>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily. Rheb was initially identified in rat brain, where its expression is elevated by seizures or by long-term potentiation. It is expressed ubiquitously, with elevated levels in muscle and brain. Rheb functions as an important mediator between the tuberous sclerosis complex proteins, TSC1 and TSC2, and the mammalian target of rapamycin (TOR) kinase to stimulate cell growth. TOR kinase regulates cell growth by controlling nutrient availability, growth factors, and the energy status of the cell. TSC1 and TSC2 form a dimeric complex that has tumor suppressor activity, and TSC2 is a GTPase activating protein (GAP) for Rheb. The TSC1/TSC2 complex inhibits the activation of TOR kinase through Rheb. Rheb has also been shown to induce the formation of large cytoplasmic vacuoles in a process that is dependent on the GTPase cycle of Rheb, but independent of the TOR kinase, suggesting Rheb plays a role in endocytic trafficking that le

Probab=98.61 E-value=7.7e-08 Score=67.68 Aligned_cols=140 Identities=19% Similarity=0.217 Sum_probs=79.6 Q ss_pred EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEE---EEEECCCEEEEEEECCCCHHHHHHHHH Q ss_conf 99999046898878999999876444200131268686986292063789---998219908999847873024677987 Q gi|254780263|r 14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAH---VSYETDKRFYSHIDCPGHADYVKNMIT 90 (392) Q Consensus 14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~---~~~~~~~~~i~iiD~PGH~~f~~~mi~ 90 (392) T Consensus 3 KIvlvGd~~VGKTsli~r~~~~~------------f~~~y~--~Ti~~~~~k~i~~~~~~~~l~iwDtaG~e~~~~~~~~ 68 (180) T cd04137 3 KIAVLGSRSVGKSSLTVQFVEGH------------FVESYY--PTIENTFSKIIRYKGQDYHLEIVDTAGQDEYSILPQK 68 (180) T ss_pred EEEEECCCCCCHHHHHHHHHCCC------------CCCCCC--CCCCCCCCEEEEECCEEEEEEEEECCCCCCCCHHHHH T ss_conf 89999989988999999997097------------899858--8124411379999999999999989987010066799 Q ss_pred HHHCCCCEEEEECCCCCCCCCHHHHH--HHHHHC---CCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEEC Q ss_conf 74002331452012344332106778--888631---8760233100233356122211012321001110145322102 Q gi|254780263|r 91 GATQADGAILVCAAEDGPKPQTREHI--LLARQI---GISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPI 165 (392) Q Consensus 91 g~~~~D~ailvVda~~G~~~QT~eh~--~l~~~l---gi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pi 165 (392) T Consensus 69 ~~~~a~~~ilvydvt~~~Sf~~~~~~~~~~~~~~~~~~~p-iilVgNK~DL~~~r~---V~~~e~~~~a~~~~----~~f 140 (180) T cd04137 69 YSIGIHGYILVYSVTSRKSFEVVKVIYDKILDMLGKESVP-IVLVGNKSDLHTQRQ---VSTEEGKELAESWG----AAF 140 (180) T ss_pred HHHHCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCC-EEEEEECCCCHHHCC---CCHHHHHHHHHHCC----CEE T ss_conf 9863557899974388788999999999999975888886-797765346244078---89999999999839----989 Q ss_pred CCCEEEEEEE Q ss_conf 3311467641 Q gi|254780263|r 166 IRGSALCALQ 175 (392) Q Consensus 166 i~~sa~~g~~ 175 (392) T Consensus 141 ~EtSAk~g~n 150 (180) T cd04137 141 LESSARENEN 150 (180) T ss_pred EEECCCCCCC T ss_conf 9977688919

HHsearch alignment for GI: 254780263 and conserved domain: cd04137