HHsearch alignment for GI: 254780263 and conserved domain: cd04141

>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like protein in all tissues), Rin (Ras-like protein in neurons) and Ric (Ras-related protein which interacts with calmodulin) form a subfamily with several unique structural and functional characteristics. These proteins all lack a the C-terminal CaaX lipid-binding motif typical of Ras family proteins, and Rin and Ric contain calmodulin-binding domains. Rin, which is expressed only in neurons, induces neurite outgrowth in rat pheochromocytoma cells through its association with calmodulin and its activation of endogenous Rac/cdc42. Rit, which is ubiquitously expressed in mammals, inhibits growth-factor withdrawl-mediated apoptosis and induces neurite extension in pheochromocytoma cells. Rit and Rin are both able to form a ternary complex with PAR6, a cell polarity-regulating protein, and Rac/cdc42. This ternary complex is proposed to have physiological function in processes such as tumorigenesis. Activated Ric is likely to sign
Probab=98.60  E-value=7.9e-08  Score=67.61  Aligned_cols=152  Identities=20%  Similarity=0.256  Sum_probs=87.4

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEE---EEEECCCEEEEEEECCCCHHHHHHHH
Q ss_conf             799999046898878999999876444200131268686986292063789---99821990899984787302467798
Q gi|254780263|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAH---VSYETDKRFYSHIDCPGHADYVKNMI   89 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~---~~~~~~~~~i~iiD~PGH~~f~~~mi   89 (392)
T Consensus         3 ~Kiv~lGd~~VGKTsli~r~~~~~------------f~~~~--~pTi~~~~~~~i~i~~~~~~l~iwDtaGqe~~~~l~~   68 (172)
T cd04141           3 YKIVMLGAGGVGKSAVTMQFISHS------------FPDYH--DPTIEDAYKQQARIDNEPALLDILDTAGQAEFTAMRD   68 (172)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHCC------------CCCCC--CCCCCCCEEEEEEECCEEEEEEEEECCCCCCCCCCHH
T ss_conf             699999999977999999997098------------99875--8842220369999999999999997888513574515


Q ss_pred             HHHHCCCCEEEEECCCCCCC-CCHHHHHHHH---H-HCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEE
Q ss_conf             77400233145201234433-2106778888---6-31876023310023335612221101232100111014532210
Q gi|254780263|r   90 TGATQADGAILVCAAEDGPK-PQTREHILLA---R-QIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTP  164 (392)
Q Consensus        90 ~g~~~~D~ailvVda~~G~~-~QT~eh~~l~---~-~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~p  164 (392)
T Consensus        69 ~~~r~a~~~ilvydvt~~~Sf~~~~~w~~~i~~~~~~~~~p-iilvGNK~DL~~~r~---Vs~~e~~~~a~~~----~~~  140 (172)
T cd04141          69 QYMRCGEGFIICYSVTDRHSFQEASEFKKLITRVRLTEDIP-LVLVGNKVDLESQRQ---VTTEEGRNLAREF----NCP  140 (172)
T ss_pred             HHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHCCCCCC-EEEEEECCCHHHHCC---CCHHHHHHHHHHC----CCE
T ss_conf             56427865688731688889999999999999972889986-899850456676188---8999999999985----997


Q ss_pred             CCCCEEEEEEECCCCCCCCCCCCCHHHHHHCC
Q ss_conf             23311467641144456521233203443102
Q gi|254780263|r  165 IIRGSALCALQGTNKELGEDSIHALMKAVDTH  196 (392)
Q Consensus       165 ii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~  196 (392)
T Consensus       141 f~EtSAk~~~n----------V~e~F~~l~~~  162 (172)
T cd04141         141 FFETSAALRHY----------IDDAFHGLVRE  162 (172)
T ss_pred             EEEECCCCCCC----------HHHHHHHHHHH
T ss_conf             99974788828----------89999999999