
T ss_pred             C---CCCEEEEECCCCCCC
T ss_conf             5---997899988888818